| Basic Information | |
|---|---|
| Family ID | F017339 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 241 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MSDGKKLKPQHAPKAPHEDPEFLNSTPARPIRILAEYIHPLV |
| Number of Associated Samples | 195 |
| Number of Associated Scaffolds | 241 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 98.76 % |
| % of genes near scaffold ends (potentially truncated) | 99.17 % |
| % of genes from short scaffolds (< 2000 bps) | 91.29 % |
| Associated GOLD sequencing projects | 179 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.44 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (99.585 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (24.481 % of family members) |
| Environment Ontology (ENVO) | Unclassified (26.556 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (49.378 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 28.57% β-sheet: 0.00% Coil/Unstructured: 71.43% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.44 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 241 Family Scaffolds |
|---|---|---|
| PF00092 | VWA | 7.47 |
| PF13519 | VWA_2 | 7.47 |
| PF03992 | ABM | 4.98 |
| PF13673 | Acetyltransf_10 | 2.07 |
| PF03739 | LptF_LptG | 0.41 |
| PF14542 | Acetyltransf_CG | 0.41 |
| PF00691 | OmpA | 0.41 |
| PF04250 | DUF429 | 0.41 |
| PF10282 | Lactonase | 0.41 |
| PF02518 | HATPase_c | 0.41 |
| COG ID | Name | Functional Category | % Frequency in 241 Family Scaffolds |
|---|---|---|---|
| COG0795 | Lipopolysaccharide export LptBFGC system, permease protein LptF | Cell wall/membrane/envelope biogenesis [M] | 0.41 |
| COG2410 | Predicted nuclease (RNAse H fold) | General function prediction only [R] | 0.41 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 99.59 % |
| Unclassified | root | N/A | 0.41 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000364|INPhiseqgaiiFebDRAFT_104146453 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_105143479 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1110 | Open in IMG/M |
| 3300000793|AF_2010_repII_A001DRAFT_10075279 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 726 | Open in IMG/M |
| 3300000793|AF_2010_repII_A001DRAFT_10080859 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 694 | Open in IMG/M |
| 3300001137|JGI12637J13337_1012989 | All Organisms → cellular organisms → Bacteria | 714 | Open in IMG/M |
| 3300001167|JGI12673J13574_1013031 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300001593|JGI12635J15846_10497385 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 720 | Open in IMG/M |
| 3300004080|Ga0062385_10204022 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1070 | Open in IMG/M |
| 3300004082|Ga0062384_100482053 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 818 | Open in IMG/M |
| 3300004157|Ga0062590_101111460 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 762 | Open in IMG/M |
| 3300004633|Ga0066395_10573788 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 658 | Open in IMG/M |
| 3300004633|Ga0066395_10970917 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 517 | Open in IMG/M |
| 3300004635|Ga0062388_100055836 | All Organisms → cellular organisms → Bacteria | 2604 | Open in IMG/M |
| 3300005167|Ga0066672_10471495 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 818 | Open in IMG/M |
| 3300005330|Ga0070690_100609867 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 829 | Open in IMG/M |
| 3300005437|Ga0070710_10717394 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium | 707 | Open in IMG/M |
| 3300005439|Ga0070711_101829635 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300005529|Ga0070741_10514342 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1080 | Open in IMG/M |
| 3300005529|Ga0070741_10565456 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1019 | Open in IMG/M |
| 3300005531|Ga0070738_10026799 | All Organisms → cellular organisms → Bacteria | 4150 | Open in IMG/M |
| 3300005533|Ga0070734_10297396 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 923 | Open in IMG/M |
| 3300005555|Ga0066692_10438217 | All Organisms → cellular organisms → Bacteria | 831 | Open in IMG/M |
| 3300005555|Ga0066692_10664980 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 648 | Open in IMG/M |
| 3300005556|Ga0066707_10792752 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
| 3300005557|Ga0066704_10964743 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 526 | Open in IMG/M |
| 3300005566|Ga0066693_10441949 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| 3300005568|Ga0066703_10428620 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 794 | Open in IMG/M |
| 3300005591|Ga0070761_10891962 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 562 | Open in IMG/M |
| 3300005607|Ga0070740_10124200 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1142 | Open in IMG/M |
| 3300005610|Ga0070763_10231561 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 995 | Open in IMG/M |
| 3300005921|Ga0070766_10525605 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 788 | Open in IMG/M |
| 3300006034|Ga0066656_10112556 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1666 | Open in IMG/M |
| 3300006052|Ga0075029_100695118 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 686 | Open in IMG/M |
| 3300006102|Ga0075015_100392929 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 781 | Open in IMG/M |
| 3300006176|Ga0070765_101924556 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 554 | Open in IMG/M |
| 3300006354|Ga0075021_10858196 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 588 | Open in IMG/M |
| 3300006800|Ga0066660_10594747 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 925 | Open in IMG/M |
| 3300006854|Ga0075425_101201068 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 862 | Open in IMG/M |
| 3300006881|Ga0068865_102131411 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
| 3300006893|Ga0073928_10036998 | All Organisms → cellular organisms → Bacteria | 4576 | Open in IMG/M |
| 3300006954|Ga0079219_10645221 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 789 | Open in IMG/M |
| 3300007255|Ga0099791_10594422 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
| 3300007258|Ga0099793_10692290 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300007265|Ga0099794_10067939 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1742 | Open in IMG/M |
| 3300007788|Ga0099795_10313982 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 692 | Open in IMG/M |
| 3300009012|Ga0066710_102733900 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 702 | Open in IMG/M |
| 3300009012|Ga0066710_102848638 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 681 | Open in IMG/M |
| 3300009012|Ga0066710_103482856 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 596 | Open in IMG/M |
| 3300009038|Ga0099829_10104779 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2205 | Open in IMG/M |
| 3300009038|Ga0099829_10473218 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1039 | Open in IMG/M |
| 3300009088|Ga0099830_11047996 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 676 | Open in IMG/M |
