| Basic Information | |
|---|---|
| Family ID | F017242 |
| Family Type | Metagenome |
| Number of Sequences | 242 |
| Average Sequence Length | 41 residues |
| Representative Sequence | MADGTLKVGTITNSAGSGNITIGSGVTLLSNVPAFEAYL |
| Number of Associated Samples | 146 |
| Number of Associated Scaffolds | 242 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 94.81 % |
| % of genes near scaffold ends (potentially truncated) | 87.19 % |
| % of genes from short scaffolds (< 2000 bps) | 87.19 % |
| Associated GOLD sequencing projects | 113 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.29 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (43.802 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine (50.826 % of family members) |
| Environment Ontology (ENVO) | Unclassified (88.430 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (96.694 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 0.00% Coil/Unstructured: 100.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.29 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 242 Family Scaffolds |
|---|---|---|
| PF00386 | C1q | 11.57 |
| PF13884 | Peptidase_S74 | 3.31 |
| PF09636 | XkdW | 1.24 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 56.20 % |
| Unclassified | root | N/A | 43.80 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000115|DelMOSum2011_c10130515 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 772 | Open in IMG/M |
| 3300000116|DelMOSpr2010_c10102398 | Not Available | 1075 | Open in IMG/M |
| 3300000117|DelMOWin2010_c10083193 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae | 1238 | Open in IMG/M |
| 3300001450|JGI24006J15134_10127215 | All Organisms → Viruses | 869 | Open in IMG/M |
| 3300001450|JGI24006J15134_10172329 | Not Available | 686 | Open in IMG/M |
| 3300001731|JGI24514J20073_1019045 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
| 3300002482|JGI25127J35165_1026806 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Flavobacterium → unclassified Flavobacterium → Flavobacterium sp. SCGC AAA160-P02 | 1344 | Open in IMG/M |
| 3300002482|JGI25127J35165_1062623 | Not Available | 786 | Open in IMG/M |
| 3300002483|JGI25132J35274_1080728 | Not Available | 673 | Open in IMG/M |
| 3300002484|JGI25129J35166_1032443 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Flavobacterium → unclassified Flavobacterium → Flavobacterium sp. | 1097 | Open in IMG/M |
| 3300002488|JGI25128J35275_1079076 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Flavobacterium → unclassified Flavobacterium → Flavobacterium sp. SCGC AAA160-P02 | 677 | Open in IMG/M |
| 3300002514|JGI25133J35611_10094071 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Flavobacterium → unclassified Flavobacterium → Flavobacterium sp. SCGC AAA160-P02 | 895 | Open in IMG/M |
| 3300002514|JGI25133J35611_10117871 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Flavobacterium → unclassified Flavobacterium → Flavobacterium sp. | 761 | Open in IMG/M |
| 3300002518|JGI25134J35505_10026569 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Flavobacterium → unclassified Flavobacterium → Flavobacterium sp. SCGC AAA160-P02 | 1686 | Open in IMG/M |
| 3300004448|Ga0065861_1150072 | All Organisms → cellular organisms → Bacteria | 649 | Open in IMG/M |
| 3300005913|Ga0075108_10211152 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured phage MedDCM-OCT-S04-C136 | 670 | Open in IMG/M |
| 3300006026|Ga0075478_10083765 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → environmental samples → uncultured Bacteroidetes bacterium | 1025 | Open in IMG/M |
| 3300006735|Ga0098038_1143304 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured phage MedDCM-OCT-S04-C136 | 800 | Open in IMG/M |
| 3300006735|Ga0098038_1149566 | Not Available | 778 | Open in IMG/M |
| 3300006735|Ga0098038_1154963 | Not Available | 761 | Open in IMG/M |
| 3300006735|Ga0098038_1189293 | Not Available | 670 | Open in IMG/M |
| 3300006737|Ga0098037_1154584 | All Organisms → Viruses | 768 | Open in IMG/M |
| 3300006737|Ga0098037_1159188 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured phage MedDCM-OCT-S04-C136 | 755 | Open in IMG/M |
| 3300006737|Ga0098037_1181735 | Not Available | 695 | Open in IMG/M |
| 3300006737|Ga0098037_1286123 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 523 | Open in IMG/M |
| 3300006749|Ga0098042_1095443 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. | 757 | Open in IMG/M |
| 3300006749|Ga0098042_1144954 | Not Available | 583 | Open in IMG/M |
| 3300006750|Ga0098058_1052528 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1147 | Open in IMG/M |
| 3300006752|Ga0098048_1158992 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured phage MedDCM-OCT-S04-C136 | 672 | Open in IMG/M |
| 3300006753|Ga0098039_1228366 | Not Available | 628 | Open in IMG/M |
| 3300006754|Ga0098044_1347460 | Not Available | 563 | Open in IMG/M |
| 3300006789|Ga0098054_1174895 | Not Available | 787 | Open in IMG/M |
| 3300006789|Ga0098054_1265085 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 618 | Open in IMG/M |
| 3300006789|Ga0098054_1340111 | Not Available | 533 | Open in IMG/M |
| 3300006793|Ga0098055_1154796 | Not Available | 881 | Open in IMG/M |
| 3300006793|Ga0098055_1167297 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Candidatus Margulisbacteria → Candidatus Marinamargulisbacteria → unclassified Candidatus Marinamargulisbacteria → Candidatus Marinamargulisbacteria bacterium SCGC AAA071-K20 | 843 | Open in IMG/M |
| 3300006793|Ga0098055_1179706 | Not Available | 808 | Open in IMG/M |
| 3300006793|Ga0098055_1244168 | Not Available | 676 | Open in IMG/M |
| 3300006802|Ga0070749_10320468 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 866 | Open in IMG/M |
| 3300006802|Ga0070749_10619984 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured phage MedDCM-OCT-S04-C136 | 582 | Open in IMG/M |
| 3300006803|Ga0075467_10382578 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured phage MedDCM-OCT-S04-C136 | 735 | Open in IMG/M |
| 3300006810|Ga0070754_10233051 | All Organisms → cellular organisms → Bacteria | 846 | Open in IMG/M |
| 3300006810|Ga0070754_10272138 | Not Available | 768 | Open in IMG/M |
| 3300006916|Ga0070750_10096007 | All Organisms → Viruses → Predicted Viral | 1378 | Open in IMG/M |
| 3300006916|Ga0070750_10211619 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Candidatus Margulisbacteria → Candidatus Marinamargulisbacteria → unclassified Candidatus Marinamargulisbacteria → Candidatus Marinamargulisbacteria bacterium SCGC AAA071-K20 | 854 | Open in IMG/M |
| 3300006916|Ga0070750_10241010 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Candidatus Margulisbacteria → Candidatus Marinamargulisbacteria → unclassified Candidatus Marinamargulisbacteria → Candidatus Marinamargulisbacteria bacterium SCGC AAA071-K20 | 788 | Open in IMG/M |
| 3300006916|Ga0070750_10269574 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC203P | 735 | Open in IMG/M |
| 3300006919|Ga0070746_10243376 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Candidatus Margulisbacteria → Candidatus Marinamargulisbacteria → unclassified Candidatus Marinamargulisbacteria → Candidatus Marinamargulisbacteria bacterium SCGC AAA071-K20 | 842 | Open in IMG/M |
| 3300006919|Ga0070746_10452452 | Not Available | 570 | Open in IMG/M |
| 3300006921|Ga0098060_1134214 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 690 | Open in IMG/M |
| 3300006928|Ga0098041_1134455 | Not Available | 797 | Open in IMG/M |
| 3300006929|Ga0098036_1130838 | Not Available | 768 | Open in IMG/M |
| 3300006929|Ga0098036_1149476 | Not Available | 714 | Open in IMG/M |
| 3300007152|Ga0101672_1097790 | All Organisms → Viruses | 502 | Open in IMG/M |
| 3300007229|Ga0075468_10111459 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured phage MedDCM-OCT-S04-C136 | 857 | Open in IMG/M |
| 3300007276|Ga0070747_1102047 | All Organisms → Viruses → Predicted Viral | 1057 | Open in IMG/M |
