| Basic Information | |
|---|---|
| Family ID | F017367 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 241 |
| Average Sequence Length | 45 residues |
| Representative Sequence | MIFRRKLLAVFALTVFLSVAAVAGLVLAVTRRAFERSEDERT |
| Number of Associated Samples | 207 |
| Number of Associated Scaffolds | 241 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 82.57 % |
| % of genes near scaffold ends (potentially truncated) | 99.17 % |
| % of genes from short scaffolds (< 2000 bps) | 91.70 % |
| Associated GOLD sequencing projects | 200 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.51 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (92.116 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (10.788 % of family members) |
| Environment Ontology (ENVO) | Unclassified (22.822 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (48.963 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 52.86% β-sheet: 0.00% Coil/Unstructured: 47.14% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.51 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 241 Family Scaffolds |
|---|---|---|
| PF00496 | SBP_bac_5 | 46.89 |
| PF01145 | Band_7 | 3.32 |
| PF00285 | Citrate_synt | 0.41 |
| PF10009 | DUF2252 | 0.41 |
| PF01717 | Meth_synt_2 | 0.41 |
| PF13520 | AA_permease_2 | 0.41 |
| PF03734 | YkuD | 0.41 |
| PF00926 | DHBP_synthase | 0.41 |
| PF12838 | Fer4_7 | 0.41 |
| COG ID | Name | Functional Category | % Frequency in 241 Family Scaffolds |
|---|---|---|---|
| COG0108 | 3,4-dihydroxy-2-butanone 4-phosphate synthase | Coenzyme transport and metabolism [H] | 0.41 |
| COG0372 | Citrate synthase | Energy production and conversion [C] | 0.41 |
| COG0620 | Methionine synthase II (cobalamin-independent) | Amino acid transport and metabolism [E] | 0.41 |
| COG1376 | Lipoprotein-anchoring transpeptidase ErfK/SrfK | Cell wall/membrane/envelope biogenesis [M] | 0.41 |
| COG3034 | Murein L,D-transpeptidase YafK | Cell wall/membrane/envelope biogenesis [M] | 0.41 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 92.12 % |
| Unclassified | root | N/A | 7.88 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001151|JGI12713J13577_1009370 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 869 | Open in IMG/M |
| 3300001593|JGI12635J15846_10217688 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1249 | Open in IMG/M |
| 3300004152|Ga0062386_101136957 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 648 | Open in IMG/M |
| 3300005290|Ga0065712_10726144 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
| 3300005332|Ga0066388_107222290 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 558 | Open in IMG/M |
| 3300005435|Ga0070714_101250316 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 725 | Open in IMG/M |
| 3300005435|Ga0070714_102152783 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 543 | Open in IMG/M |
| 3300005468|Ga0070707_102052286 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 539 | Open in IMG/M |
| 3300005541|Ga0070733_10850691 | Not Available | 613 | Open in IMG/M |
| 3300005542|Ga0070732_10670377 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 631 | Open in IMG/M |
| 3300005547|Ga0070693_100391304 | All Organisms → cellular organisms → Bacteria | 961 | Open in IMG/M |
| 3300005554|Ga0066661_10206033 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1218 | Open in IMG/M |
| 3300005555|Ga0066692_10152773 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1418 | Open in IMG/M |
| 3300005556|Ga0066707_10878463 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 550 | Open in IMG/M |
| 3300005569|Ga0066705_10394463 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 868 | Open in IMG/M |
| 3300005575|Ga0066702_10205201 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1194 | Open in IMG/M |
| 3300005578|Ga0068854_100152311 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1784 | Open in IMG/M |
| 3300005586|Ga0066691_10511165 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 717 | Open in IMG/M |
| 3300005610|Ga0070763_10285653 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 903 | Open in IMG/M |
| 3300005614|Ga0068856_102368288 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 539 | Open in IMG/M |
| 3300005712|Ga0070764_10837615 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 573 | Open in IMG/M |
| 3300005834|Ga0068851_10251715 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1002 | Open in IMG/M |
| 3300005952|Ga0080026_10021471 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1576 | Open in IMG/M |
| 3300006028|Ga0070717_10140100 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2086 | Open in IMG/M |
| 3300006028|Ga0070717_10297904 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1433 | Open in IMG/M |
| 3300006028|Ga0070717_10748766 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 888 | Open in IMG/M |
| 3300006052|Ga0075029_101138278 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 543 | Open in IMG/M |
| 3300006162|Ga0075030_100750313 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 772 | Open in IMG/M |
| 3300006173|Ga0070716_101402775 | Not Available | 568 | Open in IMG/M |
| 3300006176|Ga0070765_100110443 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2394 | Open in IMG/M |
| 3300006176|Ga0070765_101604791 | Not Available | 612 | Open in IMG/M |
| 3300006176|Ga0070765_101757215 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 582 | Open in IMG/M |
| 3300006755|Ga0079222_11085132 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 701 | Open in IMG/M |
| 3300006796|Ga0066665_10992547 | All Organisms → cellular organisms → Bacteria | 645 | Open in IMG/M |
| 3300006804|Ga0079221_10304212 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 937 | Open in IMG/M |
| 3300006854|Ga0075425_101643757 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 723 | Open in IMG/M |
| 3300009088|Ga0099830_10000062 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 33367 | Open in IMG/M |
| 3300009088|Ga0099830_10184977 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1623 | Open in IMG/M |
| 3300009088|Ga0099830_11860688 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 503 | Open in IMG/M |
| 3300009521|Ga0116222_1013978 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3725 | Open in IMG/M |
| 3300009521|Ga0116222_1529708 | Not Available | 517 | Open in IMG/M |
| 3300009524|Ga0116225_1341825 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 667 | Open in IMG/M |
| 3300009551|Ga0105238_10167126 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2176 | Open in IMG/M |
| 3300009616|Ga0116111_1030724 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1733 | Open in IMG/M |
| 3300009698|Ga0116216_10543533 | Not Available | 701 | Open in IMG/M |
| 3300009700|Ga0116217_10458867 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 804 | Open in IMG/M |
| 3300009824|Ga0116219_10195739 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1158 | Open in IMG/M |
| 3300010043|Ga0126380_10777534 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 780 | Open in IMG/M |
| 3300010043|Ga0126380_10779062 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 780 | Open in IMG/M |
| 3300010048|Ga0126373_13160135 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 513 | Open in IMG/M |
| 3300010048|Ga0126373_13276750 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 504 | Open in IMG/M |
| 3300010359|Ga0126376_11381467 | All Organisms → cellular organisms → Bacteria | 728 | Open in IMG/M |
| 3300010360|Ga0126372_10778762 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 945 | Open in IMG/M |
| 3300010361|Ga0126378_10690060 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1133 | Open in IMG/M |
