| Basic Information | |
|---|---|
| Family ID | F017227 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 242 |
| Average Sequence Length | 42 residues |
| Representative Sequence | DLRRRVDTAVYSTGNREVTLREEGFPQALRLVDAILAARQAA |
| Number of Associated Samples | 208 |
| Number of Associated Scaffolds | 242 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.41 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 95.04 % |
| Associated GOLD sequencing projects | 194 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.37 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (60.331 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (16.942 % of family members) |
| Environment Ontology (ENVO) | Unclassified (32.645 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (48.347 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 48.57% β-sheet: 0.00% Coil/Unstructured: 51.43% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.37 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 242 Family Scaffolds |
|---|---|---|
| PF13624 | SurA_N_3 | 84.71 |
| PF03819 | MazG | 4.55 |
| PF03952 | Enolase_N | 2.89 |
| PF13623 | SurA_N_2 | 1.65 |
| PF12697 | Abhydrolase_6 | 0.41 |
| PF12844 | HTH_19 | 0.41 |
| PF03461 | TRCF | 0.41 |
| PF05977 | MFS_3 | 0.41 |
| PF09312 | SurA_N | 0.41 |
| COG ID | Name | Functional Category | % Frequency in 242 Family Scaffolds |
|---|---|---|---|
| COG0148 | Enolase | Carbohydrate transport and metabolism [G] | 2.89 |
| COG1197 | Transcription-repair coupling factor (superfamily II helicase) | Transcription [K] | 0.83 |
| COG0760 | Peptidyl-prolyl isomerase, parvulin family | Posttranslational modification, protein turnover, chaperones [O] | 0.41 |
| COG2814 | Predicted arabinose efflux permease AraJ, MFS family | Carbohydrate transport and metabolism [G] | 0.41 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 60.33 % |
| Unclassified | root | N/A | 39.67 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2124908045|KansclcFeb2_ConsensusfromContig809494 | Not Available | 807 | Open in IMG/M |
| 2170459005|F1BAP7Q01DBWE6 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M14 | 504 | Open in IMG/M |
| 2170459008|GA8OVOZ01DNSF8 | Not Available | 506 | Open in IMG/M |
| 2228664022|INPgaii200_c0563061 | Not Available | 625 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_101906221 | Not Available | 1200 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_104714284 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 610 | Open in IMG/M |
| 3300000956|JGI10216J12902_102702650 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M14 | 537 | Open in IMG/M |
| 3300000956|JGI10216J12902_117209810 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1202 | Open in IMG/M |
| 3300001380|JGI1356J14229_10176190 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 636 | Open in IMG/M |
| 3300002347|JGIcombinedJ26865_1021069 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1056 | Open in IMG/M |
| 3300002568|C688J35102_119927441 | Not Available | 816 | Open in IMG/M |
| 3300004081|Ga0063454_100145238 | Not Available | 1243 | Open in IMG/M |
| 3300004114|Ga0062593_101798630 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 673 | Open in IMG/M |
| 3300005093|Ga0062594_101990380 | Not Available | 620 | Open in IMG/M |
| 3300005146|Ga0066817_1017205 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M14 | 636 | Open in IMG/M |
| 3300005167|Ga0066672_10814959 | Not Available | 586 | Open in IMG/M |
| 3300005181|Ga0066678_10648963 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium | 703 | Open in IMG/M |
| 3300005187|Ga0066675_11416295 | Not Available | 509 | Open in IMG/M |
| 3300005332|Ga0066388_103711056 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 779 | Open in IMG/M |
| 3300005339|Ga0070660_101745192 | Not Available | 530 | Open in IMG/M |
| 3300005434|Ga0070709_11609224 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 529 | Open in IMG/M |
| 3300005434|Ga0070709_11764132 | Not Available | 506 | Open in IMG/M |
| 3300005435|Ga0070714_101899663 | Not Available | 581 | Open in IMG/M |
| 3300005436|Ga0070713_102401334 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 510 | Open in IMG/M |
| 3300005518|Ga0070699_101932186 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 540 | Open in IMG/M |
| 3300005526|Ga0073909_10405543 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M14 | 643 | Open in IMG/M |
| 3300005529|Ga0070741_10621443 | Not Available | 962 | Open in IMG/M |