| 3300007276|Ga0070747_1190513 | Not Available | 726 | Open in IMG/M |
| 3300007344|Ga0070745_1350758 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. UFLA03-84 | 517 | Open in IMG/M |
| 3300007346|Ga0070753_1294589 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Candidatus Margulisbacteria → Candidatus Marinamargulisbacteria → unclassified Candidatus Marinamargulisbacteria → Candidatus Marinamargulisbacteria bacterium SCGC AAA071-K20 | 581 | Open in IMG/M |
| 3300007540|Ga0099847_1170502 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured phage MedDCM-OCT-S04-C136 | 642 | Open in IMG/M |
| 3300007963|Ga0110931_1157316 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured phage MedDCM-OCT-S04-C136 | 682 | Open in IMG/M |
| 3300008012|Ga0075480_10425440 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured phage MedDCM-OCT-S04-C136 | 650 | Open in IMG/M |
| 3300008050|Ga0098052_1155936 | All Organisms → Viruses | 902 | Open in IMG/M |
| 3300009103|Ga0117901_1220864 | All Organisms → Viruses | 995 | Open in IMG/M |
| 3300009149|Ga0114918_10247987 | Not Available | 1014 | Open in IMG/M |
| 3300009426|Ga0115547_1199395 | Not Available | 631 | Open in IMG/M |
| 3300009428|Ga0114915_1112496 | All Organisms → Viruses | 799 | Open in IMG/M |
| 3300009433|Ga0115545_1188537 | Not Available | 706 | Open in IMG/M |
| 3300009435|Ga0115546_1120926 | All Organisms → Viruses | 938 | Open in IMG/M |
| 3300009435|Ga0115546_1142605 | Not Available | 848 | Open in IMG/M |
| 3300009550|Ga0115013_11468668 | Not Available | 510 | Open in IMG/M |
| 3300009604|Ga0114901_1118805 | All Organisms → Viruses | 816 | Open in IMG/M |
| 3300009605|Ga0114906_1111588 | Not Available | 974 | Open in IMG/M |
| 3300009790|Ga0115012_10752000 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED64 | 786 | Open in IMG/M |
| 3300009790|Ga0115012_11963364 | Not Available | 518 | Open in IMG/M |
| 3300010148|Ga0098043_1061486 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured phage MedDCM-OCT-S04-C136 | 1133 | Open in IMG/M |
| 3300010148|Ga0098043_1062716 | Not Available | 1120 | Open in IMG/M |
| 3300010148|Ga0098043_1111919 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured phage MedDCM-OCT-S04-C136 | 790 | Open in IMG/M |
| 3300010148|Ga0098043_1120004 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 758 | Open in IMG/M |
| 3300010148|Ga0098043_1137888 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured phage MedDCM-OCT-S04-C136 | 696 | Open in IMG/M |
| 3300010148|Ga0098043_1156804 | Not Available | 642 | Open in IMG/M |
| 3300010149|Ga0098049_1047568 | All Organisms → cellular organisms → Bacteria | 1372 | Open in IMG/M |
| 3300010149|Ga0098049_1128972 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 785 | Open in IMG/M |
| 3300010150|Ga0098056_1171526 | All Organisms → Viruses | 729 | Open in IMG/M |
| 3300010150|Ga0098056_1203291 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured phage MedDCM-OCT-S04-C136 | 661 | Open in IMG/M |
| 3300010150|Ga0098056_1208021 | Not Available | 653 | Open in IMG/M |
| 3300010151|Ga0098061_1176367 | Not Available | 765 | Open in IMG/M |
| 3300010153|Ga0098059_1219332 | All Organisms → Viruses | 738 | Open in IMG/M |
| 3300010153|Ga0098059_1375893 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Pelagivirus | 538 | Open in IMG/M |
| 3300010155|Ga0098047_10114233 | All Organisms → Viruses | 1051 | Open in IMG/M |
| 3300010155|Ga0098047_10321992 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured phage MedDCM-OCT-S04-C136 | 582 | Open in IMG/M |
| 3300010155|Ga0098047_10344062 | Not Available | 561 | Open in IMG/M |
| 3300010300|Ga0129351_1318646 | All Organisms → Viruses | 586 | Open in IMG/M |
| 3300012920|Ga0160423_10608319 | Not Available | 740 | Open in IMG/M |
| 3300017697|Ga0180120_10197166 | Not Available | 835 | Open in IMG/M |
| 3300017697|Ga0180120_10205959 | Not Available | 813 | Open in IMG/M |
| 3300017697|Ga0180120_10417378 | All Organisms → Viruses | 525 | Open in IMG/M |
| 3300017703|Ga0181367_1045089 | All Organisms → Viruses | 781 | Open in IMG/M |
| 3300017706|Ga0181377_1045682 | Not Available | 853 | Open in IMG/M |
| 3300017708|Ga0181369_1091871 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured phage MedDCM-OCT-S04-C136 | 637 | Open in IMG/M |
| 3300017709|Ga0181387_1117984 | Not Available | 545 | Open in IMG/M |
| 3300017714|Ga0181412_1026310 | All Organisms → Viruses → Predicted Viral | 1590 | Open in IMG/M |
| 3300017731|Ga0181416_1027735 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured phage MedDCM-OCT-S04-C136 | 1329 | Open in IMG/M |
| 3300017739|Ga0181433_1069352 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Pelagivirus | 879 | Open in IMG/M |
| 3300017740|Ga0181418_1084101 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Pelagivirus | 775 | Open in IMG/M |
| 3300017744|Ga0181397_1135133 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured phage MedDCM-OCT-S04-C136 | 636 | Open in IMG/M |
| 3300017744|Ga0181397_1152136 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured phage MedDCM-OCT-S04-C136 | 591 | Open in IMG/M |
| 3300017746|Ga0181389_1124505 | All Organisms → Viruses | 697 | Open in IMG/M |
| 3300017746|Ga0181389_1152637 | Not Available | 613 | Open in IMG/M |
| 3300017749|Ga0181392_1096436 | Not Available | 885 | Open in IMG/M |
| 3300017749|Ga0181392_1139800 | Not Available | 711 | Open in IMG/M |
| 3300017755|Ga0181411_1138555 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 704 | Open in IMG/M |
| 3300017755|Ga0181411_1152376 | All Organisms → Viruses | 665 | Open in IMG/M |
| 3300017756|Ga0181382_1128407 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Pelagivirus | 672 | Open in IMG/M |
| 3300017758|Ga0181409_1175743 | Not Available | 623 | Open in IMG/M |
| 3300017759|Ga0181414_1113869 | All Organisms → Viruses | 710 | Open in IMG/M |
| 3300017762|Ga0181422_1223601 | All Organisms → Viruses | 562 | Open in IMG/M |
| 3300017763|Ga0181410_1050573 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Pelagivirus | 1277 | Open in IMG/M |
| 3300017764|Ga0181385_1241566 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Pelagivirus | 542 | Open in IMG/M |
| 3300017769|Ga0187221_1123854 | Not Available | 778 | Open in IMG/M |
| 3300017781|Ga0181423_1276765 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Candidatus Margulisbacteria → Candidatus Marinamargulisbacteria → unclassified Candidatus Marinamargulisbacteria → Candidatus Marinamargulisbacteria bacterium SCGC AAA071-K20 | 622 | Open in IMG/M |
| 3300017783|Ga0181379_1277463 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured phage MedDCM-OCT-S04-C136 | 573 | Open in IMG/M |
| 3300017967|Ga0181590_10295782 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae | 1179 | Open in IMG/M |
| 3300017967|Ga0181590_10556578 | Not Available | 791 | Open in IMG/M |
| 3300018048|Ga0181606_10173440 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured phage MedDCM-OCT-S08-C233 | 1276 | Open in IMG/M |
| 3300018416|Ga0181553_10327075 | Not Available | 847 | Open in IMG/M |
| 3300018420|Ga0181563_10457087 | Not Available | 722 | Open in IMG/M |
| 3300018420|Ga0181563_10577483 | Not Available | 626 | Open in IMG/M |
| 3300018424|Ga0181591_10354180 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → environmental samples → uncultured Bacteroidetes bacterium | 1105 | Open in IMG/M |
| 3300020191|Ga0181604_10239781 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. | 856 | Open in IMG/M |
| 3300020374|Ga0211477_10213498 | Not Available | 671 | Open in IMG/M |
| 3300020381|Ga0211476_10226216 | All Organisms → Viruses → environmental samples → uncultured virus | 654 | Open in IMG/M |
| 3300020437|Ga0211539_10246897 | All Organisms → Viruses | 736 | Open in IMG/M |
| 3300020446|Ga0211574_10241881 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 782 | Open in IMG/M |