| 3300010366|Ga0126379_11429218 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 797 | Open in IMG/M |
| 3300010373|Ga0134128_10515283 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1333 | Open in IMG/M |
| 3300010376|Ga0126381_101053089 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1174 | Open in IMG/M |
| 3300010376|Ga0126381_103513366 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 615 | Open in IMG/M |
| 3300010379|Ga0136449_100132310 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4965 | Open in IMG/M |
| 3300010379|Ga0136449_102976758 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 662 | Open in IMG/M |
| 3300010398|Ga0126383_13509771 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 512 | Open in IMG/M |
| 3300010937|Ga0137776_1270211 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 969 | Open in IMG/M |
| 3300011083|Ga0138560_1093839 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 506 | Open in IMG/M |
| 3300011271|Ga0137393_11230808 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 635 | Open in IMG/M |
| 3300011271|Ga0137393_11521747 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 559 | Open in IMG/M |
| 3300012096|Ga0137389_10928925 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 746 | Open in IMG/M |
| 3300012205|Ga0137362_11215999 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 638 | Open in IMG/M |
| 3300012210|Ga0137378_10827193 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 839 | Open in IMG/M |
| 3300012349|Ga0137387_10920305 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 631 | Open in IMG/M |
| 3300012357|Ga0137384_10413755 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1112 | Open in IMG/M |
| 3300012361|Ga0137360_11171661 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 664 | Open in IMG/M |
| 3300012362|Ga0137361_10839355 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 835 | Open in IMG/M |
| 3300012917|Ga0137395_10437902 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 938 | Open in IMG/M |
| 3300012918|Ga0137396_10417078 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 995 | Open in IMG/M |
| 3300012971|Ga0126369_12719059 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 579 | Open in IMG/M |
| 3300012975|Ga0134110_10290873 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 703 | Open in IMG/M |
| 3300012984|Ga0164309_10885550 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 726 | Open in IMG/M |
| 3300013100|Ga0157373_10055091 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2825 | Open in IMG/M |
| 3300013100|Ga0157373_10802553 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 694 | Open in IMG/M |
| 3300013297|Ga0157378_11166769 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 809 | Open in IMG/M |
| 3300013306|Ga0163162_12013510 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 662 | Open in IMG/M |
| 3300014169|Ga0181531_10287965 | Not Available | 1004 | Open in IMG/M |
| 3300014169|Ga0181531_10578980 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 695 | Open in IMG/M |
| 3300014200|Ga0181526_10360493 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 924 | Open in IMG/M |
| 3300014495|Ga0182015_10431729 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 847 | Open in IMG/M |
| 3300014501|Ga0182024_10368871 | All Organisms → cellular organisms → Bacteria | 1869 | Open in IMG/M |
| 3300014655|Ga0181516_10459793 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 652 | Open in IMG/M |
| 3300014658|Ga0181519_10138291 | Not Available | 1558 | Open in IMG/M |
| 3300014838|Ga0182030_10451729 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1308 | Open in IMG/M |
| 3300015241|Ga0137418_10349295 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1221 | Open in IMG/M |
| 3300015242|Ga0137412_10152939 | All Organisms → cellular organisms → Bacteria | 1860 | Open in IMG/M |
| 3300015356|Ga0134073_10088937 | All Organisms → cellular organisms → Bacteria | 895 | Open in IMG/M |
| 3300015373|Ga0132257_100499206 | Not Available | 1492 | Open in IMG/M |
| 3300015374|Ga0132255_100435261 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1916 | Open in IMG/M |
| 3300017823|Ga0187818_10121231 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1134 | Open in IMG/M |
| 3300017927|Ga0187824_10023493 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1829 | Open in IMG/M |
| 3300017933|Ga0187801_10215761 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 763 | Open in IMG/M |
| 3300017933|Ga0187801_10511951 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 506 | Open in IMG/M |
| 3300017938|Ga0187854_10312902 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 669 | Open in IMG/M |
| 3300017943|Ga0187819_10019967 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3893 | Open in IMG/M |
| 3300017943|Ga0187819_10847448 | Not Available | 512 | Open in IMG/M |
| 3300017955|Ga0187817_10502243 | All Organisms → cellular organisms → Bacteria | 774 | Open in IMG/M |
| 3300017955|Ga0187817_11031260 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 527 | Open in IMG/M |
| 3300017975|Ga0187782_10913400 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 681 | Open in IMG/M |
| 3300017995|Ga0187816_10199762 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 869 | Open in IMG/M |
| 3300017999|Ga0187767_10042454 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1096 | Open in IMG/M |
| 3300018008|Ga0187888_1107955 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1178 | Open in IMG/M |
| 3300018014|Ga0187860_1120072 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1165 | Open in IMG/M |
| 3300018025|Ga0187885_10020049 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3852 | Open in IMG/M |
| 3300018030|Ga0187869_10299389 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 774 | Open in IMG/M |
| 3300018042|Ga0187871_10496292 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 675 | Open in IMG/M |
| 3300018042|Ga0187871_10763507 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 539 | Open in IMG/M |
| 3300018043|Ga0187887_10276519 | Not Available | 993 | Open in IMG/M |
| 3300018047|Ga0187859_10139585 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1282 | Open in IMG/M |
| 3300018086|Ga0187769_10660008 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 790 | Open in IMG/M |
| 3300018086|Ga0187769_11201845 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 574 | Open in IMG/M |
| 3300018090|Ga0187770_11003615 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 671 | Open in IMG/M |
| 3300018431|Ga0066655_10019395 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3139 | Open in IMG/M |
| 3300018431|Ga0066655_11099008 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 556 | Open in IMG/M |
| 3300018433|Ga0066667_10132225 | All Organisms → cellular organisms → Bacteria | 1727 | Open in IMG/M |
| 3300018482|Ga0066669_10917097 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 785 | Open in IMG/M |
| 3300019888|Ga0193751_1019077 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3419 | Open in IMG/M |
| 3300019890|Ga0193728_1160868 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 979 | Open in IMG/M |
| 3300020034|Ga0193753_10030979 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3028 | Open in IMG/M |
| 3300020579|Ga0210407_11356424 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 529 | Open in IMG/M |
| 3300020580|Ga0210403_10478911 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1012 | Open in IMG/M |
| 3300020581|Ga0210399_10716990 | All Organisms → cellular organisms → Bacteria | 821 | Open in IMG/M |
| 3300020582|Ga0210395_10260649 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1303 | Open in IMG/M |