| 3300009088|Ga0099830_11053375 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 674 | Open in IMG/M |
| 3300009089|Ga0099828_10622952 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 971 | Open in IMG/M |
| 3300009089|Ga0099828_10734724 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 886 | Open in IMG/M |
| 3300009089|Ga0099828_11124570 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 698 | Open in IMG/M |
| 3300009089|Ga0099828_11619293 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 570 | Open in IMG/M |
| 3300009089|Ga0099828_12027663 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 503 | Open in IMG/M |
| 3300009137|Ga0066709_101671571 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 906 | Open in IMG/M |
| 3300009176|Ga0105242_10109112 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2356 | Open in IMG/M |
| 3300009641|Ga0116120_1147425 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 759 | Open in IMG/M |
| 3300009764|Ga0116134_1197077 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 702 | Open in IMG/M |
| 3300010043|Ga0126380_11973986 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 533 | Open in IMG/M |
| 3300010159|Ga0099796_10055814 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1384 | Open in IMG/M |
| 3300010304|Ga0134088_10025503 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2644 | Open in IMG/M |
| 3300010320|Ga0134109_10325233 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 598 | Open in IMG/M |
| 3300010322|Ga0134084_10234077 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 656 | Open in IMG/M |
| 3300010325|Ga0134064_10453905 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 523 | Open in IMG/M |
| 3300010336|Ga0134071_10412021 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 689 | Open in IMG/M |
| 3300010343|Ga0074044_10510550 | All Organisms → cellular organisms → Bacteria | 785 | Open in IMG/M |
| 3300010358|Ga0126370_11626825 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 619 | Open in IMG/M |
| 3300010358|Ga0126370_12496296 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300010359|Ga0126376_12371370 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 577 | Open in IMG/M |
| 3300010359|Ga0126376_12517308 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300010362|Ga0126377_10246168 | All Organisms → cellular organisms → Bacteria | 1738 | Open in IMG/M |
| 3300010366|Ga0126379_12688162 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 595 | Open in IMG/M |
| 3300011269|Ga0137392_10135796 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1975 | Open in IMG/M |
| 3300011269|Ga0137392_10568473 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 941 | Open in IMG/M |
| 3300011269|Ga0137392_11437024 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
| 3300011270|Ga0137391_10531749 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 992 | Open in IMG/M |
| 3300011271|Ga0137393_10076182 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2688 | Open in IMG/M |
| 3300011271|Ga0137393_10095967 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2412 | Open in IMG/M |
| 3300011271|Ga0137393_10275583 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1430 | Open in IMG/M |
| 3300011271|Ga0137393_10311617 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1341 | Open in IMG/M |
| 3300012189|Ga0137388_10161761 | All Organisms → cellular organisms → Bacteria | 1992 | Open in IMG/M |
| 3300012189|Ga0137388_10356386 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1350 | Open in IMG/M |
| 3300012189|Ga0137388_11735098 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 558 | Open in IMG/M |
| 3300012202|Ga0137363_10259580 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1415 | Open in IMG/M |
| 3300012206|Ga0137380_10352543 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1312 | Open in IMG/M |
| 3300012209|Ga0137379_11598813 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 551 | Open in IMG/M |
| 3300012285|Ga0137370_10952319 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300012349|Ga0137387_10597358 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 800 | Open in IMG/M |
| 3300012354|Ga0137366_10333728 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1112 | Open in IMG/M |
| 3300012359|Ga0137385_10977120 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 699 | Open in IMG/M |
| 3300012362|Ga0137361_11479298 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 601 | Open in IMG/M |
| 3300012363|Ga0137390_11026661 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 776 | Open in IMG/M |
| 3300012363|Ga0137390_11314698 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 669 | Open in IMG/M |
| 3300012582|Ga0137358_10399980 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 929 | Open in IMG/M |
| 3300012582|Ga0137358_11118509 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300012683|Ga0137398_10277337 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1122 | Open in IMG/M |
| 3300012685|Ga0137397_10314725 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1167 | Open in IMG/M |
| 3300012685|Ga0137397_10474233 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 932 | Open in IMG/M |
| 3300012918|Ga0137396_10369072 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1063 | Open in IMG/M |
| 3300012922|Ga0137394_11055249 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 674 | Open in IMG/M |
| 3300012925|Ga0137419_10449499 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1015 | Open in IMG/M |
| 3300012925|Ga0137419_10749273 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 796 | Open in IMG/M |
| 3300012930|Ga0137407_10098081 | All Organisms → cellular organisms → Bacteria | 2505 | Open in IMG/M |
| 3300012930|Ga0137407_10286577 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1502 | Open in IMG/M |
| 3300012957|Ga0164303_10041499 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1976 | Open in IMG/M |
| 3300012977|Ga0134087_10016599 | All Organisms → cellular organisms → Bacteria | 2637 | Open in IMG/M |
| 3300014154|Ga0134075_10162065 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 957 | Open in IMG/M |
| 3300014157|Ga0134078_10036660 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1638 | Open in IMG/M |
| 3300014502|Ga0182021_13591197 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 515 | Open in IMG/M |
| 3300015054|Ga0137420_1268388 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 988 | Open in IMG/M |
| 3300015245|Ga0137409_10946787 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 698 | Open in IMG/M |
| 3300015356|Ga0134073_10223937 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 636 | Open in IMG/M |
| 3300016357|Ga0182032_11192538 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 655 | Open in IMG/M |
| 3300016387|Ga0182040_10756579 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 798 | Open in IMG/M |
| 3300016445|Ga0182038_10749905 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 853 | Open in IMG/M |
| 3300016445|Ga0182038_11376186 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 632 | Open in IMG/M |