| 3300021335|Ga0213867_1073715 | All Organisms → Viruses → Predicted Viral | 1260 | Open in IMG/M |
| 3300021373|Ga0213865_10317047 | Not Available | 720 | Open in IMG/M |
| 3300021964|Ga0222719_10538706 | Not Available | 692 | Open in IMG/M |
| 3300022074|Ga0224906_1066948 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1113 | Open in IMG/M |
| 3300022074|Ga0224906_1131583 | Not Available | 717 | Open in IMG/M |
| 3300022178|Ga0196887_1092383 | Not Available | 689 | Open in IMG/M |
| 3300022187|Ga0196899_1096745 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured phage MedDCM-OCT-S04-C136 | 880 | Open in IMG/M |
| 3300022187|Ga0196899_1113901 | Not Available | 786 | Open in IMG/M |
| 3300022929|Ga0255752_10246505 | Not Available | 796 | Open in IMG/M |
| 3300023116|Ga0255751_10126369 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 1541 | Open in IMG/M |
| 3300023176|Ga0255772_10182242 | All Organisms → Viruses | 1212 | Open in IMG/M |
| 3300023176|Ga0255772_10192582 | Not Available | 1166 | Open in IMG/M |
| 3300025072|Ga0208920_1029709 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Pelagivirus | 1147 | Open in IMG/M |
| 3300025072|Ga0208920_1034664 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1044 | Open in IMG/M |
| 3300025083|Ga0208791_1050521 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 726 | Open in IMG/M |
| 3300025086|Ga0208157_1093369 | Not Available | 733 | Open in IMG/M |
| 3300025086|Ga0208157_1133212 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 564 | Open in IMG/M |
| 3300025096|Ga0208011_1042461 | All Organisms → Viruses | 1076 | Open in IMG/M |
| 3300025096|Ga0208011_1090318 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured phage MedDCM-OCT-S04-C136 | 660 | Open in IMG/M |
| 3300025097|Ga0208010_1035811 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1144 | Open in IMG/M |
| 3300025098|Ga0208434_1039325 | Not Available | 1077 | Open in IMG/M |
| 3300025098|Ga0208434_1076357 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 688 | Open in IMG/M |
| 3300025101|Ga0208159_1037511 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1064 | Open in IMG/M |
| 3300025101|Ga0208159_1062401 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured phage MedDCM-OCT-S04-C136 | 740 | Open in IMG/M |
| 3300025102|Ga0208666_1033464 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Candidatus Margulisbacteria → Candidatus Marinamargulisbacteria → unclassified Candidatus Marinamargulisbacteria → Candidatus Marinamargulisbacteria bacterium SCGC AAA071-K20 | 1538 | Open in IMG/M |
| 3300025102|Ga0208666_1129683 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 587 | Open in IMG/M |
| 3300025103|Ga0208013_1042538 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Candidatus Margulisbacteria → Candidatus Marinamargulisbacteria → unclassified Candidatus Marinamargulisbacteria → Candidatus Marinamargulisbacteria bacterium SCGC AAA071-K20 | 1260 | Open in IMG/M |
| 3300025108|Ga0208793_1083387 | Not Available | 918 | Open in IMG/M |
| 3300025108|Ga0208793_1104884 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Candidatus Margulisbacteria → Candidatus Marinamargulisbacteria → unclassified Candidatus Marinamargulisbacteria → Candidatus Marinamargulisbacteria bacterium SCGC AAA071-K20 | 788 | Open in IMG/M |
| 3300025108|Ga0208793_1141391 | Not Available | 642 | Open in IMG/M |
| 3300025109|Ga0208553_1040815 | All Organisms → Viruses → Predicted Viral | 1169 | Open in IMG/M |
| 3300025109|Ga0208553_1109156 | Not Available | 635 | Open in IMG/M |
| 3300025109|Ga0208553_1110251 | Not Available | 631 | Open in IMG/M |
| 3300025110|Ga0208158_1053653 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured phage MedDCM-OCT-S04-C136 | 988 | Open in IMG/M |
| 3300025110|Ga0208158_1090746 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured phage MedDCM-OCT-S04-C136 | 722 | Open in IMG/M |
| 3300025110|Ga0208158_1145609 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 539 | Open in IMG/M |
| 3300025114|Ga0208433_1131476 | Not Available | 601 | Open in IMG/M |
| 3300025118|Ga0208790_1009156 | All Organisms → Viruses | 3657 | Open in IMG/M |
| 3300025118|Ga0208790_1162778 | Not Available | 610 | Open in IMG/M |
| 3300025118|Ga0208790_1178690 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured phage MedDCM-OCT-S04-C136 | 571 | Open in IMG/M |
| 3300025120|Ga0209535_1098978 | Not Available | 1049 | Open in IMG/M |
| 3300025120|Ga0209535_1112479 | All Organisms → Viruses | 946 | Open in IMG/M |
| 3300025120|Ga0209535_1161939 | Not Available | 687 | Open in IMG/M |
| 3300025120|Ga0209535_1167758 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. | 665 | Open in IMG/M |
| 3300025120|Ga0209535_1169288 | All Organisms → Viruses | 660 | Open in IMG/M |
| 3300025127|Ga0209348_1043951 | All Organisms → Viruses → Predicted Viral | 1538 | Open in IMG/M |
| 3300025127|Ga0209348_1074280 | Not Available | 1096 | Open in IMG/M |
| 3300025127|Ga0209348_1103379 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured phage MedDCM-OCT-S04-C136 | 882 | Open in IMG/M |
| 3300025128|Ga0208919_1087722 | All Organisms → Viruses | 1013 | Open in IMG/M |
| 3300025131|Ga0209128_1052057 | All Organisms → Viruses | 1492 | Open in IMG/M |
| 3300025131|Ga0209128_1071147 | All Organisms → Viruses | 1195 | Open in IMG/M |
| 3300025131|Ga0209128_1143349 | Not Available | 722 | Open in IMG/M |
| 3300025131|Ga0209128_1148187 | All Organisms → Viruses | 705 | Open in IMG/M |
| 3300025132|Ga0209232_1100517 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage Lederberg EXVC029P | 977 | Open in IMG/M |
| 3300025132|Ga0209232_1143850 | All Organisms → Viruses | 767 | Open in IMG/M |
| 3300025138|Ga0209634_1231929 | Not Available | 681 | Open in IMG/M |
| 3300025141|Ga0209756_1177533 | All Organisms → Viruses | 833 | Open in IMG/M |
| 3300025151|Ga0209645_1088414 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured phage MedDCM-OCT-S04-C136 | 1020 | Open in IMG/M |
| 3300025151|Ga0209645_1109762 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → unclassified Siphoviridae → Pelagibacter phage HTVC010P | 886 | Open in IMG/M |
| 3300025543|Ga0208303_1057549 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured phage MedDCM-OCT-S04-C136 | 922 | Open in IMG/M |
| 3300025543|Ga0208303_1061792 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. | 876 | Open in IMG/M |
| 3300025652|Ga0208134_1041525 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1526 | Open in IMG/M |
| 3300025729|Ga0209558_1184580 | All Organisms → Viruses | 677 | Open in IMG/M |
| 3300025759|Ga0208899_1127537 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured phage MedDCM-OCT-S04-C136 | 904 | Open in IMG/M |
| 3300025759|Ga0208899_1131153 | Not Available | 885 | Open in IMG/M |
| 3300025769|Ga0208767_1148153 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 859 | Open in IMG/M |
| 3300025769|Ga0208767_1205208 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 658 | Open in IMG/M |
| 3300025803|Ga0208425_1119321 | Not Available | 604 | Open in IMG/M |
| 3300025806|Ga0208545_1121415 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured phage MedDCM-OCT-S04-C136 | 656 | Open in IMG/M |
| 3300025810|Ga0208543_1096766 | Not Available | 706 | Open in IMG/M |
| 3300025816|Ga0209193_1052122 | Not Available | 1132 | Open in IMG/M |
| 3300025816|Ga0209193_1074312 | All Organisms → Viruses | 889 | Open in IMG/M |
| 3300025873|Ga0209757_10190749 | Not Available | 647 | Open in IMG/M |
| 3300026259|Ga0208896_1085188 | Not Available | 913 | Open in IMG/M |
| 3300029319|Ga0183748_1055686 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1091 | Open in IMG/M |
| 3300029319|Ga0183748_1096284 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured phage MedDCM-OCT-S04-C136 | 689 | Open in IMG/M |
| 3300029319|Ga0183748_1104154 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 644 | Open in IMG/M |