| 3300020583|Ga0210401_10353737 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1330 | Open in IMG/M |
| 3300020583|Ga0210401_10414534 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1209 | Open in IMG/M |
| 3300021046|Ga0215015_10724652 | All Organisms → cellular organisms → Bacteria | 665 | Open in IMG/M |
| 3300021088|Ga0210404_10503013 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 685 | Open in IMG/M |
| 3300021170|Ga0210400_10105211 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2239 | Open in IMG/M |
| 3300021171|Ga0210405_10790671 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 728 | Open in IMG/M |
| 3300021178|Ga0210408_10678739 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 812 | Open in IMG/M |
| 3300021401|Ga0210393_10910806 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 713 | Open in IMG/M |
| 3300021402|Ga0210385_10124885 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1820 | Open in IMG/M |
| 3300021403|Ga0210397_10183390 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1486 | Open in IMG/M |
| 3300021403|Ga0210397_10642680 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 813 | Open in IMG/M |
| 3300021406|Ga0210386_10244583 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1529 | Open in IMG/M |
| 3300021406|Ga0210386_10247435 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1520 | Open in IMG/M |
| 3300021433|Ga0210391_10309906 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1238 | Open in IMG/M |
| 3300021475|Ga0210392_10503115 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 893 | Open in IMG/M |
| 3300021477|Ga0210398_10474586 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1019 | Open in IMG/M |
| 3300021477|Ga0210398_11625054 | Not Available | 500 | Open in IMG/M |
| 3300021560|Ga0126371_12831159 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 588 | Open in IMG/M |
| 3300021858|Ga0213852_1300775 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 550 | Open in IMG/M |
| 3300021860|Ga0213851_1570434 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 974 | Open in IMG/M |
| 3300021861|Ga0213853_10233513 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 500 | Open in IMG/M |
| 3300022557|Ga0212123_10241312 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1304 | Open in IMG/M |
| 3300023056|Ga0233357_1025527 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 716 | Open in IMG/M |
| 3300023259|Ga0224551_1095188 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 526 | Open in IMG/M |
| 3300025501|Ga0208563_1001087 | All Organisms → cellular organisms → Bacteria | 19619 | Open in IMG/M |
| 3300025576|Ga0208820_1108670 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 669 | Open in IMG/M |
| 3300025905|Ga0207685_10046279 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1655 | Open in IMG/M |
| 3300025912|Ga0207707_10359652 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1253 | Open in IMG/M |
| 3300025916|Ga0207663_11701805 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 507 | Open in IMG/M |
| 3300025923|Ga0207681_11492487 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 567 | Open in IMG/M |
| 3300025932|Ga0207690_11434392 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 577 | Open in IMG/M |
| 3300025992|Ga0208775_1001428 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1548 | Open in IMG/M |
| 3300026078|Ga0207702_12194972 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 541 | Open in IMG/M |
| 3300026118|Ga0207675_101103836 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 813 | Open in IMG/M |
| 3300026217|Ga0209871_1015547 | Not Available | 1416 | Open in IMG/M |
| 3300026467|Ga0257154_1025224 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 879 | Open in IMG/M |
| 3300026557|Ga0179587_10287740 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1057 | Open in IMG/M |
| 3300026928|Ga0207779_1024799 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 741 | Open in IMG/M |
| 3300027024|Ga0207819_1046428 | Not Available | 522 | Open in IMG/M |
| 3300027045|Ga0207726_1014941 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1261 | Open in IMG/M |
| 3300027064|Ga0208724_1021025 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 654 | Open in IMG/M |
| 3300027080|Ga0208237_1049917 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 624 | Open in IMG/M |
| 3300027548|Ga0209523_1025477 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1171 | Open in IMG/M |
| 3300027583|Ga0209527_1092557 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 679 | Open in IMG/M |
| 3300027610|Ga0209528_1041458 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1020 | Open in IMG/M |
| 3300027692|Ga0209530_1020914 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1974 | Open in IMG/M |
| 3300027765|Ga0209073_10165040 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 825 | Open in IMG/M |
| 3300027783|Ga0209448_10017286 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2354 | Open in IMG/M |
| 3300027826|Ga0209060_10468659 | Not Available | 572 | Open in IMG/M |
| 3300027842|Ga0209580_10472567 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 625 | Open in IMG/M |
| 3300027862|Ga0209701_10628334 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 565 | Open in IMG/M |
| 3300027884|Ga0209275_10173587 | Not Available | 1154 | Open in IMG/M |
| 3300027889|Ga0209380_10620130 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 625 | Open in IMG/M |
| 3300027905|Ga0209415_10408478 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1092 | Open in IMG/M |
| 3300027915|Ga0209069_10819918 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 557 | Open in IMG/M |
| 3300028017|Ga0265356_1015156 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 837 | Open in IMG/M |
| 3300028036|Ga0265355_1014741 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 657 | Open in IMG/M |
| 3300028536|Ga0137415_10268917 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1511 | Open in IMG/M |
| 3300028780|Ga0302225_10035549 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2492 | Open in IMG/M |
| 3300028780|Ga0302225_10506550 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 563 | Open in IMG/M |
| 3300028798|Ga0302222_10027793 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2315 | Open in IMG/M |
| 3300028808|Ga0302228_10048237 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2058 | Open in IMG/M |
| 3300028874|Ga0302155_10132115 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1104 | Open in IMG/M |
| 3300028906|Ga0308309_10491229 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1060 | Open in IMG/M |
| 3300028906|Ga0308309_11335705 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 616 | Open in IMG/M |
| 3300029914|Ga0311359_10246060 | All Organisms → cellular organisms → Bacteria | 1524 | Open in IMG/M |
| 3300030056|Ga0302181_10278836 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 748 | Open in IMG/M |
| 3300030058|Ga0302179_10115268 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1186 | Open in IMG/M |
| 3300030509|Ga0302183_10100158 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1141 | Open in IMG/M |
| 3300030520|Ga0311372_10464614 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1878 | Open in IMG/M |
| 3300030580|Ga0311355_10413743 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1316 | Open in IMG/M |
| 3300030618|Ga0311354_10020864 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 8082 | Open in IMG/M |
| 3300030737|Ga0302310_10672662 | Not Available | 540 | Open in IMG/M |
| 3300030906|Ga0302314_11376176 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 647 | Open in IMG/M |
| 3300031090|Ga0265760_10124416 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 830 | Open in IMG/M |