| 3300016750|Ga0181505_10812966 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 563 | Open in IMG/M |
| 3300017930|Ga0187825_10320178 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
| 3300017932|Ga0187814_10195306 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 760 | Open in IMG/M |
| 3300017933|Ga0187801_10365651 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 595 | Open in IMG/M |
| 3300017934|Ga0187803_10063562 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1452 | Open in IMG/M |
| 3300017955|Ga0187817_10199018 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1277 | Open in IMG/M |
| 3300017959|Ga0187779_10266143 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1089 | Open in IMG/M |
| 3300017975|Ga0187782_10418551 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1019 | Open in IMG/M |
| 3300017988|Ga0181520_10737364 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 670 | Open in IMG/M |
| 3300018033|Ga0187867_10423741 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 736 | Open in IMG/M |
| 3300018058|Ga0187766_11317520 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300018062|Ga0187784_10183246 | All Organisms → cellular organisms → Bacteria | 1711 | Open in IMG/M |
| 3300018085|Ga0187772_11388735 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300018433|Ga0066667_10104545 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1894 | Open in IMG/M |
| 3300018468|Ga0066662_11491839 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 703 | Open in IMG/M |
| 3300018468|Ga0066662_12100257 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 592 | Open in IMG/M |
| 3300019789|Ga0137408_1438895 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2909 | Open in IMG/M |
| 3300020006|Ga0193735_1095104 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 836 | Open in IMG/M |
| 3300020199|Ga0179592_10001641 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 9075 | Open in IMG/M |
| 3300020580|Ga0210403_10210286 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1596 | Open in IMG/M |
| 3300020581|Ga0210399_10045076 | All Organisms → cellular organisms → Bacteria | 3536 | Open in IMG/M |
| 3300020583|Ga0210401_11139455 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 638 | Open in IMG/M |
| 3300021088|Ga0210404_10170528 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1152 | Open in IMG/M |
| 3300021088|Ga0210404_10748307 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 558 | Open in IMG/M |
| 3300021168|Ga0210406_10970558 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 634 | Open in IMG/M |
| 3300021170|Ga0210400_10733602 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 811 | Open in IMG/M |
| 3300021170|Ga0210400_11013393 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 674 | Open in IMG/M |
| 3300021170|Ga0210400_11315244 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 579 | Open in IMG/M |
| 3300021181|Ga0210388_11098952 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 678 | Open in IMG/M |
| 3300021407|Ga0210383_11025019 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 699 | Open in IMG/M |
| 3300021420|Ga0210394_10225139 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1639 | Open in IMG/M |
| 3300021420|Ga0210394_11512085 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 567 | Open in IMG/M |
| 3300021420|Ga0210394_11755456 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300021432|Ga0210384_10048697 | All Organisms → cellular organisms → Bacteria | 3860 | Open in IMG/M |
| 3300021432|Ga0210384_10165761 | All Organisms → cellular organisms → Bacteria | 1984 | Open in IMG/M |
| 3300021432|Ga0210384_10413702 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1215 | Open in IMG/M |
| 3300021478|Ga0210402_10092385 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2708 | Open in IMG/M |
| 3300021559|Ga0210409_11241142 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 621 | Open in IMG/M |
| 3300024288|Ga0179589_10322193 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 698 | Open in IMG/M |
| 3300024331|Ga0247668_1077790 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 670 | Open in IMG/M |
| 3300025441|Ga0208456_1019064 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1492 | Open in IMG/M |
| 3300025454|Ga0208039_1050069 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 773 | Open in IMG/M |
| 3300025812|Ga0208457_1088309 | Not Available | 579 | Open in IMG/M |
| 3300025898|Ga0207692_10920740 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 575 | Open in IMG/M |
| 3300025916|Ga0207663_10389826 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1063 | Open in IMG/M |
| 3300025922|Ga0207646_10780011 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 852 | Open in IMG/M |
| 3300025928|Ga0207700_11569093 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
| 3300025929|Ga0207664_10736596 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 886 | Open in IMG/M |
| 3300025939|Ga0207665_11687640 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300026323|Ga0209472_1249434 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 568 | Open in IMG/M |
| 3300026374|Ga0257146_1056632 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 635 | Open in IMG/M |
| 3300026507|Ga0257165_1061091 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 683 | Open in IMG/M |
| 3300026529|Ga0209806_1194803 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 713 | Open in IMG/M |
| 3300026551|Ga0209648_10748017 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 534 | Open in IMG/M |
| 3300026551|Ga0209648_10762960 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 528 | Open in IMG/M |
| 3300026557|Ga0179587_10101882 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1739 | Open in IMG/M |
| 3300026557|Ga0179587_10384204 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 914 | Open in IMG/M |
| 3300026557|Ga0179587_10481612 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 813 | Open in IMG/M |
| 3300026830|Ga0207861_107128 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 750 | Open in IMG/M |
| 3300026999|Ga0207949_1008134 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 947 | Open in IMG/M |
| 3300027011|Ga0207740_1006446 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1835 | Open in IMG/M |
| 3300027069|Ga0208859_1040826 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
| 3300027376|Ga0209004_1001939 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2508 | Open in IMG/M |
| 3300027565|Ga0209219_1054218 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1000 | Open in IMG/M |
| 3300027616|Ga0209106_1059534 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 854 | Open in IMG/M |
| 3300027655|Ga0209388_1089475 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 885 | Open in IMG/M |
| 3300027655|Ga0209388_1150778 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 657 | Open in IMG/M |
| 3300027667|Ga0209009_1065676 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 911 | Open in IMG/M |