| 3300033742|Ga0314858_088849 | Not Available | 779 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 50.83% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 16.12% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 11.57% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 4.96% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 2.89% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 2.48% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 2.07% |
| Deep Ocean | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean | 1.24% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 1.24% |
| Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 0.83% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 0.83% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.83% |
| Saline Lake | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake | 0.83% |
| Surface Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater | 0.41% |
| Microbial Mat | Environmental → Aquatic → Marine → Coastal → Sediment → Microbial Mat | 0.41% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.41% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.41% |
| Sea-Ice Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sea-Ice Brine | 0.41% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 0.41% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 0.41% |
| Volcanic Co2 Seeps | Environmental → Aquatic → Marine → Volcanic → Unclassified → Volcanic Co2 Seeps | 0.41% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000115 | Marine microbial communities from Delaware Coast, sample from Delaware MO Summer July 2011 | Environmental | Open in IMG/M |
| 3300000116 | Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010 | Environmental | Open in IMG/M |
| 3300000117 | Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010 | Environmental | Open in IMG/M |
| 3300001450 | Marine viral communities from the Pacific Ocean - LP-53 | Environmental | Open in IMG/M |
| 3300001731 | Marine viral communities from the Pacific Ocean - LP-37 | Environmental | Open in IMG/M |
| 3300002482 | Marine viral communities from the Pacific Ocean - ETNP_2_30 | Environmental | Open in IMG/M |
| 3300002483 | Marine viral communities from the Pacific Ocean - ETNP_6_30 | Environmental | Open in IMG/M |
| 3300002484 | Marine viral communities from the Pacific Ocean - ETNP_2_130 | Environmental | Open in IMG/M |
| 3300002488 | Marine viral communities from the Pacific Ocean - ETNP_2_60 | Environmental | Open in IMG/M |
| 3300002514 | Marine viral communities from the Pacific Ocean - ETNP_6_85 | Environmental | Open in IMG/M |
| 3300002518 | Marine viral communities from the Pacific Ocean - ETNP_6_100 | Environmental | Open in IMG/M |
| 3300004448 | Marine viral communities from Newfoundland, Canada BC-1 | Environmental | Open in IMG/M |
| 3300005913 | Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UK1 | Environmental | Open in IMG/M |
| 3300006026 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006735 | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG | Environmental | Open in IMG/M |
| 3300006737 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG | Environmental | Open in IMG/M |
| 3300006738 | Marine viral communities from the Subarctic Pacific Ocean - 3_ETSP_OMZ_AT15126 metaG | Environmental | Open in IMG/M |
| 3300006749 | Marine viral communities from the Subarctic Pacific Ocean - 9_ETSP_OMZ_AT15188 metaG | Environmental | Open in IMG/M |
| 3300006750 | Marine viral communities from the Subarctic Pacific Ocean - 19_ETSP_OMZ_AT15317 metaG | Environmental | Open in IMG/M |
| 3300006752 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG | Environmental | Open in IMG/M |
| 3300006753 | Marine viral communities from the Subarctic Pacific Ocean - 6_ETSP_OMZ_AT15160 metaG | Environmental | Open in IMG/M |
| 3300006754 | Marine viral communities from the Subarctic Pacific Ocean - 10_ETSP_OMZ_AT15264 metaG | Environmental | Open in IMG/M |
| 3300006789 | Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG | Environmental | Open in IMG/M |
| 3300006793 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006803 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 | Environmental | Open in IMG/M |
| 3300006916 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 | Environmental | Open in IMG/M |
| 3300006919 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 | Environmental | Open in IMG/M |
| 3300006921 | Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaG | Environmental | Open in IMG/M |
| 3300006924 | Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaG | Environmental | Open in IMG/M |
| 3300006928 | Marine viral communities from the Subarctic Pacific Ocean - 8_ETSP_OMZ_AT15162 metaG | Environmental | Open in IMG/M |
| 3300006929 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG | Environmental | Open in IMG/M |
| 3300007152 | Seawater microbiome, Papua New Guinea CO2 seep, Dobu 'bubble', waterEBds3 | Environmental | Open in IMG/M |
| 3300007229 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007276 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 | Environmental | Open in IMG/M |
| 3300007344 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 | Environmental | Open in IMG/M |
| 3300007346 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 | Environmental | Open in IMG/M |
| 3300007540 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007963 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG (version 2) | Environmental | Open in IMG/M |
| 3300008012 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_DNA | Environmental | Open in IMG/M |
| 3300008050 | Marine viral communities from the Subarctic Pacific Ocean - 15_ETSP_OMZ_AT15312 metaG | Environmental | Open in IMG/M |
| 3300009103 | Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 143m, 250-2.7um | Environmental | Open in IMG/M |
| 3300009149 | Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG | Environmental | Open in IMG/M |
| 3300009426 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100420 | Environmental | Open in IMG/M |
| 3300009428 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_55 | Environmental | Open in IMG/M |
| 3300009433 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100330 | Environmental | Open in IMG/M |
| 3300009435 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100413 | Environmental | Open in IMG/M |
| 3300009529 | Deep subsurface microbial communities from Black Sea to uncover new lineages of life (NeLLi) - Black_00105 metaG | Environmental | Open in IMG/M |
| 3300009550 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - South Atlantic ANT15 Metagenome | Environmental | Open in IMG/M |
| 3300009604 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s16 | Environmental | Open in IMG/M |
| 3300009605 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_M9 | Environmental | Open in IMG/M |
| 3300009790 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT10 Metagenome | Environmental | Open in IMG/M |
| 3300010148 | Marine viral communities from the Subarctic Pacific Ocean - 9B_ETSP_OMZ_AT15188_CsCl metaG | Environmental | Open in IMG/M |
| 3300010149 | Marine viral communities from the Subarctic Pacific Ocean - 13B_ETSP_OMZ_AT15268_CsCl metaG | Environmental | Open in IMG/M |
| 3300010150 | Marine viral communities from the Subarctic Pacific Ocean - 17B_ETSP_OMZ_AT15314_CsCl metaG | Environmental | Open in IMG/M |
| 3300010151 | Marine viral communities from the Subarctic Pacific Ocean - 22_ETSP_OMZ_AT15343 metaG | Environmental | Open in IMG/M |
| 3300010153 | Marine viral communities from the Subarctic Pacific Ocean - 20_ETSP_OMZ_AT15318 metaG | Environmental | Open in IMG/M |
| 3300010155 | Marine viral communities from the Subarctic Pacific Ocean - 12_ETSP_OMZ_AT15267 metaG | Environmental | Open in IMG/M |
| 3300010300 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_DNA | Environmental | Open in IMG/M |