| 3300031231|Ga0170824_117304036 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1434 | Open in IMG/M |
| 3300031233|Ga0302307_10309511 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 807 | Open in IMG/M |
| 3300031249|Ga0265339_10126824 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1308 | Open in IMG/M |
| 3300031474|Ga0170818_111546857 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 617 | Open in IMG/M |
| 3300031679|Ga0318561_10084766 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1646 | Open in IMG/M |
| 3300031708|Ga0310686_115196818 | Not Available | 567 | Open in IMG/M |
| 3300031711|Ga0265314_10465615 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 671 | Open in IMG/M |
| 3300031715|Ga0307476_11111696 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 580 | Open in IMG/M |
| 3300031718|Ga0307474_10834022 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 729 | Open in IMG/M |
| 3300031718|Ga0307474_11250619 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 586 | Open in IMG/M |
| 3300031718|Ga0307474_11518766 | Not Available | 527 | Open in IMG/M |
| 3300031719|Ga0306917_10802309 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 738 | Open in IMG/M |
| 3300031720|Ga0307469_11254206 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 702 | Open in IMG/M |
| 3300031788|Ga0302319_10684064 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1044 | Open in IMG/M |
| 3300031820|Ga0307473_10504123 | All Organisms → cellular organisms → Bacteria | 817 | Open in IMG/M |
| 3300031820|Ga0307473_10963650 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 620 | Open in IMG/M |
| 3300031823|Ga0307478_10645946 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 886 | Open in IMG/M |
| 3300031823|Ga0307478_11023063 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 690 | Open in IMG/M |
| 3300031823|Ga0307478_11531300 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 551 | Open in IMG/M |
| 3300031890|Ga0306925_11343512 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 708 | Open in IMG/M |
| 3300031912|Ga0306921_11723396 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 677 | Open in IMG/M |
| 3300031912|Ga0306921_12464701 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 541 | Open in IMG/M |
| 3300031959|Ga0318530_10117889 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1064 | Open in IMG/M |
| 3300031962|Ga0307479_11168943 | Not Available | 734 | Open in IMG/M |
| 3300032035|Ga0310911_10411445 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 783 | Open in IMG/M |
| 3300032160|Ga0311301_11483127 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 837 | Open in IMG/M |
| 3300032180|Ga0307471_101812880 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 761 | Open in IMG/M |
| 3300032770|Ga0335085_11068439 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 867 | Open in IMG/M |
| 3300032782|Ga0335082_11074080 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 670 | Open in IMG/M |
| 3300032783|Ga0335079_10720460 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1040 | Open in IMG/M |
| 3300032829|Ga0335070_11908723 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 536 | Open in IMG/M |
| 3300032898|Ga0335072_10713619 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 978 | Open in IMG/M |
| 3300032954|Ga0335083_10869319 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 718 | Open in IMG/M |
| 3300032954|Ga0335083_11401285 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 534 | Open in IMG/M |
| 3300032955|Ga0335076_11193415 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 645 | Open in IMG/M |
| 3300033290|Ga0318519_10319052 | All Organisms → cellular organisms → Bacteria | 913 | Open in IMG/M |
| 3300034125|Ga0370484_0009560 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 2047 | Open in IMG/M |
| 3300034163|Ga0370515_0365374 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 609 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 10.79% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 7.88% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.39% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 5.39% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.98% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 4.56% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 3.73% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.73% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 3.73% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.32% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.32% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.32% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.90% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.90% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 2.07% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.07% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.66% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.66% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.66% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.66% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.66% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 1.66% |
| Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 1.24% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 1.24% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.24% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.24% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 1.24% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.83% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.83% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.83% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.83% |
| Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 0.83% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.83% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.83% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.83% |
| Sediment | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Sediment | 0.41% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.41% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.41% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.41% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.41% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.41% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.41% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.41% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.41% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.41% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.41% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.41% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.41% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.41% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.41% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.41% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.41% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001151 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O3 | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
| 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Host-Associated | Open in IMG/M |
| 3300005952 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-045 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009521 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG | Environmental | Open in IMG/M |
| 3300009524 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG | Environmental | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009616 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_100 | Environmental | Open in IMG/M |