| 3300027678|Ga0209011_1168808 | All Organisms → cellular organisms → Bacteria | 609 | Open in IMG/M |
| 3300027703|Ga0207862_1238479 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 535 | Open in IMG/M |
| 3300027706|Ga0209581_1004007 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 12190 | Open in IMG/M |
| 3300027825|Ga0209039_10360356 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 563 | Open in IMG/M |
| 3300027846|Ga0209180_10718508 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 542 | Open in IMG/M |
| 3300027857|Ga0209166_10304836 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 837 | Open in IMG/M |
| 3300027862|Ga0209701_10584920 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 595 | Open in IMG/M |
| 3300027867|Ga0209167_10302741 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii | 865 | Open in IMG/M |
| 3300027867|Ga0209167_10625135 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 589 | Open in IMG/M |
| 3300027874|Ga0209465_10184720 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1039 | Open in IMG/M |
| 3300027875|Ga0209283_10625915 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 680 | Open in IMG/M |
| 3300027884|Ga0209275_10601683 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 631 | Open in IMG/M |
| 3300027898|Ga0209067_10688243 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 592 | Open in IMG/M |
| 3300027908|Ga0209006_10404323 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1150 | Open in IMG/M |
| 3300028381|Ga0268264_10132620 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2211 | Open in IMG/M |
| 3300028906|Ga0308309_11255167 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 638 | Open in IMG/M |
| 3300028906|Ga0308309_11396515 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 600 | Open in IMG/M |
| 3300029636|Ga0222749_10589694 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 606 | Open in IMG/M |
| 3300029943|Ga0311340_11570366 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300031057|Ga0170834_111608738 | All Organisms → cellular organisms → Bacteria | 619 | Open in IMG/M |
| 3300031128|Ga0170823_16223549 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 859 | Open in IMG/M |
| 3300031226|Ga0307497_10728478 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| (restricted) 3300031248|Ga0255312_1157623 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
| 3300031545|Ga0318541_10057706 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2009 | Open in IMG/M |
| 3300031561|Ga0318528_10273686 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 906 | Open in IMG/M |
| 3300031573|Ga0310915_10018476 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4198 | Open in IMG/M |
| 3300031573|Ga0310915_10138501 | All Organisms → cellular organisms → Bacteria | 1675 | Open in IMG/M |
| 3300031708|Ga0310686_102093161 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 946 | Open in IMG/M |
| 3300031718|Ga0307474_10200594 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1518 | Open in IMG/M |
| 3300031720|Ga0307469_12434027 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
| 3300031736|Ga0318501_10676816 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
| 3300031753|Ga0307477_10119799 | All Organisms → cellular organisms → Bacteria | 1834 | Open in IMG/M |
| 3300031753|Ga0307477_10281628 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1149 | Open in IMG/M |
| 3300031754|Ga0307475_10296613 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1297 | Open in IMG/M |
| 3300031754|Ga0307475_11474948 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
| 3300031781|Ga0318547_10374009 | All Organisms → cellular organisms → Bacteria | 872 | Open in IMG/M |
| 3300031782|Ga0318552_10561294 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 583 | Open in IMG/M |
| 3300031820|Ga0307473_11136912 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 577 | Open in IMG/M |
| 3300031823|Ga0307478_10588576 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 930 | Open in IMG/M |
| 3300031890|Ga0306925_11825918 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
| 3300031897|Ga0318520_10303085 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 963 | Open in IMG/M |
| 3300031912|Ga0306921_11141775 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 871 | Open in IMG/M |
| 3300031942|Ga0310916_10955659 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 716 | Open in IMG/M |
| 3300031962|Ga0307479_10758484 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 947 | Open in IMG/M |
| 3300031981|Ga0318531_10166737 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 989 | Open in IMG/M |
| 3300032001|Ga0306922_11494629 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 675 | Open in IMG/M |
| 3300032051|Ga0318532_10172591 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 768 | Open in IMG/M |
| 3300032174|Ga0307470_10783632 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 736 | Open in IMG/M |
| 3300032180|Ga0307471_101792162 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 765 | Open in IMG/M |
| 3300032261|Ga0306920_102063602 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 797 | Open in IMG/M |
| 3300032783|Ga0335079_10198876 | All Organisms → cellular organisms → Bacteria | 2224 | Open in IMG/M |
| 3300032954|Ga0335083_10828270 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 740 | Open in IMG/M |
| 3300033158|Ga0335077_10250192 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1964 | Open in IMG/M |
| 3300033158|Ga0335077_10840399 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 931 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 24.48% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 14.11% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.39% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.56% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.56% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 3.73% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 3.73% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.73% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.32% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.90% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.90% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.90% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.49% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 2.07% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.07% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.07% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.66% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.66% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.66% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.66% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.66% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.83% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.41% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.41% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.41% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.41% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.41% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 0.41% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.41% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.41% |