| 3300012920 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St8 metaG | Environmental | Open in IMG/M |
| 3300017697 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_DNA (version 2) | Environmental | Open in IMG/M |
| 3300017703 | Marine viral communities from the Subarctic Pacific Ocean - ?Lowphox_02 viral metaG | Environmental | Open in IMG/M |
| 3300017706 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_13 viral metaG | Environmental | Open in IMG/M |
| 3300017708 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_04 viral metaG | Environmental | Open in IMG/M |
| 3300017709 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 10 SPOT_SRF_2010-04-27 | Environmental | Open in IMG/M |
| 3300017714 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 35 SPOT_SRF_2012-08-15 | Environmental | Open in IMG/M |
| 3300017731 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 39 SPOT_SRF_2013-01-16 | Environmental | Open in IMG/M |
| 3300017739 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10 | Environmental | Open in IMG/M |
| 3300017740 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 41 SPOT_SRF_2013-03-13 | Environmental | Open in IMG/M |
| 3300017741 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 44 SPOT_SRF_2013-06-19 | Environmental | Open in IMG/M |
| 3300017744 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 20 SPOT_SRF_2011-02-23 | Environmental | Open in IMG/M |
| 3300017746 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 12 SPOT_SRF_2010-06-29 | Environmental | Open in IMG/M |
| 3300017749 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15 | Environmental | Open in IMG/M |
| 3300017755 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 34 SPOT_SRF_2012-07-09 | Environmental | Open in IMG/M |
| 3300017756 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 5 SPOT_SRF_2009-10-22 | Environmental | Open in IMG/M |
| 3300017758 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 32 SPOT_SRF_2012-05-30 | Environmental | Open in IMG/M |
| 3300017759 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 37 SPOT_SRF_2012-11-28 | Environmental | Open in IMG/M |
| 3300017762 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 45 SPOT_SRF_2013-07-18 | Environmental | Open in IMG/M |
| 3300017763 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 33 SPOT_SRF_2012-06-20 | Environmental | Open in IMG/M |
| 3300017764 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 8 SPOT_SRF_2010-02-11 | Environmental | Open in IMG/M |
| 3300017769 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 5 SPOT_SRF_2009-10-22 (version 2) | Environmental | Open in IMG/M |
| 3300017781 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 46 SPOT_SRF_2013-08-14 | Environmental | Open in IMG/M |
| 3300017783 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 2 SPOT_SRF_2009-07-10 | Environmental | Open in IMG/M |
| 3300017967 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071411BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018048 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041412US metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018416 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018420 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018424 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300020191 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041410US metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020374 | Marine microbial communities from Tara Oceans - TARA_A100001011 (ERX291766-ERR318618) | Environmental | Open in IMG/M |
| 3300020381 | Marine microbial communities from Tara Oceans - TARA_A100001011 (ERX291769-ERR318620) | Environmental | Open in IMG/M |
| 3300020437 | Marine microbial communities from Tara Oceans - TARA_B100000282 (ERX555906-ERR599074) | Environmental | Open in IMG/M |
| 3300020446 | Marine microbial communities from Tara Oceans - TARA_B100001287 (ERX556031-ERR598989) | Environmental | Open in IMG/M |
| 3300021335 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO540 | Environmental | Open in IMG/M |
| 3300021373 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO282 | Environmental | Open in IMG/M |
| 3300021958 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_27D | Environmental | Open in IMG/M |
| 3300021964 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_34D | Environmental | Open in IMG/M |
| 3300022053 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (v2) | Environmental | Open in IMG/M |
| 3300022074 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10 (v2) | Environmental | Open in IMG/M |
| 3300022178 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (v3) | Environmental | Open in IMG/M |
| 3300022187 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (v3) | Environmental | Open in IMG/M |
| 3300022929 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG | Environmental | Open in IMG/M |
| 3300023116 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412BT metaG | Environmental | Open in IMG/M |
| 3300023176 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071411BT metaG | Environmental | Open in IMG/M |
| 3300025072 | Marine viral communities from the Subarctic Pacific Ocean - 19_ETSP_OMZ_AT15317 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025083 | Marine viral communities from the Subarctic Pacific Ocean - 11_ETSP_OMZ_AT15265 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025085 | Marine viral communities from the Subarctic Pacific Ocean - 14_ETSP_OMZ_AT15311 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025086 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025096 | Marine viral communities from the Subarctic Pacific Ocean - 7_ETSP_OMZ_AT15161 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025097 | Marine viral communities from the Subarctic Pacific Ocean - 2_ETSP_OMZ_AT15125 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025098 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025101 | Marine viral communities from the Subarctic Pacific Ocean - 9_ETSP_OMZ_AT15188 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025102 | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025103 | Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025108 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025109 | Marine viral communities from the Subarctic Pacific Ocean - 6_ETSP_OMZ_AT15160 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025110 | Marine viral communities from the Subarctic Pacific Ocean - 8_ETSP_OMZ_AT15162 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025114 | Marine viral communities from the Subarctic Pacific Ocean - 3_ETSP_OMZ_AT15126 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025118 | Marine viral communities from the Subarctic Pacific Ocean - 10_ETSP_OMZ_AT15264 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025120 | Marine viral communities from the Pacific Ocean - LP-28 (SPAdes) | Environmental | Open in IMG/M |
| 3300025127 | Marine viral communities from the Pacific Ocean - ETNP_2_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300025128 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025131 | Marine viral communities from the Pacific Ocean - ETNP_6_100 (SPAdes) | Environmental | Open in IMG/M |
| 3300025132 | Marine viral communities from the Pacific Ocean - ETNP_2_60 (SPAdes) | Environmental | Open in IMG/M |
| 3300025138 | Marine viral communities from the Pacific Ocean - LP-40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025141 | Marine viral communities from the Pacific Ocean - ETNP_6_85 (SPAdes) | Environmental | Open in IMG/M |
| 3300025151 | Marine viral communities from the Pacific Ocean - ETNP_6_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300025438 | Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UK9 (SPAdes) | Environmental | Open in IMG/M |
| 3300025543 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025645 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (SPAdes) | Environmental | Open in IMG/M |