| 3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010937 | Fumarole sediment microbial communities, Furnas, Sao Miguel, Azores. Combined Assembly of Gp0156138, Gp0156139 | Environmental | Open in IMG/M |
| 3300011083 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 45 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014169 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaG | Environmental | Open in IMG/M |
| 3300014200 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaG | Environmental | Open in IMG/M |
| 3300014495 | Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014655 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_10_metaG | Environmental | Open in IMG/M |
| 3300014658 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_10_metaG | Environmental | Open in IMG/M |
| 3300014838 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015356 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
| 3300017927 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_4 | Environmental | Open in IMG/M |
| 3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
| 3300017938 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_150 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
| 3300017999 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_10_MG | Environmental | Open in IMG/M |
| 3300018008 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_40 | Environmental | Open in IMG/M |
| 3300018014 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_40 | Environmental | Open in IMG/M |
| 3300018025 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_100 | Environmental | Open in IMG/M |
| 3300018030 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_100 | Environmental | Open in IMG/M |
| 3300018042 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10 | Environmental | Open in IMG/M |
| 3300018043 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10 | Environmental | Open in IMG/M |
| 3300018047 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10 | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019888 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2 | Environmental | Open in IMG/M |
| 3300019890 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1 | Environmental | Open in IMG/M |
| 3300020034 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1c2 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021046 | Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depth | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300021858 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2015 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021860 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2014 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021861 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300023056 | Soil microbial communities from Shasta-Trinity National Forest, California, United States - GEON-SFM-MS2 | Environmental | Open in IMG/M |
| 3300023259 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P3 20-24 | Environmental | Open in IMG/M |
| 3300025501 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300025576 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025992 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_104 (SPAdes) | Environmental | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026217 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-045 (SPAdes) | Environmental | Open in IMG/M |
| 3300026467 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-16-A | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300026928 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 44 (SPAdes) | Environmental | Open in IMG/M |
| 3300027024 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 42 (SPAdes) | Environmental | Open in IMG/M |
| 3300027045 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 40 (SPAdes) | Environmental | Open in IMG/M |
| 3300027064 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF003 (SPAdes) | Environmental | Open in IMG/M |
| 3300027080 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF009 (SPAdes) | Environmental | Open in IMG/M |
| 3300027548 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027583 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027610 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027692 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027765 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes) | Environmental | Open in IMG/M |
| 3300027783 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027826 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300027915 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300028017 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 | Host-Associated | Open in IMG/M |
| 3300028036 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 | Host-Associated | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028780 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_2 | Environmental | Open in IMG/M |
| 3300028798 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_2 | Environmental | Open in IMG/M |
| 3300028808 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_2 | Environmental | Open in IMG/M |
| 3300028874 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N3_1 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029914 | III_Bog_E2 coassembly | Environmental | Open in IMG/M |
| 3300030056 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_3 | Environmental | Open in IMG/M |
| 3300030058 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_1 | Environmental | Open in IMG/M |
| 3300030509 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_2 | Environmental | Open in IMG/M |
| 3300030520 | III_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300030580 | II_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300030618 | II_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030737 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_2 | Environmental | Open in IMG/M |
| 3300030906 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N2_3 | Environmental | Open in IMG/M |
| 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031233 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_2 | Environmental | Open in IMG/M |
| 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Host-Associated | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Host-Associated | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031788 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_2 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031959 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
| 3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| 3300034125 | Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_tus_01_15 | Environmental | Open in IMG/M |
| 3300034163 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_04D_14 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12713J13577_10093702 | 3300001151 | Forest Soil | MFRRKLLSVFALTVFLSVAAVAWLVSEVTRRAFVR |
| JGI12635J15846_102176881 | 3300001593 | Forest Soil | MTFRRKLLAVFALTVFSSVATVGWLVSTLSRRAFERADDERTSALVTQFRHEFNRQGE |
| Ga0062386_1011369572 | 3300004152 | Bog Forest Soil | MMFRRKLLAVFALTVCVSVGAVTALVLAVTRRAFEKTEEERIAALVA |
| Ga0065712_107261441 | 3300005290 | Miscanthus Rhizosphere | VSFRRKLLLVFSLTVFVSVATVAWVVSVFTRRTFERASDE |
| Ga0066388_1072222902 | 3300005332 | Tropical Forest Soil | MSFRRKLLTVFALTVFLSVTSVALLVQFLTRGAFEKAENQRTSAL |
| Ga0070714_1012503161 | 3300005435 | Agricultural Soil | MSFRRKLLLVFSASVALSVAAVAWLVQEVTRKAFEETENQRTSQLVGQFQ |
| Ga0070714_1021527832 | 3300005435 | Agricultural Soil | MTFRRKLLLVFALTVFLSVAGVALLVQWVTRNAFEKTENQR |
| Ga0070707_1020522862 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | LSFGRKLLLVFALTVFLSVGAVTWIVSAVTRRAFERANEAQT |
| Ga0070733_108506911 | 3300005541 | Surface Soil | MMFRRKLLGVFALTVFLSVAAVALLVSAVTRRAFDR |