| Sandy Soil | Environmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil | 0.41% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.41% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.41% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.41% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.41% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.41% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000793 | Forest soil microbial communities from Amazon forest - 2010 replicate II A001 | Environmental | Open in IMG/M |
| 3300001137 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M3 | Environmental | Open in IMG/M |
| 3300001167 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M2 | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005531 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen12_06102014_R2 | Environmental | Open in IMG/M |
| 3300005533 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005607 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen15_06102014_R2 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009641 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_150 | Environmental | Open in IMG/M |
| 3300009764 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_40 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
| 3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
| 3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
| 3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300014502 | Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015356 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300016750 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017930 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5 | Environmental | Open in IMG/M |
| 3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
| 3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
| 3300017934 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300017988 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_30_metaG | Environmental | Open in IMG/M |
| 3300018033 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_10 | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300020006 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1m2 | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300024331 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK09 | Environmental | Open in IMG/M |
| 3300025441 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_100 (SPAdes) | Environmental | Open in IMG/M |
| 3300025454 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300025812 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 (SPAdes) | Environmental | Open in IMG/M |
| 3300026374 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-08-A | Environmental | Open in IMG/M |
| 3300026507 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-12-B | Environmental | Open in IMG/M |
| 3300026529 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes) | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300026830 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 33 (SPAdes) | Environmental | Open in IMG/M |
| 3300026999 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF044 (SPAdes) | Environmental | Open in IMG/M |
| 3300027011 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 29 (SPAdes) | Environmental | Open in IMG/M |
| 3300027069 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF002 (SPAdes) | Environmental | Open in IMG/M |
| 3300027376 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027565 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027616 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027655 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027667 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027678 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027703 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 81 (SPAdes) | Environmental | Open in IMG/M |
| 3300027706 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen15_06102014_R2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027825 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027857 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027898 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300029943 | I_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031128 | Oak Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
| 3300031248 (restricted) | Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH5_T0_E5 | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300031981 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032051 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f26 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| INPhiseqgaiiFebDRAFT_1041464531 | 3300000364 | Soil | MPGKQAKLAKPKPQHAPKAPHEDAKFLESTPARPLRILAEYI |
| INPhiseqgaiiFebDRAFT_1051434791 | 3300000364 | Soil | MVSERPKLKPQHAPKAPHGDKKFLESAPARPLRILAE |
| AF_2010_repII_A001DRAFT_100752791 | 3300000793 | Forest Soil | MPDGTKMKPQHAPKVSYEDPKFLGSVPARPIRIIAEYIHPLVQLKREGI |
| AF_2010_repII_A001DRAFT_100808591 | 3300000793 | Forest Soil | MPDGTKMKPQHAPKLSYEDPKFLGSVPARPIRIIAEY |
| JGI12637J13337_10129891 | 3300001137 | Forest Soil | MPDGKKLKQQHAPKAPHEDMDFLQSTAARPLRILAEYL |
| JGI12673J13574_10130312 | 3300001167 | Forest Soil | MPDGKRPKPQHAPKAPHENAEFLASTPARPIRIISEYIYPLVQLKKEGICDTIVM |
| JGI12635J15846_104973852 | 3300001593 | Forest Soil | MPDGKKLKQQHAPKAPHEDMDFLQSTAARPLRILAEYLHPLV |
| Ga0062385_102040221 | 3300004080 | Bog Forest Soil | MSQRQPKLKPQHAPKPPHEDLEFLQSTPARPLRIMAEYMQP |
| Ga0062384_1004820532 | 3300004082 | Bog Forest Soil | MAVRQPKLKPMHAPLAPHKDQAFLDSTAARPIRILAEYLQPLVQLKKEG |
| Ga0062590_1011114602 | 3300004157 | Soil | MSAGHLKLKPQHAPKAPHEDPRFLESTPARPLRILAEYLHPLVQL |
| Ga0066395_105737882 | 3300004633 | Tropical Forest Soil | MPDGKKMKPQHAPKVAHEDQKFLGSVPARPIRIMAEYIHPLVQLKNE |
| Ga0066395_109709171 | 3300004633 | Tropical Forest Soil | MPDGKKMKPQHAPKVAYEDQKFLGSVPARPIRIMTEYIHPLVQLKNEGI |
| Ga0062388_1000558361 | 3300004635 | Bog Forest Soil | MSQRQPKLKPQHAPKPPHEDLEFLQSTPARPVRILAEYLQPMMQLK |
| Ga0066672_104714951 | 3300005167 | Soil | MPNGKKLKPQHAPKVTHEDQKFLNSVPARPIRILGEYIHPLGQLKNEGI |
| Ga0070690_1006098672 | 3300005330 | Switchgrass Rhizosphere | MCAAQVKLKPLHAPKSPYQDPEFLGSTAARPIRILSEYLHPLVQLKKEG |
| Ga0070710_107173941 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | MPGKPAKPKPQHAPKAPHQDAKFLESTAARPLRILAEYIQPLAQ |
| Ga0070711_1018296352 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MSSAQLPKLKPQHAPKAPHEDPKFLESTPARPLRILAEYINPL |
| Ga0070741_105143422 | 3300005529 | Surface Soil | MSETGRNGKLKPQHAPKAPHEDAAFLESTPARPLRILA |
| Ga0070741_105654561 | 3300005529 | Surface Soil | MSPARPRLKPLHAPKVPHEDEQFLESVPARPLRILGEYI |
| Ga0070738_100267994 | 3300005531 | Surface Soil | MSETGRNGKLKPQHAPKAPHEDAAFLESTPARPLRILAEYL |
| Ga0070734_102973961 | 3300005533 | Surface Soil | MPDGKRPKPQHAPKAPHEDHKFMSSTPARPIRILAEYLHPLAQLKKE |
| Ga0066692_104382172 | 3300005555 | Soil | MPNGKRPKPQHAPKPPHQDPEFLSSTPARPIRILGEYIHPLVQL |