| 3300025652 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (SPAdes) | Environmental | Open in IMG/M |
| 3300025729 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI074_LV_150m_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025759 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (SPAdes) | Environmental | Open in IMG/M |
| 3300025769 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (SPAdes) | Environmental | Open in IMG/M |
| 3300025803 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025806 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025816 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100330 (SPAdes) | Environmental | Open in IMG/M |
| 3300025853 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (SPAdes) | Environmental | Open in IMG/M |
| 3300025873 | Marine viral communities from the Pacific Ocean - ETNP_6_1000 (SPAdes) | Environmental | Open in IMG/M |
| 3300026259 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV63 (SPAdes) | Environmental | Open in IMG/M |
| 3300029319 | Marine viral communities collected during Tara Oceans survey from station TARA_032 - TARA_A100001516 | Environmental | Open in IMG/M |
| 3300032047 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 34915 | Environmental | Open in IMG/M |
| 3300032373 | Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 6-month pyrrhotite 2 | Environmental | Open in IMG/M |
| 3300033742 | Sea-ice brine viral communities from Beaufort Sea near Barrow, Alaska, United States - 2018 seawater | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOSum2011_101305153 | 3300000115 | Marine | MADGTLKVGTITNSAGSGNITIGSGVTLQSNVPAFF |
| DelMOSpr2010_101023984 | 3300000116 | Marine | MADGTLKVGTITNSAGSGNITIGSGVTLLSNVPAFLALLSTTTN |
| DelMOWin2010_100831935 | 3300000117 | Marine | MADGILKVGTITNSAGSGNIAIGSGVTLQSNVPAFEVHLSASQALTDDTLT |
| JGI24006J15134_101272153 | 3300001450 | Marine | MANGTLKVGQITTSSGSGNITIGSGVTVNVNRPAFFAYANAAQAVAD |
| JGI24006J15134_101452391 | 3300001450 | Marine | MADGTLKVGQITTSSGSGTITIPDAVTVSSASLSNTPAFEAFLSSAQ |
| JGI24006J15134_101723292 | 3300001450 | Marine | MADGTLKVGQITNSQGSGNITIGSGVTVNVNRPAFFAYANAAQAVAD |
| JGI24514J20073_10190452 | 3300001731 | Marine | MADGILKVGQITNSAGSGNITIGSGVTVNVNRPAFAAYLGANQVF |
| JGI25127J35165_10268061 | 3300002482 | Marine | MANGTLKVGTITTSSGSGNITIGSGVTLQSNAPAFFATMSANQTGLTD |
| JGI25127J35165_10626231 | 3300002482 | Marine | MANGTLKVGEITTSSGSGNITIGSGVTLQSNAPAFFATMSANQTGLTD |
| JGI25132J35274_10807282 | 3300002483 | Marine | MANGTLKVGEITTSTGSGNITIGSGVTLQSNAPAFFATMSAN |
| JGI25129J35166_10324433 | 3300002484 | Marine | MADGILKVGQITNSAGSGNITIGSGVTLQSNVPAFEAYLSSSQTLSDATT |
| JGI25128J35275_10790761 | 3300002488 | Marine | MADGTLKVGTITNSAGSGNINIGSGVTLLSNVPAFEAYLSAT |
| JGI25133J35611_100940713 | 3300002514 | Marine | MADGILKVGQITNSAGSGNITIGSGVTLQSNVPAFEAYLSSSQT |
| JGI25133J35611_101178711 | 3300002514 | Marine | MADGILKVGQITNSAGSGNITIGSGVIVNVNRPAFAAYLGANQVFSTTTET |
| JGI25134J35505_100265695 | 3300002518 | Marine | MADGILKVGQITNSAGSGNITIGSGVIVNVNRPAFAAYLGANQVFSTTTE |
| Ga0065861_11500722 | 3300004448 | Marine | MADGTLKVGTITNSQGSGNITIGSGVTVNVNRPAFFAYLSANQSIGNDAYTLAQLN |
| Ga0075108_102111521 | 3300005913 | Saline Lake | MADGILKVGTITNSAGSGNIAIGSGVTVNVNRPAFSVSISANQT |
| Ga0075478_100837654 | 3300006026 | Aqueous | MADGTLKVGTITNSAGSGNIAIGSGVTLLSNVPAFQVYL |
| Ga0098038_11433043 | 3300006735 | Marine | MADGILKVGTITNSAGSGNITIGSGVTLLSNVPAFEASLSSEQT |
| Ga0098038_11495662 | 3300006735 | Marine | MADGTLKVGTITNSAGSGNITIGSGVTLLSNVPAFHARLNSNQDIS |
| Ga0098038_11549632 | 3300006735 | Marine | MADGTLKVGTITNSAGSGNITIGSGVTLLSSTPAFHATVSA |
| Ga0098038_11892931 | 3300006735 | Marine | MADGTLKVGTITNSAGSGNITIGSGVTLLSNVPAFEAYLSATTTI |
| Ga0098038_12566392 | 3300006735 | Marine | MADGTLKVGTITTSTGSGSITIPSGVTLSGGGLANTPYFYGEA |
| Ga0098037_11545843 | 3300006737 | Marine | MADGILKVGTITNSAGSGNIAIGSGVTLLSNVPAFEA |
| Ga0098037_11591881 | 3300006737 | Marine | MADGILKVGTITNSAGSGNITIGSGVTLLSNVPAFEASLSSEQTVS |
| Ga0098037_11817351 | 3300006737 | Marine | MADGTLKVGTITNSAGSGNITIGSGVTLLSNVPAF |
| Ga0098037_12861232 | 3300006737 | Marine | MADGILKVGTITNSAGSGNITIGSGVTVNVNRPAFSA |
| Ga0098035_11207753 | 3300006738 | Marine | MADGTLKVGTITTSSGSGTITVPSTVTIAGAIAST |
| Ga0098042_10954431 | 3300006749 | Marine | MADGTLKVGTITNSAGSGNITIGSGVTINVNRPAFQAYLGSNQTVADATATK |
| Ga0098042_11449542 | 3300006749 | Marine | MANGTLKVSNIETSSGSGNITISQSGETVTLTGNTTISGT |
| Ga0098058_10525281 | 3300006750 | Marine | MADGILKVGQITNSAGSGNITIGSGVTVNVNRPAFHAYSTA |
| Ga0098048_11589921 | 3300006752 | Marine | MADGTLKVGTLTNSAGSGNITIGSGVTLQSNVPAFEAYLS |
| Ga0098039_12283662 | 3300006753 | Marine | MADGILKVGQITNSAGSGNITIGSGVTVNVNRPAFA |
| Ga0098044_13474601 | 3300006754 | Marine | MADGILKVGQITNSAGSGNITIGSGVTVNVNRPAF |
| Ga0098054_11748953 | 3300006789 | Marine | MADGTLKVGTITNSAGSGNITIGSGVTLVNNTPALK |
| Ga0098054_12650851 | 3300006789 | Marine | MADGILKVGTITTSTGSGSITIPSGVTLSGGVANTPAFEAY |
| Ga0098054_13401112 | 3300006789 | Marine | MADGTLKVGTITNSAGSGNITIGSGVTLQSNVPAFSARMN |
| Ga0098055_11547963 | 3300006793 | Marine | MADGILKVGQITNSAGSGNITIGSGVTVTVNRPSFFAY |
| Ga0098055_11672971 | 3300006793 | Marine | MADGTLKVGTITTSTGSGSITIPSGVTLKNNTPAFMAYQSAGSTT |
| Ga0098055_11797063 | 3300006793 | Marine | MADGTLKVGTITTSTGSGSITIPSGVTLSGGVANTPSFEAYASAYQS |
| Ga0098055_12441682 | 3300006793 | Marine | MADGILKVGTITTSTGSGSITIPSGVTLKNNTPAFMAYQSAGSTT |
| Ga0070749_103204683 | 3300006802 | Aqueous | MADGTLKVGTITNSAGSGNITIGSGVTLLSNVPAFEAVLSS |
| Ga0070749_106199841 | 3300006802 | Aqueous | MADGTLKVGTITNSAGSGNIAIGSGVTLLSNVPAFE |
| Ga0075467_103825781 | 3300006803 | Aqueous | MTAILKVDTIQDTSGNITIGSGVTLNSNTPAFEAYLSANQSINDIT |
| Ga0070754_102330511 | 3300006810 | Aqueous | MADGILKVGTITNSAGSGNIAIGSGVTLLSNVPAFQVY |
| Ga0070754_102721381 | 3300006810 | Aqueous | MADGTLKVGTITNSAGSGNITIGSCVTLLSNTPAFEVYLNANQTLTDNT |
| Ga0070750_100960072 | 3300006916 | Aqueous | MADGTLKVGTITNSAGSGNIAIGSGVTLLSNVPAFEVQLTSD |
| Ga0070750_102116193 | 3300006916 | Aqueous | MADGTLKVGTITNSAGSGNITIGSGVTLLSNVPAFEVQLTS |
| Ga0070750_102410101 | 3300006916 | Aqueous | MADGTVKVGTITNSAGSGNITIGSGVTLKSNVPAFDVFLSVDQTGLTDQAVNLVKFDS |
| Ga0070750_102695743 | 3300006916 | Aqueous | MADGTLKVGTITNSAGSGNIAIGSGVTVNVNRPAFR |
| Ga0070746_102433763 | 3300006919 | Aqueous | MADGILKVGTITNSAGSGNIAIGSGVTLLSNVPAFEVQLTSNQSIPNTTA |
| Ga0070746_104524521 | 3300006919 | Aqueous | MADGTLKVGTITNSAGSGNITIGSGVTLLSSTPAFHAYLSATQTISND |
| Ga0098060_11342142 | 3300006921 | Marine | MADGTLKVGTITTSAGSGNITIGSGVTLLSNVPAFEAYLSA |
| Ga0098051_11083851 | 3300006924 | Marine | MADGTLKVGTITTSSGSGTITIPTTVTVAGAMANTPAFF |
| Ga0098041_11344553 | 3300006928 | Marine | MADGTLKVGTITTSSGSGNITIGSGVTLLSNVPAFE |
| Ga0098036_11308381 | 3300006929 | Marine | MADGTLKVGTITNSAGSGNITIGSGVTLLSNTPAFEVYLNG |
| Ga0098036_11494761 | 3300006929 | Marine | MADGTLKVGTITNSAGSGNITIGSGVTLLSNTPAFEVY |
| Ga0101672_10977902 | 3300007152 | Volcanic Co2 Seeps | MADGTLKVGTITTSSGSGNITIGSGVTVNVNRPSFM |
| Ga0075468_101114593 | 3300007229 | Aqueous | MADGTLKVGTITTSSGSGNITIGSGVTLLSNVPAFEAY |
| Ga0070747_11020473 | 3300007276 | Aqueous | MADGTLKVGTITTSSGSGNITIGSGVTLLSNVPAFEAYL |
| Ga0070747_11905132 | 3300007276 | Aqueous | MADGTLKVGTITNSAGSGNITIGSGVTLLSSTPAFHAYL |
| Ga0070745_13507582 | 3300007344 | Aqueous | MADGTLKVGTITNSAGSGNIAIGSGVTLLSNVPAFQ |
| Ga0070753_12945892 | 3300007346 | Aqueous | MADGTLKVGTITTSSGSGSITIPSGVTLKNNTPAFMAY |
| Ga0099847_11705021 | 3300007540 | Aqueous | MADGTLKVGTITNSAGSGNITIGSGVTLLSNVPAFEVQLTSNQS |
| Ga0110931_11573161 | 3300007963 | Marine | MADGTLKVGTITNSAGSGNITIGSGVTLLSNTPAFEVYLN |
| Ga0075480_102875141 | 3300008012 | Aqueous | MADGILKVGTITTSSGSGTITIPDAVNVSSVSLSNTPAFQAYRTALQSISNST |
| Ga0075480_104254402 | 3300008012 | Aqueous | MADGTLKVGTITNSAGSGNIAIGSGVTLLSNVPAFEVQLTSNQ |
| Ga0098052_11559363 | 3300008050 | Marine | MADGILKVGEITNSAGSGNITIGSGVTVNVNRPSFLANYLT |
| Ga0117901_12208644 | 3300009103 | Marine | MADGILKVGTITNSAGSGNITIGSGVTLQTGTPAFQANASGIT |