| Ga0070732_106703771 | 3300005542 | Surface Soil | MSFRRKLLTVFALTVFLSVASVALLVQFLTRGAFEKTENQRTSALVAQFQHE |
| Ga0070693_1003913041 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | VSFRRKLLLAFGLTVVLSVITVAWIASVVTRRAFEQADNERSAALVA |
| Ga0066661_102060332 | 3300005554 | Soil | MSFRRKLLAVFALTVFVSVAGVAWIVSAVTRRAFEQADAERTVALTAQFR |
| Ga0066692_101527732 | 3300005555 | Soil | MSFRRKLLAVFGLTVFVSVAAVTWIVSISTRRTFERA |
| Ga0066707_108784632 | 3300005556 | Soil | MSFRRKLLAVFGLTVFVSVAAVTWIVSVSTRRTFERANE |
| Ga0066705_103944631 | 3300005569 | Soil | LNFRRKLLLLFALTVFLSVAAVAWLVSTVTRRAFEQSNEAQTAAL |
| Ga0066702_102052012 | 3300005575 | Soil | MIFRRKLLAVFALTVFLSVVAVAAMVLVVTRRAFEKNEEQRTSALV |
| Ga0068854_1001523113 | 3300005578 | Corn Rhizosphere | VSFRRKLLLAFALTVVLSVITVAWIASVVTRRAFEQADNERSAALVAQFRHEFA |
| Ga0066691_105111652 | 3300005586 | Soil | VTFRRKLLVVFALTVFLSVAAVAWLVSSVTRRAFERTEDERTTALFTQ |
| Ga0070763_102856531 | 3300005610 | Soil | MIFRRKLLGVFALTVFVSVAAVAVLVLEVTRRAFEKT |
| Ga0068856_1023682882 | 3300005614 | Corn Rhizosphere | LSFRRKLSLVFALTVFLSVGAVTWIVSSVTRRAFEH |
| Ga0070764_108376151 | 3300005712 | Soil | MMFRRKLLAVFALTVFVSVAAVAGLVLAFTRPAFEKTEEQRTAALVAQF |
| Ga0068851_102517152 | 3300005834 | Corn Rhizosphere | LSFRRKLLLVFALTVFLCVGAVTWIVSSVTRRAFERANEAQTTA |
| Ga0080026_100214711 | 3300005952 | Permafrost Soil | MTFRRKLLAVFALTVFLSVGAVAWLVLALTRNAFEKTEDQRTAAL |
| Ga0070717_101401003 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MSFRRKLLAVFAMTVVLSVAGVAFMVSAMTRRAFERTEEQRTTA |
| Ga0070717_102979042 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MTFRRKLLAIFALTVFLSVTAVALLVQWVTRNAFEKAEGQRTASLVAQFQR |
| Ga0070717_107487662 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | VTFRRKLLTVFALTVFLSVAGVALLVQWLTRGAFEKTENERTAALVAQFQK |
| Ga0075029_1011382782 | 3300006052 | Watersheds | MSFSRKLLAVFALTVFLSVAAVALLVIAVTRNAFEKTEEQRTTALVTQ |
| Ga0075030_1007503131 | 3300006162 | Watersheds | MIFRRKLLAVFALTVFLSVAAVAGLVLAVTRRAFERSEDER |
| Ga0070716_1014027751 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | VSFRRKLFLVFALTVFLCVGAVAWIVSAMTRRAFERANEDQT |
| Ga0070765_1001104433 | 3300006176 | Soil | MMFRRKLLAVFALTVFLSVAGVAWLVSEVTRRAFVQSDDERTAALLTQ |
| Ga0070765_1016047912 | 3300006176 | Soil | MMFRRKLLTVFALTVFLSVAAVAWLVSEVTRRAFVRSDDERTAALVAQF |
| Ga0070765_1017572152 | 3300006176 | Soil | MTFRRKLLVVFALTVFLSVAAVALLVSEVTRRAFDRSEDERTAALVTQFRRAFNR |
| Ga0079222_110851322 | 3300006755 | Agricultural Soil | VSFRRKLLLVFSLTVFVSVATVAWVVSVFTRRTFERASDERTA |
| Ga0066665_109925471 | 3300006796 | Soil | MSFRRKLLAVFALTVSVSVGSVAWIVLVLSRHAFERADAEHTAALVAQFRR |
| Ga0079221_103042122 | 3300006804 | Agricultural Soil | VSFRRKLLLVFSLTVFVSVATVAWVVSVFTRRTFE |
| Ga0075425_1016437572 | 3300006854 | Populus Rhizosphere | VTFRRKLLTVFALTVFLSVAGVALLVQWLTRGAFEKTENERTAA |
| Ga0099830_1000006234 | 3300009088 | Vadose Zone Soil | LSFGRKLLLVFALTVFLSVGAVTWIVSAVTRRAFERANEAQTAALIA |
| Ga0099830_101849771 | 3300009088 | Vadose Zone Soil | MSFRRKLLAVFALAVIASVVAVAWIASVVSSRAFAQANQERTAALV |
| Ga0099830_118606881 | 3300009088 | Vadose Zone Soil | MTFRRKLLAVFALTVFLSVAAVALLVLAVTRNAFEKTEE |
| Ga0116222_10139781 | 3300009521 | Peatlands Soil | MTFRRKLLTVFALTVFLSVAAVAGLVLAVTRSAFEKTEGQ* |
| Ga0116222_15297081 | 3300009521 | Peatlands Soil | MTFRRKLLAVFALTVFLSVAAVALLVLAVTRKTFEKTEDQRTTALVTEFQREFTRRGEEVAQRV |
| Ga0116225_13418251 | 3300009524 | Peatlands Soil | MTFRRKLLTVFALTVFLSVAAVAGLVLAVTRSAFEKTEGQRTAALISQFQIEFRHQGEDVAR |
| Ga0105238_101671261 | 3300009551 | Corn Rhizosphere | VSFRRKLLLVFSLTVFVSVATVAWVVSVFTRRTFERASDERTATL |
| Ga0116111_10307241 | 3300009616 | Peatland | MTFRRKLLAVFALTVFLSVGAVAWLVLVLTRNAFEKTEDQRTAALVTQF |
| Ga0116216_105435332 | 3300009698 | Peatlands Soil | MMFRRKLLAVFALTVFLSVAAVAWLVSEVTRRAFVRSDDE |
| Ga0116217_104588671 | 3300009700 | Peatlands Soil | MTFRRKLLAVFALTVFLSVAVVALLVLGVTRKAFEKSEEQRTTA |
| Ga0116219_101957391 | 3300009824 | Peatlands Soil | MMFRRKLLTVFALTVFLSVAAVALLVSVVTRRAFEHSEDERTAA |
| Ga0126380_107775342 | 3300010043 | Tropical Forest Soil | VTFRRKLLAIFALTVFLSVTAVALLVQWVTRNAFEKTEN |
| Ga0126380_107790622 | 3300010043 | Tropical Forest Soil | VSFRRKLLLVFALTVFLSVAAVAWMVSLVTRRAFERSNEER |
| Ga0126373_131601352 | 3300010048 | Tropical Forest Soil | MTFRRKLLAVFALTVFLSVAGVALLVQLVTRHAFEKAENDRTAALVAQFQHEF |
| Ga0126373_132767501 | 3300010048 | Tropical Forest Soil | MIFRRKLLTVFALTVFLSVAAVAVLVLTLTRRAFEKNEE |
| Ga0126376_113814672 | 3300010359 | Tropical Forest Soil | VSFRRKLLAVFALTVFVSVATVALIVSALTRQASEKSEEERT |
| Ga0126372_107787622 | 3300010360 | Tropical Forest Soil | MSFRRKLLIVFALTVFLSVASVAILVQWVTRNAFEKEENQRTAALVTQ |
| Ga0126378_106900602 | 3300010361 | Tropical Forest Soil | MTFRRKLLAVFALTVFLSVAGVALLVQLVTRHAFEKA |
| Ga0126379_114292181 | 3300010366 | Tropical Forest Soil | LSFRRKLLLLFALTVFVSVVTVAWIVSLVTRRAFERANESQTAALVG |
| Ga0134128_105152831 | 3300010373 | Terrestrial Soil | MSFRRKLLAVFALTVLLTVTGVAWLVQEVTRKAFEKNENARTAALV |
| Ga0126381_1010530892 | 3300010376 | Tropical Forest Soil | MSFRRKLIAVFALAVFLSVAGVAGLVLQTTRSAFEKRENQQ |
| Ga0126381_1035133661 | 3300010376 | Tropical Forest Soil | VSFRRKLLLLFSITVFLAVTAVAWFVSLVTRQAFEKANEERTSALVA |
| Ga0136449_1001323106 | 3300010379 | Peatlands Soil | MTFRRKLVTVFALTVFLSVAAVALLVIAVTRNAFEKTEDQRTTALVTQF |
| Ga0136449_1029767581 | 3300010379 | Peatlands Soil | MTFRSKLVAVFALTVFLSVAAVALLVIAVTRNAFEKTEDQRTTALVTQF |
| Ga0126383_135097712 | 3300010398 | Tropical Forest Soil | VSFRRKLLLVFALTVFFSVAAVAFLVSLVTRRAFER |
| Ga0137776_12702112 | 3300010937 | Sediment | MSFRRKLLTVFALTVFLSVASVALLVQYLTRGAFEKTENQRTSALVAQFQREFSR |
| Ga0138560_10938392 | 3300011083 | Peatlands Soil | MTFRRKLLAVFALTVFLSVAAVAGLVLAMTRRAFEKTEDQQTSGLMAEFQREFNRQGEEVTQ |
| Ga0137393_112308082 | 3300011271 | Vadose Zone Soil | MSYRRKLLAVFALTVVLSVAGVAFLVSAMTRRAFEHTE |
| Ga0137393_115217471 | 3300011271 | Vadose Zone Soil | MSFRRKLLAVFALTVVLSVAAVAWLVSVMTRRAFERTEDERT |
| Ga0137389_109289251 | 3300012096 | Vadose Zone Soil | LSFGRKLLLVFALTVFLSVGAVTWIVSAITRRAFERANEDQTAA |
| Ga0137362_112159991 | 3300012205 | Vadose Zone Soil | MTFRRKLLAVFALTVFLSVATVGWLVSTLSRRAFERAEDERTSALVTQFRHEFNRQGEEVSRR |
| Ga0137378_108271931 | 3300012210 | Vadose Zone Soil | LSFRRKLLLLFALTVFLSVATVAWIVSLATRRAFEQGNEAQTTALVGQFQ |
| Ga0137387_109203052 | 3300012349 | Vadose Zone Soil | MSFRRKLLAVFALTAFLSIAAVAWIVSTTTRRAFERANEQRTAALLAQF |
| Ga0137384_104137551 | 3300012357 | Vadose Zone Soil | MTFRRKLLAVFALTVFLSVAAVALLVLAVTRNAFEKTEEQR |
| Ga0137360_111716611 | 3300012361 | Vadose Zone Soil | VSFRRKLFLVFALTVFLCVGAVAWIISAMTRRAFERANEDQTAA |
| Ga0137361_108393552 | 3300012362 | Vadose Zone Soil | MTFRRKLLAVFALTVFLSVATVGWLVSTLSRRAFELVDDERTSALVTQFRHEFNRQGEEVSRRVE |
| Ga0137395_104379021 | 3300012917 | Vadose Zone Soil | VSFRRKLFLVFALTVFLCVGAVAWIISAMTRRAFERANEDQTAAL |
| Ga0137396_104170781 | 3300012918 | Vadose Zone Soil | MTFRRKLLAVFALTVFLSVATVGWLVSTLSRRAFERAEDERTSALVTQFRHEFNRQGEE |
| Ga0126369_127190592 | 3300012971 | Tropical Forest Soil | MTFRRKLLAVFALTVFLSVAAVALLAQWVTRNAFEKAEGQRTASLV |
| Ga0134110_102908732 | 3300012975 | Grasslands Soil | MSFRRKLLAVFGLTVFVSVAAVTWIVSISTRRTFERANEERTAAL |
| Ga0164309_108855502 | 3300012984 | Soil | LSFRRKLLLLFALTVFVSVATVAWLVSLATRRAFEQNNEAQSAALAGQFQ |
| Ga0157373_100550911 | 3300013100 | Corn Rhizosphere | LSFRRKLLLVFALTVFLCVGAVTWIVSSVTRRAFDRANEAQTTALIAQFRRE |
| Ga0157373_108025531 | 3300013100 | Corn Rhizosphere | LSFRRKLLLVFGLTVFLCVGAVTWIVSSVTRRAFDRANEAQTTALIAQFRRE |
| Ga0157378_111667691 | 3300013297 | Miscanthus Rhizosphere | LSFRRKLLLVFALTVFLCVGAVTWIVSSVTRRAFERANEAQTT |
| Ga0163162_120135102 | 3300013306 | Switchgrass Rhizosphere | VSFRRKLLLAFALTVVLSVITVAWIASVVTRRAFEQAD |
| Ga0181531_102879651 | 3300014169 | Bog | MMFRRKLLAVFALTVFLSVATVAFLVSAVTRRAFDHSEDERTAA |
| Ga0181531_105789801 | 3300014169 | Bog | MIFRRKLLAVFALTVFLVVAAVALLVSSLTRRAFEQTENVRTTALVTQFQREF |
| Ga0181526_103604932 | 3300014200 | Bog | MTFRRKLLTVFALTVFLSVAAVALLVLAVTRNAFEKTEEQRTAALVAQFQR |