| Ga0066692_106649801 | 3300005555 | Soil | MPDGKRMKPQHAPKVAHQDQKFLNSVPARPIRILGEYIHPLVQLK |
| Ga0066707_107927521 | 3300005556 | Soil | MPNGKRPKPQHAPKPPHQDPEFLSSTPARPIRILGEYIHPLVQLKRE |
| Ga0066704_109647432 | 3300005557 | Soil | MPDGKRMKPLHAPKVAHQDQKFLNSVPARPIRILGEYIHPLVQLKNE |
| Ga0066693_104419492 | 3300005566 | Soil | MSDGQKPKPQHAPKAPHEDPIFLESTPARPIRILGEYIHPLVQL |
| Ga0066703_104286201 | 3300005568 | Soil | MSDGKKLKPQHAPKAPHEDPQFLRSTPARPIRILG |
| Ga0070761_108919621 | 3300005591 | Soil | MAVRQLKLKPMHAPLAPHKDPAFLESTAARPIRILAEYLQPLVQLK |
| Ga0070740_101242002 | 3300005607 | Surface Soil | MSETGRNGKLKPQHAPKAPHEDAAFLESTPARPLRILAEYLHP |
| Ga0070763_102315611 | 3300005610 | Soil | MSAGKPKLKPQHAPHAPHEDRHFLQSTPARPLRILAEY |
| Ga0070766_105256051 | 3300005921 | Soil | MPDGKRPKPQHAPKPPHQDPKFLASTPARPIRILGEYIHPLVQLKREGI |
| Ga0066656_101125565 | 3300006034 | Soil | MSDGRKLKPQHAPKAPHEDQQFLKSTPARPIRILGEYIHPLVQLKR |
| Ga0075029_1006951181 | 3300006052 | Watersheds | MSDGKKLKPQHAPKVTHEDQRFLNSVPARPIRILGEY |
| Ga0075015_1003929291 | 3300006102 | Watersheds | MPDGKRPKPQHAPKAPHENPEFLDSTPARPIRIISEYIYPLVQLKKE |
| Ga0070765_1019245561 | 3300006176 | Soil | MAVRQSKLKPMHAPLAPHKDPQFLESTAARPIRILAEYLQPLVQ |
| Ga0075021_108581962 | 3300006354 | Watersheds | MSDGQKLKPQHAPKAPHEDQKFLKSTPARPIRILGEYIHPLVQLKREG |
| Ga0066660_105947472 | 3300006800 | Soil | MPDGKKRKPQHAPKVAHEDEKFLSSVPARPIRILAE |
| Ga0075425_1012010683 | 3300006854 | Populus Rhizosphere | MSVKPAKLKPQHAPKAPHEDPVFLESTPARPLRILA |
| Ga0068865_1021314112 | 3300006881 | Miscanthus Rhizosphere | MSVKPGKLKPQHAPKAPHEDPVFLESTPARPLRILAEYINP |
| Ga0073928_100369984 | 3300006893 | Iron-Sulfur Acid Spring | MAVRQPKLKPMHAPLAPHKDPKFLESTAARPIRILAEYL |
| Ga0079219_106452212 | 3300006954 | Agricultural Soil | MPDGKKMKPQHAPKAPHADAKFLASVPARPIRIISEYIHPLVQLKNEGIGD |
| Ga0099791_105944221 | 3300007255 | Vadose Zone Soil | MFDGRELKPQHAPKAPHEDPEFLNSTPARPIRILGEYIHPLVQLKRE |
| Ga0099793_106922901 | 3300007258 | Vadose Zone Soil | MSAKPVKPKPQHAPKAPHEDPKFLESTPARPLRILAEYINP |
| Ga0099794_100679391 | 3300007265 | Vadose Zone Soil | MSDGKKLKPQHAPKAPHEDPVFLKSTPARPIRILGEYIH |
| Ga0099795_103139821 | 3300007788 | Vadose Zone Soil | MSPGPVKLKPQHAPKAPHQDPEFLESTAARPIRILAEYLH |
| Ga0066710_1027339001 | 3300009012 | Grasslands Soil | MSDGKKLKPQHAPNPPHQDPKFLASTPARPIRILGEYIHPLVQLKKEGI |
| Ga0066710_1028486381 | 3300009012 | Grasslands Soil | MPNGKKLKPQHAPKVTHEDQKFLNSVPARPIRILGEYIHPLGQLKNEGIGDT |
| Ga0066710_1034828562 | 3300009012 | Grasslands Soil | MSEGKKLKPQHAPKAPHEDPIFLKSTPARQIRIVG |
| Ga0099829_101047793 | 3300009038 | Vadose Zone Soil | MPDAKRPKPQHAPKAPHEDHSFLASTTARPIRILSEYLHPLVELKKE |
| Ga0099829_104732181 | 3300009038 | Vadose Zone Soil | MSDGKQLKPQHAPKAPHEDPKFLASTPARPIRILGEYIHPLVQLK |
| Ga0099830_110479961 | 3300009088 | Vadose Zone Soil | MSPGHVKLKPQHAPKVPHEDPQFLESTAARPLRILAEYLYPL |
| Ga0099830_110533752 | 3300009088 | Vadose Zone Soil | MPDGKKLKPQHAPKAPHEDTKFLNSTPARPIRILGEYIHPLV |
| Ga0099828_106229521 | 3300009089 | Vadose Zone Soil | MSDGKKLKPQHAPKAPHEDPRFLSSTPARPIRILGEYIHPLVQLKSEGIG |
| Ga0099828_107347241 | 3300009089 | Vadose Zone Soil | MSTGHVKLKPQHAPQVPHQDPQFLESNAARPLRIL |
| Ga0099828_111245702 | 3300009089 | Vadose Zone Soil | MSDGQKLKPQHAPKAPHEDQKFLKSTPARPIRILGEYIHPLVQL |
| Ga0099828_116192932 | 3300009089 | Vadose Zone Soil | MSDGKKLKPQHAPKAPHEDPQFLKSTPARPIRILGE |
| Ga0099828_120276632 | 3300009089 | Vadose Zone Soil | MSDGKKLKPQHAPKAAHEDQEFLNSTPARPIRILGEYIHPLVQLK |
| Ga0066709_1016715711 | 3300009137 | Grasslands Soil | MSDGKKLKPQHAPKAPHEDPEFLNSTPARPIRILAEYIHPLV |
| Ga0105242_101091123 | 3300009176 | Miscanthus Rhizosphere | MSVKPGKLKPLHAPKAPHEDPVFLESTPARPLRILAEYINPLAQL |
| Ga0116120_11474251 | 3300009641 | Peatland | MPDGKRLKPQHAPKAPHEDRKFMASTPARPIRILG |
| Ga0116134_11970771 | 3300009764 | Peatland | MPDGKRLKPQHAPKAPHEDRKFMASTPARPIRILGEYIYPLAQLKKEGI |
| Ga0126380_119739862 | 3300010043 | Tropical Forest Soil | MDIRFSEMAMSTGHIKLKPQHAPKVPHEDPMFLESTAARPLRILAE |
| Ga0099796_100558141 | 3300010159 | Vadose Zone Soil | MSSGPVKLKPQHAPKAPHQDPKFLESTAARPIRILAEYLHPLVQLKK |
| Ga0134088_100255034 | 3300010304 | Grasslands Soil | MSDGKKLKPQHAPKAPHEDPKFLSSTPARPIRILGEYIHPLVQL |
| Ga0134109_103252331 | 3300010320 | Grasslands Soil | MSDGKRLKPQHAPKPPHQDPKFLASTPARPIRILGEYIHPLVQLKREGI |
| Ga0134084_102340771 | 3300010322 | Grasslands Soil | MPDGKKLKPQHAPKASHEDQKFLNSVPARPIRILGEYIHPLVQLKNE |
| Ga0134064_104539051 | 3300010325 | Grasslands Soil | MPNGKKLKPQHAPKVTHEDQKFLNSVPARPIRILGEYIHPLGQLKNEGIGDTI |
| Ga0134071_104120211 | 3300010336 | Grasslands Soil | MAAARMHHRPTHAPAVPHEDPKFLQSTPARPLRILAEYLHPL |
| Ga0074044_105105501 | 3300010343 | Bog Forest Soil | MPQRQPKLKPQHAPKPPHEDLQFLQSTPARPVRILTEYLQPMMQ |
| Ga0126370_116268252 | 3300010358 | Tropical Forest Soil | MSSGHIKLKSQHAPKVPHEDPMFLQSTAARPLRILAEYLHP |
| Ga0126370_124962962 | 3300010358 | Tropical Forest Soil | MSAKPAKLKPQHAPKAPHEDPVFLESTPARPLRILAEYINPLAQLKR |
| Ga0126376_123713701 | 3300010359 | Tropical Forest Soil | MPDGKKMKPQHAPKVTHEDPKFLSSVPARPIRILGEYMHPLVQLKNE |
| Ga0126376_125173082 | 3300010359 | Tropical Forest Soil | MPDGKRPKPQHAPKAPHENPEFLASTPARPIRIIAEYTYPLVQLKKEGIGD |
| Ga0126377_102461681 | 3300010362 | Tropical Forest Soil | MSAKATKPKPQHAPKAPHEDPIFLASTPARPLRILAE |
| Ga0126379_126881621 | 3300010366 | Tropical Forest Soil | MVTRLSERIAMSSGHIKLKSQHAPKVPHEDPMFLQSTAARPLRILAEYLHPLVQL |
| Ga0137392_101357962 | 3300011269 | Vadose Zone Soil | MPPGHGKLKPQHAPKAPHQDPKFLDSSAARPIRILAEYLHPLVQL |
| Ga0137392_105684732 | 3300011269 | Vadose Zone Soil | MSDGKKLKPQHAPKAPHEDPEFLESTPARPIRILGEYIHPLVQLK |
| Ga0137392_114370241 | 3300011269 | Vadose Zone Soil | MSDGKKPKPHHAPKAPHEDPEFLESTPARPIRILGEYIHPLVQ |
| Ga0137391_105317491 | 3300011270 | Vadose Zone Soil | MPDGKKLKPQHAPKAPHEDQKFLNSTPARPIRILGEYIHPLVQLKREG |
| Ga0137393_100761824 | 3300011271 | Vadose Zone Soil | MSDGKKPKPQHAPKAPHEDPQFLESTPARPIRILGEYI |
| Ga0137393_100959674 | 3300011271 | Vadose Zone Soil | MSDSKKLKPQHAPKAPHEDPKFLGSTPARPIRILGEYIHPLVQLK |
| Ga0137393_102755831 | 3300011271 | Vadose Zone Soil | MSDGKKLKPQHAPNPPHQNPKFLASTPARPIRILGEYIHPLVQLKKEGIADT |
| Ga0137393_103116171 | 3300011271 | Vadose Zone Soil | MSDGKKLKPQHAPKAPHEDQKFLSSTPARPIRILGEY |
| Ga0137388_101617613 | 3300012189 | Vadose Zone Soil | MSDGHKLKPQHAPKAPHEDQKFLKSTPARPIRILGEYIHPLVQLKREGIGD |
| Ga0137388_103563862 | 3300012189 | Vadose Zone Soil | MSPGHVKLKPQHARKAPHQDPKFLDSTAARPLRILAEYLH |
| Ga0137388_117350982 | 3300012189 | Vadose Zone Soil | MPDAKRPKPQHAPKAPHEDHSFLASTTALPSRILSEYF |
| Ga0137363_102595802 | 3300012202 | Vadose Zone Soil | MSSGHVKLKPQHAPKAPHQDPKFLDSTAARPIRILAEYLYPLVQLK |
| Ga0137380_103525432 | 3300012206 | Vadose Zone Soil | MSDGKKLKPLHAPKAPHEDPQFLKSTPARPIRILGEYIHPLV |
| Ga0137379_115988131 | 3300012209 | Vadose Zone Soil | MSDGKKLKPQHAPNPPHQDPKFLASTPARPIRILGEY |
| Ga0137370_109523191 | 3300012285 | Vadose Zone Soil | MSDGQKPKPQHAPKAPHEDPIFLESTPARPIRILGEYIHPLVQLKREEIG |
| Ga0137387_105973582 | 3300012349 | Vadose Zone Soil | MSDGRKLKPQHAPKAPHEDQQFLKSTPARPIRILGEYIHPL |
| Ga0137366_103337281 | 3300012354 | Vadose Zone Soil | MSDGKKLKPQHAPNPPHQDPKFLASTPARPIRILGEYIH |
| Ga0137385_109771201 | 3300012359 | Vadose Zone Soil | MSDGKKLKPLHAPKAPHEDPQFLKSTPARPIRILGEYIHPL |