| Ga0114918_102479871 | 3300009149 | Deep Subsurface | MADGTLKVGTITNSAGSGNITIGSGVTFLSNTPAF |
| Ga0115547_11993953 | 3300009426 | Pelagic Marine | MADGTLKVGTITNSAGSGNIAIGSGVTLLSNVPAFEA |
| Ga0114915_11124961 | 3300009428 | Deep Ocean | MADGTLKVGTITNSQGSGNITIGSGVTLLSNVPAFEAELS |
| Ga0115545_11885372 | 3300009433 | Pelagic Marine | MADGTLKVGTITNSAGSGNIAIGSGVTLLSNVPAFFAFLNSDQSSIA |
| Ga0115546_11209263 | 3300009435 | Pelagic Marine | MADGILKVGTITTSSGSGTITIGSGVTLLSNVPAFEATITTEQNPSGG |
| Ga0115546_11426053 | 3300009435 | Pelagic Marine | MADGILKVGTITNSAGSGNITLGSGVTLLSNVPAFEAYVNTAKI* |
| Ga0114919_111799422 | 3300009529 | Deep Subsurface | MADGTLKVGTITTSSGSGTITIPNTVTVAGAMANTPAFFAY |
| Ga0115013_114686681 | 3300009550 | Marine | MADGTLKVGTITNSAGSGNITIGSGVTLLSNTPAFEVYLNTTQTLTDDTSTK |
| Ga0114901_11188051 | 3300009604 | Deep Ocean | MADGILKVGQITNSAGSGNITIGSGVTVNVNRPAFMAY |
| Ga0114906_11115881 | 3300009605 | Deep Ocean | MADGTLKVGTITNSAGSGNISIGSGVTLLSSTPAFHAYLSATQT |
| Ga0115012_107520003 | 3300009790 | Marine | MADGILKVGQITTSSGSGTITVPSGVILQNNVPAFSARL |
| Ga0115012_119633641 | 3300009790 | Marine | MADGTLKVGTITNSAGSGNITIGSGVTLQSNVPAFEAYLSSNQSVS |
| Ga0098043_10614861 | 3300010148 | Marine | MADGTLKVGTITNSAGSGNITIGSGVTLQSNVPAFEAYLSSNQTVSSND |
| Ga0098043_10627161 | 3300010148 | Marine | MADGTLKVGTITNSAGSGNITIGSGVTLLSNVPAFEVW |
| Ga0098043_11119191 | 3300010148 | Marine | MADGTLKVGTITTSSGSGTITIGSGVTLLSNVPAFEVWLSANQGISDN |
| Ga0098043_11200043 | 3300010148 | Marine | MADGTLKVGTITNSAGSGNITIGSGVTLLSNVPAFEAYLSA |
| Ga0098043_11378881 | 3300010148 | Marine | MADGTLKVGTITNSAGSGNITIGSGVTLLSNTPAFEVYLNGNQT |
| Ga0098043_11568042 | 3300010148 | Marine | MADGTLKVGTITTSSGSGNITIGSGVTLLSNVPAFQA |
| Ga0098049_10475681 | 3300010149 | Marine | MADGILKVGTITNSAGSGNITIGSGVTVNVNRPAFEAYQSVAQTPSLS |
| Ga0098049_11289721 | 3300010149 | Marine | MADGILKVGEITNSAGSGNITIGSGVTVNVNRPAFEAYLASDQSSITS |
| Ga0098056_10698911 | 3300010150 | Marine | MADGTLKVGTITTSSGSGTITVPSTVTIAGAIASTPA |
| Ga0098056_11715261 | 3300010150 | Marine | MADGILKVGTITNSAGSGNITIGSGVTVNVNRPAFEA |
| Ga0098056_11943492 | 3300010150 | Marine | MADGTLKVGTITTSTGSGSITIPSGVTLSGGVANTPAFEA |
| Ga0098056_12032911 | 3300010150 | Marine | MADGILKVGQITASSGSGTITVPSGVILQNNVPAFSARLSTGQ |
| Ga0098056_12080212 | 3300010150 | Marine | MADGILKVGTITTSTGSGSITIPSGVTLKNNTPAFMAYQS |
| Ga0098056_12231752 | 3300010150 | Marine | MADGILKVGTITTSTGSGSITIPSGVTLSGGVANTPSFEAYASAY |
| Ga0098061_11763672 | 3300010151 | Marine | MADGILKVGQITNSAGSGNITIGSGVTVNVNRPAFAAAIVSNQSVSD |
| Ga0098059_12193321 | 3300010153 | Marine | MADGTLKVGTITNSAGSGNITIGSGVTVNVNRPSFKVYGS |
| Ga0098059_13758931 | 3300010153 | Marine | MADGILKVGQITNSAGSGNITIGSGVTVNVNRPAFHAYS |
| Ga0098047_101142333 | 3300010155 | Marine | MADGILKVGQITNSAGSGNITIGSGVTVNVNRPSFKVYGSA |
| Ga0098047_103219921 | 3300010155 | Marine | MADGTLKVGQITNSAGSGNITIGSGVTVNVNRPSFKVYGSADQTGL |
| Ga0098047_103440623 | 3300010155 | Marine | MADGILKVGQITNSAGSGNITIGSGVTLVNNTPALKV |
| Ga0129351_13186461 | 3300010300 | Freshwater To Marine Saline Gradient | MADGTLKVGTITNSAGSGNITIGSGVTVNVNRPAFEAYLSSTQTI |
| Ga0160423_106083191 | 3300012920 | Surface Seawater | MANGILKVGEITTSSGSGNITIGSGVTLLSNTPAF |
| Ga0180120_101971663 | 3300017697 | Freshwater To Marine Saline Gradient | MADGILKVGTITNSAGSGNIAIGSGVTVNVNRPSFSAEGTGLTVA |
| Ga0180120_102059592 | 3300017697 | Freshwater To Marine Saline Gradient | MADGTLKVGTITNSAGSGNIAIGSGVTLLSNVPAFEAYLSASQSISDNTIT |
| Ga0180120_102290372 | 3300017697 | Freshwater To Marine Saline Gradient | MADGILKVGTITTSSGSGTITIPDAVNVSSVSLSNTPAFQAYRTAL |
| Ga0180120_104173782 | 3300017697 | Freshwater To Marine Saline Gradient | MADGTLKVGTITNSAGSGNIAIGSGVTVNVNRPSFSAEGTGLTVA |
| Ga0181367_10450891 | 3300017703 | Marine | MADGTLKVGTITNSAGSGNITIGSGVTVNVNRPSFFAYLN |
| Ga0181377_10456823 | 3300017706 | Marine | MADGTLKVGTITTSSGSGNITIGSGVTINVNRPVWYVKLSSDQD |
| Ga0181369_10918712 | 3300017708 | Marine | MADGTLKVGTITNSAGSGNITIGSGVTLLSNVPAFDARVGG |
| Ga0181387_11179841 | 3300017709 | Seawater | MANGTLKVGTITNSAGSGNITIGSGVTVNVNRPSFF |
| Ga0181412_10263101 | 3300017714 | Seawater | MADGTLKVGTITNSAGSGNITIGSGVTVNVNRPAFHAYLGSN |
| Ga0181416_10277351 | 3300017731 | Seawater | MADGTLKVGTITNSAGSGNITIGSGVTLNSNAPIFY |
| Ga0181433_10693522 | 3300017739 | Seawater | MADGTLKVGTITNSAGSGNITIGSGVTVNVNRPAFF |
| Ga0181433_10772361 | 3300017739 | Seawater | MADGTLKVGTITTSSGSGTITIPDAVTVSSVSLSNTPAFQAYRTALQSLSN |
| Ga0181418_10841012 | 3300017740 | Seawater | MADGTLKVGTITNSAGSGNITIGSGVTVNVNRPAFFAYLSANQSIGNDA |
| Ga0181421_10115871 | 3300017741 | Seawater | MADGTLKVGTITTSSGSGTITIPDAVTVSSVSLSNTPAFQAYRTA |
| Ga0181421_10818491 | 3300017741 | Seawater | MADGILKVGTITTSSGSGTITIPDAVTVSSVSLSNTPAFQAYRTA |
| Ga0181397_11351331 | 3300017744 | Seawater | MTAILKVGTITNSAGSGNITIGSGVTVNVNRPAFHAYLGSNQTA |
| Ga0181397_11521362 | 3300017744 | Seawater | MADGTLKVGTITNSAGSGNITIGSGVTLNSNAPIFYGYLSS |
| Ga0181389_11245051 | 3300017746 | Seawater | MADGTLKVGTITNSAGSGNITIGSGVTVNVNRPVFDVNLS |
| Ga0181389_11526371 | 3300017746 | Seawater | MADGTLKVGTITNSAVSGNITIGSGVTLQNAVPAFE |
| Ga0181392_10564934 | 3300017749 | Seawater | MADGTLKVGTITTSSGSGTITIPDAVTVSSVSLSNTP |
| Ga0181392_10964363 | 3300017749 | Seawater | MADGILKVGTITNSAGSGNITIGSGVTLLSNAPAFEVELTSDQTI |
| Ga0181392_11398002 | 3300017749 | Seawater | MADGTLKVGTITNSAGSGNITIGSGVTLLSNAPAFEVELTSDQTI |
| Ga0181411_11385552 | 3300017755 | Seawater | MADGTLKVGTITNSAGSGNITIGSGVTLLSNTPAFHATVSATQAIAQ |
| Ga0181411_11523762 | 3300017755 | Seawater | MADGTLKVGTITNSAGSGNITIGSGVTLQSNTPSFHATSS |
| Ga0181382_11284071 | 3300017756 | Seawater | MADGTLKVGTITNSAGSGNITIGSGVTLLSSVPAH |
| Ga0181409_11757432 | 3300017758 | Seawater | MADGTLKVGTITNSAGSGNITIGSGVTVNVNRPSFFVHAASAQAV |
| Ga0181414_11138691 | 3300017759 | Seawater | MADGTLKVGTITNSAGSGNITIGSGVTVNVNRPAFQAYLGSN |
| Ga0181422_12236012 | 3300017762 | Seawater | MADGTLKVGTITNSAGSGNITIGSGVTLQSNTPSFHA |
| Ga0181410_10505731 | 3300017763 | Seawater | MADGTLKVGTITNSAGSGNITIGSGVTVNVNRPSFFVHAA |
| Ga0181385_12415662 | 3300017764 | Seawater | MADGTLKVGTITNSAGSGNITIGSGVTVNVNRPAFHAYLGSNQTA |
| Ga0187221_11238542 | 3300017769 | Seawater | MADGTLKVGTITNSAGSGNITIGSGVTVNVNRPVFDVNLSADQTA |
| Ga0181423_12767651 | 3300017781 | Seawater | MADGTLKVGTITNSAGSGNITIGSGVTVNVNSPAFEAY |
| Ga0181379_12774631 | 3300017783 | Seawater | MADGILKVGTITNSAGSGNITIGSGVTVNVIRPAFHA |
| Ga0181590_102957821 | 3300017967 | Salt Marsh | MADGTLKVGTITNSAGSGNIAIGSGVTLLSNVPAF |
| Ga0181590_105565782 | 3300017967 | Salt Marsh | MADGTLKVGTITNSAGSGNIAIGSGVTLLSNVPAFQAYVSSDQSVT |
| Ga0181606_101734401 | 3300018048 | Salt Marsh | MADGTLKVGTITNSAGSGNITIGSGVTVNVNRPAFEAYLS |
| Ga0181553_103270751 | 3300018416 | Salt Marsh | MADGTLKVGTITTSSGSGNITIGSGVTLLSNTPAFQAHLS |
| Ga0181563_104570872 | 3300018420 | Salt Marsh | MADGTLKVGTITTSSGSGNITIGSGVTLLSNTPAFEAKLSS |
| Ga0181563_105774831 | 3300018420 | Salt Marsh | MADGTLKVGTITNSAGSGNITIGSGVTLQSNVPAFQAVASS |
| Ga0181591_103541801 | 3300018424 | Salt Marsh | MADGTLKVGTITNSAGSGNIAIGSGVTLLSNVPAFQAY |
| Ga0181604_102397813 | 3300020191 | Salt Marsh | MADGTLKVGTITTSSGSGNIAIGSGVTLLSNVPAFRAYTDTIQTTSDGVA |
| Ga0211477_102134981 | 3300020374 | Marine | MANGTLKVGTITTSSGSGNITIGSGVTVNVNRPSFSAEGTGLTVAN |
| Ga0211476_102262162 | 3300020381 | Marine | MANGTLKVGTITTSSGSGNITIGSGVVVNVNRPSFSAEGTGLTV |
| Ga0211539_102468971 | 3300020437 | Marine | MANGTLKVGEITTSSGSGNITIGSGVTLNVNRPSFYSYL |
| Ga0211574_102418812 | 3300020446 | Marine | MANGILKVGEITTSSGSGNITIGSGVTLQSNVPAFEAFLSADQTGLTDATD |
| Ga0213867_10737151 | 3300021335 | Seawater | MANGTLKVGTITNSAGSGNIAIGSGVTLLSNVPAFQ |
| Ga0213865_103170472 | 3300021373 | Seawater | MADGTLKVGTITNSAGSGNIAIGSGVTLQSNVPAFFAYSNSDQTVT |
| Ga0222718_102764011 | 3300021958 | Estuarine Water | MADGTLKVGTITTSSGSGTITIPNTVTVAGAMANTPAFRAYK |
| Ga0222719_105387061 | 3300021964 | Estuarine Water | MADGTLKVGTITNSAGSGNIAIGSGVTLLSNVPAFEAFLSAT |
| Ga0212030_10492222 | 3300022053 | Aqueous | MADGTLKVGTITTSSGSGTITIPDAVNVSSVSLSNTP |