| Ga0182015_104317292 | 3300014495 | Palsa | MSFQRKLLAVFSLTVFLSVAAVTTIVSSVTRRAFERADEER |
| Ga0182024_103688711 | 3300014501 | Permafrost | MSFRRKLLTVFALTVFLSVGAVTWIVSTVTRRAFERDDDDRA |
| Ga0181516_104597931 | 3300014655 | Bog | MTFRRKLLLVFTLTVILSVAAVAWLVQAVTRNAFEKTESERTATL |
| Ga0181519_101382911 | 3300014658 | Bog | MMFRRKLLALLALTVCLAVGAVAWLVSDMTRRAFARSD |
| Ga0182030_104517291 | 3300014838 | Bog | MSFQRKLLAVFSLTVLLSVAEVTVIVSSVTQKAFDRVDAQRTAALVA |
| Ga0137418_103492952 | 3300015241 | Vadose Zone Soil | VSFRRKLFLVFALTVFLCVGAVAWIVSAMTRRAFERANED |
| Ga0137412_101529393 | 3300015242 | Vadose Zone Soil | MLRRKLLSVFALTVFLSVAAVAWLVSAVTRRAFDRSEN |
| Ga0134073_100889372 | 3300015356 | Grasslands Soil | MSFRRKLLAVFALTVSVSVGSVAWIVLVLSRHAFERADAE |
| Ga0132257_1004992062 | 3300015373 | Arabidopsis Rhizosphere | LSFRRKLLLVFGLTVFLCVGAVTWIVSSVTRRAFDRAN |
| Ga0132255_1004352611 | 3300015374 | Arabidopsis Rhizosphere | MSFRRKLLLVFALTVFLSVAAVAWMVSLVTRRAFERSNEERTAAL |
| Ga0187818_101212312 | 3300017823 | Freshwater Sediment | MIFRRKLLAVFALTVFLSVAAVAGLVLAVTRRAFEKSEDER |
| Ga0187824_100234931 | 3300017927 | Freshwater Sediment | LIFRRKLLMLFALTVFFSVAAVAWLVSSVTRRAFEQ |
| Ga0187801_102157612 | 3300017933 | Freshwater Sediment | MSFRRKLLAVFALTVFLSVAAVAVLVQWVTRNAFEKTENE |
| Ga0187801_105119511 | 3300017933 | Freshwater Sediment | MSFRRKLVAVFALTVLLSVAGVAGLVLQMTRSAFEKTENQQTVA |
| Ga0187854_103129021 | 3300017938 | Peatland | MMFRRKLLAVFALTVFLSVAAVAWLVSEVTRRAFARSDDERTAALVT |
| Ga0187819_100199674 | 3300017943 | Freshwater Sediment | MSFRRKLLATFALTVFLSVAAVAWIVSLVTRRAFERS |
| Ga0187819_108474482 | 3300017943 | Freshwater Sediment | MTFRRKLLAVFALTVFLSVAAVAGLVLAMTRRAFEKTEDQQTSALIAGFQREFNRQGEDVTRR |
| Ga0187817_105022432 | 3300017955 | Freshwater Sediment | MMFRRKLLLVFALTVFLSVAAVALLVSAVTRRAFDRSEDERT |
| Ga0187817_110312601 | 3300017955 | Freshwater Sediment | MSFRRKLLAVFALTVFLSVAAVAVLVQWVTRNAFEKTENERTAALVSQFQ |
| Ga0187782_109134002 | 3300017975 | Tropical Peatland | MSFRRKLVAVFALTVFLSVAGVAGLVLQMTRSAFEKTENQQTAALV |
| Ga0187816_101997622 | 3300017995 | Freshwater Sediment | MTFRKKLLLVFALTVFVSVAGVALLVQLITRNAFEKTEN |
| Ga0187767_100424542 | 3300017999 | Tropical Peatland | MNFRRRLLAVFALTVVLAVAAVTIIVSAITRRAFARSDQEQTAALVAQ |
| Ga0187888_11079552 | 3300018008 | Peatland | MMFRRKLLAVFALTVFLSVAAVAWLVSEVTRRAFARSDDERTAALVTQFRHEFN |
| Ga0187860_11200722 | 3300018014 | Peatland | MMFRRKLLAVFALTVCVSVGAVTALVLAVTRRAFEKTEEERIAALVAQFQREFNR |
| Ga0187885_100200491 | 3300018025 | Peatland | MMFRRKLLAVFALTVFLSVAAVAWLVSEVTRRAFIRSDD |
| Ga0187869_102993891 | 3300018030 | Peatland | MMFRRKLLAVFALTVFLSVAAVAWLVSEVTRRAFIRSDDERTAALVTQFRHEFNRQ |
| Ga0187871_104962922 | 3300018042 | Peatland | MIFRRKLLAVFALTVFLVVAAVALLVSALTRRAFEQTEDVRTTALVTQFQRE |
| Ga0187871_107635072 | 3300018042 | Peatland | MIFRRKLLAVFALTVFLVVAAVTLLVSALTRRAFEQTEDVRTTALVTQFQREFERQGEE |
| Ga0187887_102765191 | 3300018043 | Peatland | MFRRKLLGVFALTVFLSVAAVAWLVSEVTRRAFVRSEDERTAAL |
| Ga0187859_101395851 | 3300018047 | Peatland | MIFRRKLLAVFALTVFLVVAAVTLLVSALTRRAFEQTEDVRTTALVTQFQRE |
| Ga0187769_106600081 | 3300018086 | Tropical Peatland | MIFRRKLLAVFTLTVCLSVGAVTALVLVVTRRAFEKNEEQRIAALLTQFQRE |
| Ga0187769_112018452 | 3300018086 | Tropical Peatland | MIFRRKLLAVFALTICLSVGAAAGLVLVVMRRAFERTEEQRIAAMVAQFQREFNRQG |
| Ga0187770_110036151 | 3300018090 | Tropical Peatland | MIFRRKLLAVFALTVCLSVAAIAGLVLVVTRHAFERTED |
| Ga0066655_100193954 | 3300018431 | Grasslands Soil | MSFRRKLLAVFALTVSVSVGSVAWIVLVLSRHAFERADAERTA |
| Ga0066655_110990082 | 3300018431 | Grasslands Soil | MSFRRKLLAVFGLTVFVSVAAVTWIVSVSTRRTFERANEE |
| Ga0066667_101322253 | 3300018433 | Grasslands Soil | MSFRRKLLAVFALTVSVSVGSVAWIVLVLSRHAFER |
| Ga0066669_109170971 | 3300018482 | Grasslands Soil | TMSFRRKLLAVFALTVLLTVTGVAWLVQEGTRKAFEKNENERTAA |
| Ga0193751_10190771 | 3300019888 | Soil | MTFRRKLLAVFALTVFLSVGAVAWLVLALTRDAFEKT |
| Ga0193728_11608682 | 3300019890 | Soil | MTFRRKLLAVFALTVFLSVATVGWLVSTLSRRAFERADDERTSALVTQFRHEFN |
| Ga0193753_100309791 | 3300020034 | Soil | MRFRRKLLAVFALTVFLSVATVALIVSAMTRRSFERANADSTIAL |
| Ga0210407_113564242 | 3300020579 | Soil | MTFRRKLLAVFALTVCLSVGAVAFLVSAVTRRAFDRSEDERT |
| Ga0210403_104789112 | 3300020580 | Soil | MSFRRKLLAVFALTVFLSVGAVSWLVLALTRNAFEKTEDQRTAAL |
| Ga0210399_107169902 | 3300020581 | Soil | VNFRRKLLAVFALTVFVCVAGVAWIIAGVTRRAFERQD |
| Ga0210395_102606492 | 3300020582 | Soil | MTFQRKLLAVFALTVFLSVAAVALLVLVVTRNAFE |
| Ga0210401_103537372 | 3300020583 | Soil | MTFRRKLLAVFALTVFVSVAAVALLVIAGTRNAFE |
| Ga0210401_104145342 | 3300020583 | Soil | VFRRKLLTVFALTVVLSVGAVVWLVSRVTRKAFDRSEDERTAALVTQFRHEFNRQG |
| Ga0215015_107246522 | 3300021046 | Soil | LSLRRKLLLVFALTVFLCVGAVAWIVSAVTRRAFERANEDQTTV |
| Ga0210404_105030132 | 3300021088 | Soil | MTFRRKLLVVFALTVFLSVAGVALLVQWVTRNAFEKTENQRTAALVIQFQLPIL |
| Ga0210400_101052111 | 3300021170 | Soil | MTFRRKLLTVFALTVFLSVAAVALLVLAVTRNTFEKTED |
| Ga0210405_107906711 | 3300021171 | Soil | MTFRRKLLAVFALTVFLSVATVGWLVSTLSRRAFERADDERTSALVTQF |
| Ga0210408_106787392 | 3300021178 | Soil | MIFRRKLLAVFALMVVVSVASVAGLVLMVIRNAFEKTEAQRTSALVAQFQ |
| Ga0210393_109108062 | 3300021401 | Soil | MIFRRKLLAVFALTVFLVVTAVTLFVSALTRRAFEQTEDVRTTALVTQFQREFERQGDEAARRVEA |
| Ga0210385_101248853 | 3300021402 | Soil | MMFRRKLLAVFAMTVFLSVATVAFLVSAVTRRAFDHSEDQRTSALVMQF |
| Ga0210397_101833901 | 3300021403 | Soil | LSFGRKLLLVFALTVFLCVGAVTWIVTAITRRAFERANEEQ |
| Ga0210397_106426802 | 3300021403 | Soil | MTFRRKLLVVFALTVFLSVATVALLVLGVTRNAFEKTEDQRTAALVTQFQ |
| Ga0210386_102445832 | 3300021406 | Soil | LNFRRKLLLLFALTVFLSVAAVAWLVSTVTRRAFEQSNEAQT |
| Ga0210386_102474351 | 3300021406 | Soil | MMFRRKLLTVFALTVFLSVAAVAWLVSEVTRRAFVR |
| Ga0210391_103099061 | 3300021433 | Soil | MIFRRKLLAVFALTVFLVVAAVTLLVSALTRRAFEQTEDVRTTALVTQFQREFERQGDEAARRVEA |
| Ga0210392_105031152 | 3300021475 | Soil | MIFRRKLLAVFALTVFLSVAAVAGLVLALTRSAFEKTEDQRTAALAA |
| Ga0210398_104745861 | 3300021477 | Soil | MIFRRKLLAVFALTVFLVVAAVALLVSSLTRRAFEQTENVRTTALITQFQREFEQQGEDA |
| Ga0210398_116250542 | 3300021477 | Soil | MIFRRKLLAVFALTVFLVVTAVTLFVSALTRRAFEQTEDVRTTALVTQFQREFERQGDEAARRVE |
| Ga0126371_128311591 | 3300021560 | Tropical Forest Soil | MSFRRKLLTVFALTVFLSVASVALLVQYLTRGAFEKTENQRTSA |
| Ga0213852_13007752 | 3300021858 | Watersheds | MTFRRKLLTVFALTVFLSVAAVAGLVLAVTRRAFERSEDERTAALVTQFRRE |
| Ga0213851_15704341 | 3300021860 | Watersheds | MIFRRKLLAVFALTVFLSVAAVAGLVLAVTRRAFERSEDERT |
| Ga0213853_102335132 | 3300021861 | Watersheds | MIFRRKLLAVFALTVFLSVAAVAGLVLAVTRRAFERSEDERTAALVAQFQ |
| Ga0212123_102413122 | 3300022557 | Iron-Sulfur Acid Spring | MSFRRKLLAVFALTVFLSVGAVSWLVLALTRNAFEKTEDQRTAALVTHFQ |
| Ga0233357_10255271 | 3300023056 | Soil | MTFRRKLLSVFALTVFLSVAAVTLLVSAVTRRAFDRSEDER |
| Ga0224551_10951881 | 3300023259 | Soil | MMFRRKLLAVFALTVFLSVAAVAWLVSEVTRRAFVRSDDERTAAL |
| Ga0208563_10010871 | 3300025501 | Peatland | VNFRARLLAVFALTVVVAVGLVAWIIAFRTRDAFRELDSQR |
| Ga0208820_11086702 | 3300025576 | Peatland | MMFRRKLLAVFALTVFLSVAAVAWLVSEVTRRAFARSDDERTAALV |
| Ga0207685_100462793 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | MTFRRKLLAIFALTVFLSVTAVALLVQWVTRNAFEKAEGQRTASLVA |
| Ga0207707_103596522 | 3300025912 | Corn Rhizosphere | MSFRRKLLLVFSVSVALSVSAVAWLVQEVTRKAFEETENQRTSQLVGQFQR |
| Ga0207663_117018052 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | VTFRRKLLTVFALTVFLSVAGVALLVQWLTRGAFEKTENERTAALVAQFQ |
| Ga0207681_114924872 | 3300025923 | Switchgrass Rhizosphere | VSFRRKLLLVFSLTVFVSVATVAWVVSVFTRRTFERASDERTATLV |
| Ga0207690_114343922 | 3300025932 | Corn Rhizosphere | VSFRRKLLLVFSLTVFVSVATVAWVVSVFTRRTFERAS |
| Ga0208775_10014282 | 3300025992 | Rice Paddy Soil | MSFRRKLLAVFAFTVLLSVTGVAWMVQEVTRKAFEKNE |
| Ga0207702_121949722 | 3300026078 | Corn Rhizosphere | LSFRRKLSLVFALTVFLSVGAVTWIVSSVTRRAFEHA |
| Ga0207675_1011038361 | 3300026118 | Switchgrass Rhizosphere | VSFRRKLLLVFSLTVFVSVATVAWIVSVFTRRTFERASDERTAT |