| Ga0137361_114792982 | 3300012362 | Vadose Zone Soil | MSTGHVKLKPQHAPKVPHEDPQFLESTAARPIRILAEYLH |
| Ga0137390_110266612 | 3300012363 | Vadose Zone Soil | MPDGKRPKPQHAPKAPHENAEFLASTPARPIRIISEYIYPLVQ |
| Ga0137390_113146981 | 3300012363 | Vadose Zone Soil | MSDGKKPKPQHAPKAPHEDPQFLESTPARPIRILGEY |
| Ga0137358_103999801 | 3300012582 | Vadose Zone Soil | MEKIPMSEGKRPKAQHAPKAPHENSEFLASTPARPIRIISEY |
| Ga0137358_111185092 | 3300012582 | Vadose Zone Soil | MSSDRPNMKPQRAPKAPHEDSKFLESTPARPLRILA* |
| Ga0137398_102773372 | 3300012683 | Vadose Zone Soil | MSDGKKLKPQHAPKAPHEDQKFLSSTPARPIRILG |
| Ga0137397_103147252 | 3300012685 | Vadose Zone Soil | MPNGKRPKPQHAPKPPHQDAEFLSSTPARPIRILGEYIHPLVQLKR |
| Ga0137397_104742331 | 3300012685 | Vadose Zone Soil | MSDGTRPKPQHAPKAPHEDPNFLASTPARPIRIISEYI |
| Ga0137396_103690721 | 3300012918 | Vadose Zone Soil | MSLGHVKLKPQHAPKAPHQDAKFLESTAARPIRILAEYLHPL |
| Ga0137394_110552492 | 3300012922 | Vadose Zone Soil | MPNGKRPKPQHAPKPPHQDAEFLSSTPARPIRILGEYIHPLVQLKREGIGDTV |
| Ga0137419_104494991 | 3300012925 | Vadose Zone Soil | MSDGTRPKPQHAPKAPHEDPNFLASTPARPIRIISEYIHPLVQLKR |
| Ga0137419_107492731 | 3300012925 | Vadose Zone Soil | MAVRQLKLKPMHAPLAPHKDPSFLESTAARPIRILAEYLQPLVQLKKEGI |
| Ga0137407_100980813 | 3300012930 | Vadose Zone Soil | MSDGQKLKPQHAPKAPHEDPKFLKSVPARPLRILGEYIHPLVQLKREG |
| Ga0137407_102865772 | 3300012930 | Vadose Zone Soil | MSPGPVKLKPQHAPKAPHQDPQFLDSTAARPIRILAEYLHPLV |
| Ga0164303_100414994 | 3300012957 | Soil | MSAKPAKPKPQHAPKAPHEDPKFLESTPARPLRILAEYINPLA |
| Ga0134087_100165994 | 3300012977 | Grasslands Soil | MSDGKRLKPQHAPKPPHQDPKFLASTPARPIRILGEYIHPLV |
| Ga0134075_101620652 | 3300014154 | Grasslands Soil | MSDGKKLKPQHAPNPPHQDPKFLASTPARPIRILGE |
| Ga0134078_100366603 | 3300014157 | Grasslands Soil | MSDGKKLKPQHAPKAPHEDPKFLSSTPARPIRILGEYIH |
| Ga0182021_135911972 | 3300014502 | Fen | MPDGKRLKPQHAPKAPHEDRKFMASTPARPIRILGE |
| Ga0137420_12683882 | 3300015054 | Vadose Zone Soil | MSDGHKLKPQHAPKAPHEDEKFLKSTPARPIRILGE |
| Ga0137409_109467872 | 3300015245 | Vadose Zone Soil | MSDGKKLKPQHAPKAPHEDQNFLSSTPARPIRILGEYIHPLV |
| Ga0134073_102239372 | 3300015356 | Grasslands Soil | MSDGKKLKAQHAPKAPHEDPEFLNSTPARPIRILAEYI |
| Ga0182032_111925381 | 3300016357 | Soil | MSPKSPKLRPLHAPKAAHEDPVFLASTPARPLRILAE |
| Ga0182040_107565792 | 3300016387 | Soil | MPVGKRPKPQHAPKASHEDRKFMSSTPARPIRILAEYLHPLAQLKKEG |
| Ga0182038_107499052 | 3300016445 | Soil | MPDGKRPKPQHAPKAPHEDRAFLCSTPARPIRILAEYIHPLAQLKKEGIG |
| Ga0182038_113761862 | 3300016445 | Soil | MPDGKRLKPLHAPKAPHEDHTFMSSTPARPIRILAEYLHPLA |
| Ga0181505_108129661 | 3300016750 | Peatland | MPDGKRLKPQHAPKAPHENHAFMQSTPARPIRILAEYLHP |
| Ga0187825_103201781 | 3300017930 | Freshwater Sediment | MSAGQRKLRPQHAPKTPHEDPKFLQSTPARPLRILAEYTHPLVQLKKEG |
| Ga0187814_101953062 | 3300017932 | Freshwater Sediment | MPDGKRLKPQHDPKTPHEDQSFLNSTPARPIRILGEYIHPLVQLKREGVG |
| Ga0187801_103656512 | 3300017933 | Freshwater Sediment | MVMPDGKRLKPLHAPKAPHEDRFFMNSTPARPIRILA |
| Ga0187803_100635621 | 3300017934 | Freshwater Sediment | MPDGKRLKPLHAPKAPHEDRRFMSSTPARPIRILAEYLHPL |
| Ga0187817_101990182 | 3300017955 | Freshwater Sediment | MSAGLPKLKPQHAPKAPHADHKFLESTPARPLRILAEYLHPLVQLKK |
| Ga0187779_102661431 | 3300017959 | Tropical Peatland | MSDGKKLKPQHAPKVTHEDQRFLNSVPARPIRILGEYIHPLVQLKNEGIGDTI |
| Ga0187782_104185511 | 3300017975 | Tropical Peatland | MPDGKRLKALHAPKAPHEDRFFMSSTPARPIRILAEYLHPLAQLKKEASATLS |
| Ga0181520_107373642 | 3300017988 | Bog | MPDGKRLKPQHAPKAPHEDRKFMASTPARPIRILGEYIYP |
| Ga0187867_104237412 | 3300018033 | Peatland | MPDGKRLKPQHAPKAPHEDRKFMASTPARPIRILGEYIYPLAQLKKEGIGDTI |
| Ga0187766_113175201 | 3300018058 | Tropical Peatland | MPDGKRLKPLHAPKAPHEDRSFMTSTPARPIRILAEYIHP |
| Ga0187784_101832463 | 3300018062 | Tropical Peatland | MPDGKRLKALHAPKAPHEDRFFMSSTPARPIRILAEY |
| Ga0187772_113887352 | 3300018085 | Tropical Peatland | MSAKLKPQHAPKAPHEDSRFLESTPARPLRILAEYL |
| Ga0066667_101045454 | 3300018433 | Grasslands Soil | MSDGRKPKPQHAPKAPHEDPIFLQSTPARPIRILGEYIHPLVQL |
| Ga0066662_114918392 | 3300018468 | Grasslands Soil | MSDGKKLKPQHAPKVPHEDPKFLNSTPARPIRILGEYIHPLVQL |
| Ga0066662_121002571 | 3300018468 | Grasslands Soil | MSDGKKLKPQHAPNPPHQDPKFLASTPARPIRILGEYIHP |
| Ga0137408_14388951 | 3300019789 | Vadose Zone Soil | MSSDRPKLKPQRAPKAPHEDSKFLESTPARPLRILAEYINPLA |
| Ga0193735_10951042 | 3300020006 | Soil | MSDGKKLKPQHAPKAPHEDPEFLNSTPARPIRILAEYIHP |
| Ga0179592_100016418 | 3300020199 | Vadose Zone Soil | MSDGKKLKPQHAPKAPHEDPEFLNSTPARPIRILAEYIHPLVQLKK |
| Ga0210403_102102863 | 3300020580 | Soil | MPDGNRPKPQHAPKAPHENPEFLASTPARPIRIISEYIYPL |
| Ga0210399_100450765 | 3300020581 | Soil | MSDGKKLKPQHAPKAPHEDPEFLNSTPARPIRILAEYIH |
| Ga0210401_111394551 | 3300020583 | Soil | MSVGHVKLKPQHAPKAPHQDPQFLESTAARPIRILAEYLHP |
| Ga0210404_101705281 | 3300021088 | Soil | MAVRRAKPKPMHAPLAPHKDPAFLDSTAARPIRILAEYLQPLVQL |
| Ga0210404_107483072 | 3300021088 | Soil | MPDGKKLKPQHAPKAPHEDQKFLDSTPARPIRILGEYIHP |
| Ga0210406_109705581 | 3300021168 | Soil | MSAGQPKPKPQHAPKASHEDHRFLESTPARPLRILAEYLHPLVQLKKEGI |
| Ga0210400_107336022 | 3300021170 | Soil | MSSGHVKLKPQHAPKVPHEDPQFLESTAARPIRILAEYLHPLVQL |
| Ga0210400_110133931 | 3300021170 | Soil | MPLGHVKLKPQHAPKVPHEDPQFLESTAARPIRILAEYLHPLVQL |
| Ga0210400_113152441 | 3300021170 | Soil | MSPGQLKLKPQHAPKAPHQDPQFLESTAARPIRILAEYLH |
| Ga0210388_110989521 | 3300021181 | Soil | MSDGNRPKPQHAPKAPHEDPKFLASTPARPIRIISE |
| Ga0210383_110250192 | 3300021407 | Soil | MSAGQPKLKPQHAPKAPHEDHRFLESTPARPLRILAEYLHP |
| Ga0210394_102251392 | 3300021420 | Soil | MSAKQEKPKPQHAPKAPHEDPKFLESTPARPLRILAEYL |
| Ga0210394_115120852 | 3300021420 | Soil | MSAGHPKLKPQHAPHAPHEDPYFLQSTPARPLRILAEYLHPLVQLK |
| Ga0210394_117554562 | 3300021420 | Soil | MSAALPKLKPRHAPKAPHEDPQFLQSTPARPLRILAEYI |
| Ga0210384_100486974 | 3300021432 | Soil | MSPGHVKLKPQHAPKVPHQDPEFLESTAARPIRILAEYLHPLVQLKNEGIGD |
| Ga0210384_101657611 | 3300021432 | Soil | MPVGKRPKPQHAPKAPHEDHKFMSSTPARPIRILAEYLHP |
| Ga0210384_104137021 | 3300021432 | Soil | MPDGQRLKPQHAPKAPHEDPTFLKSTPARPIRILGEYIHPL |
| Ga0210402_100923851 | 3300021478 | Soil | MSDGKKLKPQHAPKAPHEDQEFLNSIPARPIRILGEYIHP |
| Ga0210409_112411421 | 3300021559 | Soil | MPDGRRPKPQHAPKPPHEDPKFLKSTPARPIRILGEYIH |
| Ga0179589_103221932 | 3300024288 | Vadose Zone Soil | MSDGTRPKPQHAPKAPHEDPNFLASTPARPIRIISEYIHPPVQLKR |
| Ga0247668_10777901 | 3300024331 | Soil | MPGKPAKLAKPKPQHAPKAPHEDAKFLESTPARPLRILAEYIDPLAQL |
| Ga0208456_10190642 | 3300025441 | Peatland | MPDGKRLKLQHAPKAPHEDRHFMASTPARPIRILAEYIHPLAQ |
| Ga0208039_10500691 | 3300025454 | Peatland | MPDGKRLKPQHAPKAPHEDRHFMASTPARPIRILAEYIHPLAQLKKEGI |
| Ga0208457_10883091 | 3300025812 | Peatland | MARTPRTLRPVHAPRVAHKDRSFLESIPARPLRILNEYLHP |
| Ga0207692_109207401 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | MALATGHVKLKPQHAPKAPHQDPKFLDSTAARPIRILAEYLHPLVQLKNE |
| Ga0207663_103898262 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MSAVLPKLKPRHAPKAPHEDPEFLQSTPARPLRILA |
| Ga0207646_107800111 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MSAKLGKPKPQHAPKAPHEDPKFLESTAARPLRILAEYIDPMAKLKR |
| Ga0207700_115690932 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MSAVLPKLKPRHAPKAPHEDPEFLQSTPARPLRILAEYIHP |
| Ga0207664_107365961 | 3300025929 | Agricultural Soil | MALATGHVKLKPQHAPKAPHQDPQFLESTAARPLRILAEYLHPHQDHETT |