| Ga0224906_10669483 | 3300022074 | Seawater | MADGILKVGTITNSAGSGNITIGSGVTLLSNVPAFEASLSSEQ |
| Ga0224906_11315831 | 3300022074 | Seawater | MADGTLKVGTITNSAGSGNITIGSGVTVNVNRPVF |
| Ga0196887_10923832 | 3300022178 | Aqueous | MADGTLKVGTITNSAGSGNITIGSGVTLLSSTPAFHAYLSATQTISN |
| Ga0196899_10461003 | 3300022187 | Aqueous | MADGTLKVGTITTSSGSGTITIPNTVTVAGAMANTPAFL |
| Ga0196899_10967451 | 3300022187 | Aqueous | MADGTLKVGTITNSAGSGNIAIGSGVTLLSNVPAFQVYLSA |
| Ga0196899_11139013 | 3300022187 | Aqueous | MADGTLKVGTITNSAGSGNITIGSGVTLLSNVPAFQV |
| Ga0255752_102465051 | 3300022929 | Salt Marsh | MADGTLKVGTITTSSGSGNITIGSGVTLLSNTPAFQ |
| Ga0255751_101263691 | 3300023116 | Salt Marsh | MADGTLKVGTITNSAGSGNIAIGSGVTLLSNVPAFQAYVSSD |
| Ga0255772_101822423 | 3300023176 | Salt Marsh | MADGTLKVGTITNSAGSGNIAIGSGVTLLSNVPAFLAYVSSDQSVTDN |
| Ga0255772_101925823 | 3300023176 | Salt Marsh | MADGTLKVGTITNSAGSGNIAIGSGVTLLSNVPAFQAYVSSDQSV |
| Ga0208920_10297092 | 3300025072 | Marine | MADGILKVGQITNSAGSGNITIGSGVTVNVNRPAFHA |
| Ga0208920_10346644 | 3300025072 | Marine | MADGILKVGQITNSAGSGNITIGSGVTVNVNRPAFHAYLGSNQ |
| Ga0208791_10505211 | 3300025083 | Marine | MADGTLKVGTITNSAGSGNITIGSGVTLLSNVPAFEA |
| Ga0208792_10586321 | 3300025085 | Marine | MADGTLKVGTITTSTGSGSITIPSGVTLSGGVANSPSFLVSNTA |
| Ga0208157_10933692 | 3300025086 | Marine | MADGTLKVGTITNSAGSGNITIGSGVTLLSNVPAFEAS |
| Ga0208157_11332121 | 3300025086 | Marine | MADGTLKVGTITTSAGSGNITIGSGVTLLSNVPAF |
| Ga0208011_10424611 | 3300025096 | Marine | MADGTLKVGTITNSAGSGNITIGSGVTLLSNTPSFMAT |
| Ga0208011_10903181 | 3300025096 | Marine | MADGILKVGQITNSAGSGNITIGSGVTLLSNTPSFMATSASTSL |
| Ga0208010_10358111 | 3300025097 | Marine | MADGILKVGQITNSAGSGNITIGSGVTVNVNRPAFHAYLGSNQTVTD |
| Ga0208434_10393251 | 3300025098 | Marine | MADGTLKVGTITNSAGSGNITIGSGVTLLSNVPAFHVYLS |
| Ga0208434_10763572 | 3300025098 | Marine | MADGTLKVGTITTSSGSGNITIGSGVTLLSNTPAFEVYLN |
| Ga0208159_10375112 | 3300025101 | Marine | MADGTLKVGTITTSSGSGNITIGSGVTLQSNVPAFEAYLSSNQTVSSN |
| Ga0208159_10624012 | 3300025101 | Marine | MADGTLKVGTITNSAGSGNITIGSGVTLQSNVPAFEAYLSSNQTVSSN |
| Ga0208666_10334644 | 3300025102 | Marine | MADGTLKVGTITNSAGSGNITIGSGVTLLSSTPAFHATVSAT |
| Ga0208666_11296831 | 3300025102 | Marine | MADGTLKVGTITTSSGSGNITIGSGVTLLSNVPAF |
| Ga0208013_10425384 | 3300025103 | Marine | MADGTLKVGTITTSTGSGSITIPSGVTLKNNTPAFMAYQSAGSTTI |
| Ga0208793_10833871 | 3300025108 | Marine | MADGTLKVGTITNSAGSGNITIGSGVTLLSNVPAFQA |
| Ga0208793_11048841 | 3300025108 | Marine | MADGTLKVGTITTSTGSGSITIPSGVTLKNNTPAFMAYQSAGS |
| Ga0208793_11413911 | 3300025108 | Marine | MADGTLKVGTITNSAGSGNITIGSGVTLLSNTPAF |
| Ga0208553_10408155 | 3300025109 | Marine | MADGILKVGQITNSAGSGNITIGSGVTVNVNRPAFHAY |
| Ga0208553_10554853 | 3300025109 | Marine | MADGTLKVGTITTSSGSGTITVPSTVTIAGAIASTPAFSARLN |
| Ga0208553_11091562 | 3300025109 | Marine | MADGILKVGQITNSAGSGNITIGSGVTLLSNVPAF |
| Ga0208553_11102512 | 3300025109 | Marine | MADGILKVGQITNSAGSGNITIGSGVTVNVNRPAFAA |
| Ga0208158_10536531 | 3300025110 | Marine | MADGTLKVGTITNSAGSGNITIGSGVTLQSNVPAFEAY |
| Ga0208158_10907462 | 3300025110 | Marine | MADGTLKVGTITTSAGSGNITIGSGVTLLSNVPAFEAY |
| Ga0208158_11456092 | 3300025110 | Marine | MADGTLKVGTITNSAGSGNITIGSGVTLLSNVPAFE |
| Ga0208433_10687661 | 3300025114 | Marine | MADGTLKVGTITTSSGSGTITVPSTVTIAGAIASTPAFS |
| Ga0208433_11314761 | 3300025114 | Marine | MADGILKVGQITNSAGSGNITIGSGVTLLSNTPSFMATSAS |
| Ga0208790_10091561 | 3300025118 | Marine | MADGILKVGQITNSAGSGNITIGSGVTVNVNRPAFHAYSTAA |
| Ga0208790_10699871 | 3300025118 | Marine | MADGTLKVGTITTSSGSGTITVPSTVTIAGAIASTPAFSAR |
| Ga0208790_11627781 | 3300025118 | Marine | MADGILKVGQITNSAGSGNITIGSGVTVNVNRPAFE |
| Ga0208790_11786902 | 3300025118 | Marine | MADGTLKVGQITNSAGSGNITIGSGVTVNVNRPSFKVYGSA |
| Ga0209535_10989783 | 3300025120 | Marine | MADGTLKVGTITNSQGSGNITIGSGVTLLSNVPAFEA |
| Ga0209535_11124793 | 3300025120 | Marine | MADGTLKVGTITNSAGSGNITIGSGVTVNVNRPAFHAYLG |
| Ga0209535_11619391 | 3300025120 | Marine | MADGTLKVGTITTSSGSGTITIGSGVTLNSNAPIFY |
| Ga0209535_11677582 | 3300025120 | Marine | MADGTLKVGTITNSAGSGNITIGSGVTLQSNVPAFSAKLSANQTLS |
| Ga0209535_11692881 | 3300025120 | Marine | MADGTLKVGTITNSAGSGNITIGSGVTVNVNRPAFHAYLGSNQTAA |
| Ga0209535_11712192 | 3300025120 | Marine | MADGTLKVGTITTSSGSGTITIPDAVTVSSASLSN |
| Ga0209348_10439511 | 3300025127 | Marine | MADGTLKVGTITNSAGSGNITIGSGVTLLSSVPAF |
| Ga0209348_10742801 | 3300025127 | Marine | MADGTLKVGTITNSAGSGNITIGSGVTLLSNVPAFEAILSS |
| Ga0209348_10863031 | 3300025127 | Marine | MANGTLKVGEITTSTGSGNITIGSGVTLQSNAPAFFATMSANQTGLTDNTFVLIQF |
| Ga0209348_11033791 | 3300025127 | Marine | MADGTLKVGTITNSAGSGNITIGSGVTLLSSVPAFEASL |
| Ga0208919_10877223 | 3300025128 | Marine | MADGTLKVGTITNSAGSGNITIGSGVTLLSNTPAFE |
| Ga0209128_10520571 | 3300025131 | Marine | MADGILKVGQITNSAGSGNITIGSGVIVNVNRPAFAAYLGANQVFST |
| Ga0209128_10711474 | 3300025131 | Marine | MADGILKVGQITNSAGSGNITIGSGVTLQSNVPAFEAYLSSSQTLSDATTTKV |
| Ga0209128_11433491 | 3300025131 | Marine | MADGILKVGQITNSAGSGNITIGSGVTLLSNVPAFEAYV |
| Ga0209128_11481872 | 3300025131 | Marine | MADGILKVGQITNSAGSGNITIGSGVTVNVNRPAFFVV |
| Ga0209232_11005171 | 3300025132 | Marine | MADGTLKVGTITNSAGSGNITIGSGVTLLSNVPSFFAY |
| Ga0209232_11438502 | 3300025132 | Marine | MADGTLKVGEITNSAGSGNITIGSGVTVNVNRPSFKVYGSTDQTGLVLNTYN |
| Ga0209634_12319292 | 3300025138 | Marine | MADGTLKVGQITNSQGSGNITIGSGVTVNVNRPAFFAYANAAQ |
| Ga0209756_11775333 | 3300025141 | Marine | MADGILKVGTITNSAGSGNITIGSGVTVNVNRPAF |
| Ga0209645_10884141 | 3300025151 | Marine | MADGTLKVGTITTSSGSGNITIGSGVTLKNNVPAFEAYLSSS |
| Ga0209645_11097622 | 3300025151 | Marine | MANGILKVGEITTSSGSGNITIGSGVTLKNNVPAFEAYLSSS |
| Ga0208770_10650251 | 3300025438 | Saline Lake | MADGTLKVGTITTSSGSGTITIPDAVTVSSASLSNTP |
| Ga0208303_10575491 | 3300025543 | Aqueous | MADGTLKVGTITNSAGSGNIAIGSGVTVNVNRPSFSAEGTG |
| Ga0208303_10617153 | 3300025543 | Aqueous | MADGILKVGTITTSSGSGTITIPDAVNVSSVSLSNTPAFQAYRTALQSISNSTF |
| Ga0208303_10617921 | 3300025543 | Aqueous | MADGTLKVGTITNSAGSGNITIGSGVTLLSNVPAFEAYL |
| Ga0208643_10931763 | 3300025645 | Aqueous | MADGTLKVGTITTSSGSGTITIPDAVNVSSVSLSNTPAFQAY |
| Ga0208134_10415251 | 3300025652 | Aqueous | MADGTLKVGTITTSSGSGNITIGSGVTLLSNVPAFEAYLS |
| Ga0209558_11845803 | 3300025729 | Marine | MADGTLKVGTITNSAGSGNITIGSGVTVNVNTPTFAATLSAD |
| Ga0208899_11275371 | 3300025759 | Aqueous | MADGTLKVGTITNSAGSGNIAIGSGVTLLSNVPAFEVQLTS |
| Ga0208899_11311531 | 3300025759 | Aqueous | MADGTLKVGTITTSSGSGSITIPSGVTLKNNTPAFMAYQSS |
| Ga0208899_11524472 | 3300025759 | Aqueous | MADGTLKVGTITTSSGSGTITIPNTVTVAGAMANTPA |
| Ga0208767_11481531 | 3300025769 | Aqueous | MADGTLKVGTITNSAGSGNITIGSGVTLLSNVPAFEAV |
| Ga0208767_12052081 | 3300025769 | Aqueous | MADGTLKVGTITTSSGSGSITIPSGVTLKNNTPAFM |
| Ga0208425_11193212 | 3300025803 | Aqueous | MADGTLKVGTITNSAGSGNIAIGSGVTVNVNRPAFEAYLSAN |
| Ga0208545_11214151 | 3300025806 | Aqueous | MADGTLKVGTITNSAGSGNITIGSGVTLLSNVPAFEAYLSSD |
| Ga0208543_10967662 | 3300025810 | Aqueous | MADGTLKVGTITTSSGSGSITIPSGVTLKNNTPAFMAYQS |
| Ga0209193_10521221 | 3300025816 | Pelagic Marine | MADGTLKVGTITNSAGSGNIAIGSGVTLLSNVPAFEATMS |
| Ga0209193_10743121 | 3300025816 | Pelagic Marine | MADGTLKVGTITNSAGSGNIAIGSGVTLLSNVPAFEAYLSSNQ |
| Ga0208645_10717763 | 3300025853 | Aqueous | MADGTLKVGTITTSSGSGTITIPNTVTVAGAMANTPAFLFN |
| Ga0209757_101907491 | 3300025873 | Marine | MANGILKVGQITNSAGSGNITIGSGVTLQTGTPTF |
| Ga0208896_10851883 | 3300026259 | Marine | MADGILKVGQITNSAGSGNITIGSGVIVNVNRPAFAAYLGA |
| Ga0183748_10556861 | 3300029319 | Marine | MANGTLKVGTLTTSSGSGNITIGSGVTLNSNTPAFFVHAASAQA |
| Ga0183748_10962841 | 3300029319 | Marine | MANGTLKVGTITTSSGSGNISIGSGVTVNVNRPAFEAVMSS |
| Ga0183748_11041542 | 3300029319 | Marine | MANGTLKVGEITTSTGSGNITIGSGVTINVNRPAFSAYLS |
| Ga0315330_107942521 | 3300032047 | Seawater | MANGILKVGTITTSSGSGNIAIGSGVTLLSNTPAFQATYSGDYIGSFPDNT |
| Ga0316204_108315511 | 3300032373 | Microbial Mat | MADGTLKVGTITTSSGSGTITIPNTVTVAGAMANTPAFHAEL |
| Ga0314858_088849_648_779 | 3300033742 | Sea-Ice Brine | MADGTLKVGQITNSQGSGNITIGSGVTVNVNRPAFFAYANAAQA |
| ⦗Top⦘ |