| Ga0209871_10155471 | 3300026217 | Permafrost Soil | MTFRRKLLAVFALTVFLSVGAVAWLVLALTRNAFEKTEDQRTAALV |
| Ga0257154_10252241 | 3300026467 | Soil | MMFRRKLLTVFALTVFLSVAAVAWLVSEVTRRAFVRSDDERTA |
| Ga0179587_102877402 | 3300026557 | Vadose Zone Soil | VSFRRKLLLVFTLTVFLSVAAVAWLVSLVTRRAFERSNEE |
| Ga0207779_10247992 | 3300026928 | Tropical Forest Soil | MIFRRKLLAVFALTVFLSVAAVTWLVSQVIRNAFD |
| Ga0207819_10464282 | 3300027024 | Tropical Forest Soil | MIFRRKLLAVFALTVFLSVAAVTWLVSQVIRNAFDKTENQRTAALVKQFQDEFARRGDEVGRRVAA |
| Ga0207726_10149411 | 3300027045 | Tropical Forest Soil | MIFRRKLLAVFALTVFLSVAAVTWLVSQVIRNAFDKTENQRTAALVKQF |
| Ga0208724_10210252 | 3300027064 | Forest Soil | MMFRRKLLAVFALTVFLSVAAVALLVLAVTRGAFEKTEEQRTAALVAQFQGQFI |
| Ga0208237_10499172 | 3300027080 | Forest Soil | MTFRRKLLTVFALTVFLSVAAVALLVLAVTRNAFEKTEDQRTA |
| Ga0209523_10254771 | 3300027548 | Forest Soil | MTFRRKLLVVFALTVFLSVAGVALLVQWVTRNAFEKTESQRT |
| Ga0209527_10925573 | 3300027583 | Forest Soil | VSFRRKLFLVFALTVFLCVGAVAWIVSAMTRRAFERANEDQTAALVTQFRRE |
| Ga0209528_10414581 | 3300027610 | Forest Soil | MTFRRKLLAVFALTVFLSVATVGWLVSTLSRRAFERADDERTSALVTQFRHEFNRQGEDVFRRVE |
| Ga0209530_10209143 | 3300027692 | Forest Soil | MMFRRKLLAVFALTVFLSVAAVSWLVSEVTRRAFVRSDNERTAA |
| Ga0209073_101650401 | 3300027765 | Agricultural Soil | MSFRRKLLLVFSATIAFSVAAVAWLVQEVTRKAFEETENQRT |
| Ga0209448_100172863 | 3300027783 | Bog Forest Soil | MMFRRKLLGVFALTVFLSVAAVAFLVSAVTRRAFERSEDDRTSALVMQ |
| Ga0209060_104686592 | 3300027826 | Surface Soil | MTFRRKLVAVFALTVFLSVAGVAGLVLSMTRSAFEK |
| Ga0209580_104725672 | 3300027842 | Surface Soil | VGRGQALNFRRKLLLLFALTVFLSVAAVAWIVSLVTRRAFEQ |
| Ga0209701_106283342 | 3300027862 | Vadose Zone Soil | MSFRRKLLAVFALAVIASVVAVAWIASVVSSRAFAQANQERTAALVA |
| Ga0209275_101735871 | 3300027884 | Soil | MFRRKLLGVFALTVCLSVAAVAWLVSAVTRRAFDRSEDERTVA |
| Ga0209380_106201301 | 3300027889 | Soil | MIFRRKLLAVFALTVFLVVAAVALLVSSLTRRAFEQTENVRTTALVTQFQREFEQQGE |
| Ga0209415_104084781 | 3300027905 | Peatlands Soil | MSFRRKLLAVFALTVFFCVAAVTAIVSSVTRRAFERADEDR |
| Ga0209069_108199182 | 3300027915 | Watersheds | VSFRRKLSLVFALTVFLSVSAVTWIVSNVTRRAFE |
| Ga0265356_10151562 | 3300028017 | Rhizosphere | MSFRRKLLAVFALTVFLSVGAVSWLVLALTRNAFEKTEDQRTAALVTHFQREFSRRGEDV |
| Ga0265355_10147412 | 3300028036 | Rhizosphere | MIFRRKLLAVFALTVFLVVAAVALLVSALTRRAFEQTENVRTTALVTQFQRE |
| Ga0137415_102689171 | 3300028536 | Vadose Zone Soil | VSFRRKLFLVFALTVFLCVGAVAWIASAMTRRAFERA |
| Ga0302225_100355491 | 3300028780 | Palsa | MIFRRKLLAVFALTVFVSVAVVALLVLAVTRRAFEKSEEQRT |
| Ga0302225_105065502 | 3300028780 | Palsa | MRFRRKLLTVFALTVFVSVAMVAWIVSEVTRRTFARSD |
| Ga0302222_100277931 | 3300028798 | Palsa | MMFRRKLLAVFALTVFLSVAAVAWLVSEVTRRAFVHSEDERTA |
| Ga0302228_100482373 | 3300028808 | Palsa | MMFRRKLLAVFALTVFLSVAAVAWLVSEVTRRAFVHSEDERT |
| Ga0302155_101321151 | 3300028874 | Bog | MMFRRKLLAVFALTVFLSVAAVAWLVSEVTRHAFARNDDERTAALVTQF |
| Ga0308309_104912292 | 3300028906 | Soil | MTFRRKLLLVFTLTVVLSVGAVAWLVQAVTRNAFEKTESERTAA |
| Ga0308309_113357052 | 3300028906 | Soil | MMFRRKLLAVFALTVFLSVAGVAWLVSEVTRRAFVQSDDERTAALLTQFRRE |
| Ga0311359_102460601 | 3300029914 | Bog | MFRRKLLGVFALTVFLSVAAVAWLVSEVTRRAFVRSEDERTAALVTQF |
| Ga0302181_102788361 | 3300030056 | Palsa | MRFRRKLLTVFALTVFVSVAMVAWIVSEVTRRTFARSDDERTAA |
| Ga0302179_101152682 | 3300030058 | Palsa | MIFRRKLLAVFALTVFLVVAAVTLLVSALTRRAFEQTEDVRTTALVTQFQREF |
| Ga0302183_101001582 | 3300030509 | Palsa | MRFRRKLLTVFALTVFVSVAMVAWIVSEVTRRTFARS |
| Ga0311372_104646141 | 3300030520 | Palsa | MRFRRKLLTVFALTVFVSVAMVAWIVSEVTRRTFA |
| Ga0311355_104137431 | 3300030580 | Palsa | MTYRRKLLTVFALTVFLSVAAVALLVQLMIRTAFEKAENDRTAALVTQIQREFSRRGEDVERR |
| Ga0311354_100208649 | 3300030618 | Palsa | MMFRRKLLAVFALTVFLSVAAVAWLVSEVTRRAFVHSEDERTAA |
| Ga0302310_106726621 | 3300030737 | Palsa | MIFRRKLLAVFALTVFVSVAVVALLVLAVTRRAFEK |
| Ga0302314_113761762 | 3300030906 | Palsa | MTYRRKLLTVFALTVFLSVAAVALLVQLMIRTAFEK |
| Ga0265760_101244161 | 3300031090 | Soil | MIFRRKLLAVFALTVFLVVAAVALLVSALTRRAFEQTEDVRTTAL |
| Ga0170824_1173040362 | 3300031231 | Forest Soil | MTFRRKLLIVFALTVFLSVAAVALLVVGVTRGAFEKNEDLRTTAMVTQFQREFTRR |
| Ga0302307_103095112 | 3300031233 | Palsa | MIFRRKLLAVFALTVFLVVAAVTLLVSALTRRAFEQTEDVRTTALVTQFQREFEQQ |
| Ga0265339_101268241 | 3300031249 | Rhizosphere | MTFRRKLLAVFALTVFLSVATVALLVLGVTRNAFEKT |
| Ga0170818_1115468572 | 3300031474 | Forest Soil | MMFRRKLLAVFALTVFLSVATVALIVSEVTRRAFARTDDERTAALVAQ |
| Ga0318561_100847661 | 3300031679 | Soil | LIFRRKLLLLFALTVFFSVAAVAWLVSSVTRRAFEQASDAQTAA |
| Ga0310686_1151968181 | 3300031708 | Soil | MFRRKLLAVFALTVFVSVAAVAWLVSAVTRRAFDRSEDERTAAL |
| Ga0265314_104656152 | 3300031711 | Rhizosphere | MSFCRKLLTVFALTVFLSVAAVALLVLAVTRSAFEKAEDQRTAALMTQFQREF |
| Ga0307476_111116961 | 3300031715 | Hardwood Forest Soil | MMFRRKLLAVFALTVFLSLAAVTLLVSAVTRRAFDRSEEERTAALVAQFRHEF |
| Ga0307474_108340221 | 3300031718 | Hardwood Forest Soil | MTFRRKLLAIFALTVFVSVGAVAWLVLALTRNAFEKNEEQR |
| Ga0307474_112506191 | 3300031718 | Hardwood Forest Soil | MTFRRKLLVVFALTVFLSVAGVALLVQWVTRNAFEKTENQR |
| Ga0307474_115187662 | 3300031718 | Hardwood Forest Soil | MSFRRKLLAVFALTVFLSVGAVSWLVLALTRNAFEKTEDQRTAALVTHFQRE |
| Ga0306917_108023092 | 3300031719 | Soil | VTFRRKLLAVFALTVFLSVAGVALLVQLVTRNAFEKTE |
| Ga0307469_112542062 | 3300031720 | Hardwood Forest Soil | MTFRRKLLAAFALTVFLSVAAVAWLVTTATRRVFEL |
| Ga0302319_106840641 | 3300031788 | Bog | MMFRRKLLGVFALTVFLSVAAVAWLVSEVTRRAFVRSEDERTAAL |
| Ga0307473_105041231 | 3300031820 | Hardwood Forest Soil | MSFRRKLLAVFALTVSVSVGSVAWIVLVMSRHAFERADADRT |
| Ga0307473_109636501 | 3300031820 | Hardwood Forest Soil | MSFRRKLLAVFALTVFFSVAAVTWIVSATTRRAFERANE |
| Ga0307478_106459462 | 3300031823 | Hardwood Forest Soil | MTFRRKLLLVFTLTVFVSVAGVAWLVQEMTRNAFEKTDSQRT |
| Ga0307478_110230632 | 3300031823 | Hardwood Forest Soil | MTFRRKLLVTFALTILLSVAVVGWLVSALSRRAFE |
| Ga0307478_115313002 | 3300031823 | Hardwood Forest Soil | MMFRRKLLALFALTVFLSVAAIAGLVLAVTRRAFA |
| Ga0306925_113435122 | 3300031890 | Soil | VTFRRKLLAVFALTVFLSVAGVALLVQLVTRNAFEKTENQRTA |
| Ga0306921_117233961 | 3300031912 | Soil | MTFRRKLLTVFALTIFLSVASIAWIVSALARRAFERANEER |
| Ga0306921_124647012 | 3300031912 | Soil | VNFRRKLLLVFALTVFLSVAAVTWIVSLVTRRAFE |
| Ga0318530_101178892 | 3300031959 | Soil | LIFRRKLLLLFALTVFFSVAAVAWLVSSVTRRAFEQASDAQ |
| Ga0307479_111689432 | 3300031962 | Hardwood Forest Soil | MFRRKLLAVFALTVFFSVAAVTLLVSAVTRRAFERSED |
| Ga0310911_104114452 | 3300032035 | Soil | MTFRRKLLLVFALTVFLSVAGVALLVQWVTRNAFEKAENQRTTA |
| Ga0311301_114831271 | 3300032160 | Peatlands Soil | MTFRSKLVAVFALTVFLSVAAVALLVIAVTRNAFEKTEDQRTTALV |
| Ga0307471_1018128802 | 3300032180 | Hardwood Forest Soil | MTFRRKLLAVFALTVFLSVATVGWLVSTLSRRAFERADDERTSALV |
| Ga0335085_110684391 | 3300032770 | Soil | MTFRRKLLIVFALTVFVSVSSVALLVQWVTRNAFEKAENQCTAALVAQFQREFT |
| Ga0335082_110740802 | 3300032782 | Soil | MTFRRKLLVVFALTVFLSVAGVALLVQIMIRNAFERAENQRAAALVNQFQHEFS |
| Ga0335079_107204602 | 3300032783 | Soil | MTFRRKLLAIFALTVFFSVAAVALLVHWVTRNAFEKAENQ |
| Ga0335070_119087231 | 3300032829 | Soil | VSFRRKLLAVFALTVIFSVAAVALLVQWATRNAFERAENQRTAALVAQFQR |
| Ga0335072_107136192 | 3300032898 | Soil | MSFRRKLLAVFGLTVFVSVAAVGGLVLALTRRAFEKNEEERTATLV |
| Ga0335083_108693191 | 3300032954 | Soil | MTFRRKLLIIFTLTVLLCVGGVALIVLTVTRNAFEK |
| Ga0335083_114012851 | 3300032954 | Soil | MTFRRKLLAVFALTVFSSVAAVAWLVLVLTRNAFE |
| Ga0335076_111934151 | 3300032955 | Soil | MTFRRKLLAIFALTVFLSVTAVALLAQWVTRNAFEKSESQRTASLVAQFQREFNR |
| Ga0318519_103190522 | 3300033290 | Soil | LIFRRKLLLLFALTVFFSVAAVAWLVSSVTRRAFEQASDAQTAALVAQFQ |
| Ga0370484_0009560_1911_2045 | 3300034125 | Untreated Peat Soil | MTFRRKLLAVFALTVFLSVGGVAWLVLALTRNAFEKAEDRHTAAL |
| Ga0370515_0365374_1_162 | 3300034163 | Untreated Peat Soil | MIFRRKLLVVFALTVFLVVAAVALLVSALTRRAFEQTEDVRTTALVTQFQREFE |
| ⦗Top⦘ |