| Ga0207665_116876401 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MCAAQVKLKPMHAPKSPYQDSEFLGSTAARPIRILSEYLHPLVQLK |
| Ga0209472_12494342 | 3300026323 | Soil | MPDGKKLKPQHAPKAPHEDPEFLNSTPARPIRILAEYI |
| Ga0257146_10566322 | 3300026374 | Soil | MSAKPVKPKPQHAPKAPHEDPKFLESTPARPLRILAEYINPLA |
| Ga0257165_10610912 | 3300026507 | Soil | MSEGKRPKPQHAPKAPHENAEFLASTPARPIRIISEYIYPLV |
| Ga0209806_11948031 | 3300026529 | Soil | MPNGKRPKPQHAPKPPHQDPEFLSSTPARPIRILGE |
| Ga0209648_107480171 | 3300026551 | Grasslands Soil | MPDGKRPKPQHAPKAPHEDRKFMSSTPARPIRILAEYLHP |
| Ga0209648_107629601 | 3300026551 | Grasslands Soil | MSDGKKLKPQHAPKAPHEDQKFLSSTPARPIRILGEYIHPLVQLKRE |
| Ga0179587_101018822 | 3300026557 | Vadose Zone Soil | MSDGKKLKPQHAPKAPHEDPEFLESTPARPIRILGEYIHPLVQLKREGIG |
| Ga0179587_103842041 | 3300026557 | Vadose Zone Soil | MSDGKRLKPQHAPPAPHEDAKFLASTPARPIRILGEYIHPLV |
| Ga0179587_104816121 | 3300026557 | Vadose Zone Soil | MSDGQKLKPQHAPKAPHEDPKFLSSTPARPIRILG |
| Ga0207861_1071281 | 3300026830 | Tropical Forest Soil | MPDGKRLKPMHAPKAPHEDHTFMSSTPARPIRILAEYIHPL |
| Ga0207949_10081342 | 3300026999 | Forest Soil | MSDGKKLKPQHAPKAPHEDPEFLESTPARPIRILGEYIHPLVQLKR |
| Ga0207740_10064461 | 3300027011 | Tropical Forest Soil | MPDGKRLKPMHAPKAPHEDHTFMSSTPARPIRILAEYIHPLAQLKKEG |
| Ga0208859_10408262 | 3300027069 | Forest Soil | MSDGKRPKPQHAPKAPHENPEFLASTPARPIRIISEYIYPLVQ |
| Ga0209004_10019394 | 3300027376 | Forest Soil | MSDGNRPKPQHAPKAPHEDPKFLASTPARPVRIISEYIHPLV |
| Ga0209219_10542181 | 3300027565 | Forest Soil | MSPGHVKLKPQHAPKAPHQDQQFLESTAARPLRILAEYLHPLV |
| Ga0209106_10595341 | 3300027616 | Forest Soil | MSAALPKLKPRHAPKAPHEDPQFLQSTPARPLRILAEYIHPYVQLKK |
| Ga0209388_10894752 | 3300027655 | Vadose Zone Soil | MSLGHVKLKPQHAPKAPHQDPKFLDSTAARPIRILAEYLHPLVQLKNEGIGD |
| Ga0209388_11507782 | 3300027655 | Vadose Zone Soil | MPDGKKPKPQHAPKPPHQDPKFLSSTPARPIRILGEYIHPL |
| Ga0209009_10656761 | 3300027667 | Forest Soil | MLEAKRPKPQHAPKAPHEDPKFMSSTPARPIRILA |
| Ga0209011_11688082 | 3300027678 | Forest Soil | MPNGKRPKPQHAPKPPHQDPVFLASTPARPIRILGEYIHPLVQLKR |
| Ga0207862_12384791 | 3300027703 | Tropical Forest Soil | MPNGKRLKPQHAPKAPHEDPTFMKSTPARPIRILAEYLFP |
| Ga0209581_10040071 | 3300027706 | Surface Soil | MSETGRNGKLKPQHAPKAPHEDAAFLESTPARPLRILAEYLHPLVQLKK |
| Ga0209039_103603561 | 3300027825 | Bog Forest Soil | MPVGKRPKPQHAPKAPHEDHQFLSSTLARPIRILSE |
| Ga0209180_107185082 | 3300027846 | Vadose Zone Soil | MSDGKKLKPQHAPKAPHEDPEFLNSTPARPIRILGEYIH |
| Ga0209166_103048361 | 3300027857 | Surface Soil | MSPGHVKLKPQHAPKAPHQDAKFLESTAARPLRILAEYLHPL |
| Ga0209701_105849201 | 3300027862 | Vadose Zone Soil | MSDGQRLKPQHAPKAPHEDQNFLKSTPARPIRILGEYI |
| Ga0209167_103027412 | 3300027867 | Surface Soil | MSAKPAKLKPLHAPKAPHEDPVFLESTPARPLRIMAE |
| Ga0209167_106251351 | 3300027867 | Surface Soil | MSEGKRPKPQHAPKAPHENAEFLASTPARPIRIISE |
| Ga0209465_101847202 | 3300027874 | Tropical Forest Soil | MSDGKRLKPLHAPKAPHEDRFFMSSTPARPIRILAEYLHPLAQLKKEGI |
| Ga0209283_106259152 | 3300027875 | Vadose Zone Soil | MPDGKRMKPQHAPKVSHEDQKFLNSVPARPLRILGEYIHPLVQ |
| Ga0209275_106016831 | 3300027884 | Soil | MAVRRAKPKPMHAPLAPHKDPAFLDSTAARPIRILAEYLQPLVQLKKEGI |
| Ga0209067_106882431 | 3300027898 | Watersheds | MPRSLTKRLKPQHAPKAPHEDPTFMTSTPARPIRILAEYI |
| Ga0209006_104043232 | 3300027908 | Forest Soil | MPDGKRPKPQHAPKAPHENPEFLASTPARPIRIISEY |
| Ga0268264_101326201 | 3300028381 | Switchgrass Rhizosphere | MSEKPKLKPQHAPKAPHEDAVFLESTPARPLRIMAEYINPLAQL |
| Ga0308309_112551672 | 3300028906 | Soil | MPDGKRLKPQHAPKAPHENPEFMSSTPARPIRILAEYIYPLAQLKKEGIG |
| Ga0308309_113965151 | 3300028906 | Soil | MAVRQPKLKPMHAPLAPHKDQTFLDSTAARPIRILAEYLQPLVQLKTE |
| Ga0222749_105896941 | 3300029636 | Soil | MSPGHVKLKPQHAPKVPHQDPEFLESTAARPIRILAEYLHPLVQLKNE |
| Ga0311340_115703661 | 3300029943 | Palsa | MSQRSPKLKPQHAPKAPHEDLEFLQSTPARPVRILAEYLQPMMQL |
| Ga0170834_1116087382 | 3300031057 | Forest Soil | MSAGQRKLRPQHAPKTPHEDPKFLQSTPARPLRILAEYTHPLVQLKKE |
| Ga0170823_162235492 | 3300031128 | Forest Soil | MSAKPVKPKPQHAPKAPHEDPKFLESTPARPLRILAEYI |
| Ga0307497_107284781 | 3300031226 | Soil | MPVGKRPKPQHAPKAPHEDHKFMSSTPARPIRILAEYLHPLAQL |
| (restricted) Ga0255312_11576231 | 3300031248 | Sandy Soil | MPDGKRPKPQHAPKAPHENPEFLASTPARPIRIISEYIYPLVQLK |
| Ga0318541_100577061 | 3300031545 | Soil | MPNGKHPKPQHAPKAPHEDRAFLSSTPARPIRILGEYIHPLAQLKKEGIGN |
| Ga0318528_102736861 | 3300031561 | Soil | MPNGKHPKPQHAPKAPHEDRAFLSSTPARPIRILGEYIHPLAQLK |
| Ga0310915_100184766 | 3300031573 | Soil | MSAKPAKLKPQHAPRAPHEDPVFLESTPARPLRILAEYINPL |
| Ga0310915_101385011 | 3300031573 | Soil | MPNGKRPKPQHAPKAPHENHAFMTSTPARPIRILAEYIHPLAQ |
| Ga0310686_1020931611 | 3300031708 | Soil | MSAGQPKLKPQHAPKAPHEDHRFLESTPARPLRIL |
| Ga0307474_102005941 | 3300031718 | Hardwood Forest Soil | MSDGKRLKPQHAPKAPHEDPKFLKSTPARPIRILGEYLHP |
| Ga0307469_124340271 | 3300031720 | Hardwood Forest Soil | MSDGNRPKPQHAPKPPHEDPKFLKSTPARPIRILGEYIHPLVQL |
| Ga0318501_106768161 | 3300031736 | Soil | MPNGKHPKPQHAPKAPHEDRAFLSSTPARPIRILGEYIHPLA |
| Ga0307477_101197993 | 3300031753 | Hardwood Forest Soil | MSAGHRKLKPQHAPKAPHEDPKFLESTPARPLRILAEYIHPLVQL |
| Ga0307477_102816282 | 3300031753 | Hardwood Forest Soil | MSPGQLKLKPQHAPKAPHQDPQFLESTAARPIRILAEYLHPLVQLKNEGIGD |
| Ga0307475_102966131 | 3300031754 | Hardwood Forest Soil | MSAALPKLKPRHAPKAPHEDPDFLQSTPARPLRILAE |
| Ga0307475_114749482 | 3300031754 | Hardwood Forest Soil | MSAALPKLKPRHAPKAPHEDPDFLQSTPARPLRILAEYIHPY |
| Ga0318547_103740092 | 3300031781 | Soil | MPDGKKMKPQHAPKVSYEDPKFLESVPARPIRIIAEYLHP |
| Ga0318552_105612942 | 3300031782 | Soil | MSRKPAKLKPLHAPKAPHEDPVFLESTPARPLRIL |
| Ga0307473_111369122 | 3300031820 | Hardwood Forest Soil | MSDGKKLKPQHAPKAPHEDQKFLSSTPARPIRILGEYIH |
| Ga0307478_105885761 | 3300031823 | Hardwood Forest Soil | MSSGHVKLKPQHAPKAPHQDPKFLDSTAARPIRILAEYLHPLVQLK |
| Ga0306925_118259181 | 3300031890 | Soil | MPDGKRLRPQHAPKAPHEDRIFMSSTPARPIRILAEYLHPLAALK |
| Ga0318520_103030852 | 3300031897 | Soil | MPDGKRLRPLHAPKAPHEDRAFMSSTPARPIRILAEYL |
| Ga0306921_111417751 | 3300031912 | Soil | MSLKPKLKPQHAPKAPHEDPVFLESTPARPLRILAEYLNPLAQL |
| Ga0310916_109556592 | 3300031942 | Soil | MSAKPAKLKPQHAPRAPHEDPVFLESTPARPLRILAEYINP |
| Ga0307479_107584841 | 3300031962 | Hardwood Forest Soil | MSDGKKLKPQHAPKAPHEDPEFLESTPARPIRILGE |
| Ga0318531_101667372 | 3300031981 | Soil | MPNGKRPKPQHAPKAPHENHAFMTSTPARPIRILAE |
| Ga0306922_114946291 | 3300032001 | Soil | MPDGKRLKPLHAPKAPHEDHTFMSSTPARPIRILAEYLHPLAQLKKEGI |
| Ga0318532_101725911 | 3300032051 | Soil | MPDGKRPRPQHAPKAPHEDRAFMSSTPARPIRILAEYLH |
| Ga0307470_107836322 | 3300032174 | Hardwood Forest Soil | MSPGHVKLKPQHAPKAPHQDPKFLESTAARPIRILAEY |
| Ga0307471_1017921621 | 3300032180 | Hardwood Forest Soil | MSVKPGKLKPLHAPKAPHEDPVFLESTPARPLRILAEYVNPLAQLK |
| Ga0306920_1020636021 | 3300032261 | Soil | MSSTRPKLKPQHAPKAPHEDAKFLESTPARPLRILA |
| Ga0335079_101988761 | 3300032783 | Soil | MSDGKRLKPQHAPKAPHEDPKFLASTPARPIRIIAEYIHPLVQLKTE |
| Ga0335083_108282702 | 3300032954 | Soil | MPNGKTLKPQHAPRAPHENREFMSSTPARPIRILAEYTYPLVQ |
| Ga0335077_102501921 | 3300033158 | Soil | MPDGKRLKPLHAPKAPHEDYTFMSSTPARPIRILAEY |
| Ga0335077_108403991 | 3300033158 | Soil | MPDGKRPKPQHAPKAPHEDHKFMSSTPARPIRILAEYIHPLAQL |
| ⦗Top⦘ |