| 3300005529|Ga0070741_11191414 | Not Available | 643 | Open in IMG/M |
| 3300005535|Ga0070684_100187219 | All Organisms → cellular organisms → Bacteria | 1883 | Open in IMG/M |
| 3300005544|Ga0070686_100883547 | Not Available | 726 | Open in IMG/M |
| 3300005556|Ga0066707_10663695 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium | 658 | Open in IMG/M |
| 3300005558|Ga0066698_10762179 | Not Available | 631 | Open in IMG/M |
| 3300005558|Ga0066698_10951107 | Not Available | 547 | Open in IMG/M |
| 3300005558|Ga0066698_11101311 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium | 502 | Open in IMG/M |
| 3300005561|Ga0066699_10686460 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 731 | Open in IMG/M |
| 3300005569|Ga0066705_10563684 | Not Available | 704 | Open in IMG/M |
| 3300005578|Ga0068854_100943145 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium | 761 | Open in IMG/M |
| 3300005578|Ga0068854_101009331 | Not Available | 737 | Open in IMG/M |
| 3300005587|Ga0066654_10299644 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 861 | Open in IMG/M |
| 3300005598|Ga0066706_11410595 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M14 | 525 | Open in IMG/M |
| 3300005614|Ga0068856_101880412 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 610 | Open in IMG/M |
| 3300005614|Ga0068856_101998751 | Not Available | 590 | Open in IMG/M |
| 3300005764|Ga0066903_101328656 | All Organisms → cellular organisms → Bacteria | 1345 | Open in IMG/M |
| 3300005901|Ga0075274_1008366 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1257 | Open in IMG/M |
| 3300006163|Ga0070715_11051582 | Not Available | 510 | Open in IMG/M |
| 3300006175|Ga0070712_100833272 | Not Available | 793 | Open in IMG/M |
| 3300006237|Ga0097621_100286499 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1451 | Open in IMG/M |
| 3300006237|Ga0097621_100575904 | Not Available | 1027 | Open in IMG/M |
| 3300006573|Ga0074055_11029020 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium | 524 | Open in IMG/M |
| 3300006755|Ga0079222_10717497 | Not Available | 795 | Open in IMG/M |
| 3300006800|Ga0066660_11640707 | Not Available | 511 | Open in IMG/M |
| 3300006800|Ga0066660_11693547 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M14 | 504 | Open in IMG/M |
| 3300006852|Ga0075433_10511103 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1057 | Open in IMG/M |
| 3300006903|Ga0075426_10357586 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1074 | Open in IMG/M |
| 3300006954|Ga0079219_11455276 | Not Available | 616 | Open in IMG/M |
| 3300007265|Ga0099794_10397093 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M14 | 720 | Open in IMG/M |
| 3300009088|Ga0099830_11606976 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M14 | 542 | Open in IMG/M |
| 3300009090|Ga0099827_11961929 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 509 | Open in IMG/M |
| 3300009093|Ga0105240_10143191 | All Organisms → cellular organisms → Bacteria | 2856 | Open in IMG/M |
| 3300009137|Ga0066709_100167383 | All Organisms → cellular organisms → Bacteria | 2839 | Open in IMG/M |
| 3300009147|Ga0114129_10365632 | All Organisms → cellular organisms → Bacteria | 1908 | Open in IMG/M |
| 3300009147|Ga0114129_11908537 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 720 | Open in IMG/M |
| 3300009174|Ga0105241_11367421 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium | 677 | Open in IMG/M |
| 3300009176|Ga0105242_11909807 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M14 | 634 | Open in IMG/M |
| 3300009789|Ga0126307_10236092 | All Organisms → cellular organisms → Bacteria | 1469 | Open in IMG/M |
| 3300009801|Ga0105056_1017420 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M14 | 861 | Open in IMG/M |
| 3300010036|Ga0126305_11305599 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M14 | 501 | Open in IMG/M |
| 3300010038|Ga0126315_10093545 | All Organisms → cellular organisms → Bacteria | 1713 | Open in IMG/M |
| 3300010046|Ga0126384_11196239 | Not Available | 701 | Open in IMG/M |
| 3300010088|Ga0127476_1076503 | Not Available | 567 | Open in IMG/M |
| 3300010166|Ga0126306_10680822 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 824 | Open in IMG/M |
| 3300010166|Ga0126306_11260109 | Not Available | 609 | Open in IMG/M |
| 3300010326|Ga0134065_10485057 | Not Available | 512 | Open in IMG/M |
| 3300010366|Ga0126379_10896129 | Not Available | 989 | Open in IMG/M |
| 3300010371|Ga0134125_11627070 | Not Available | 703 | Open in IMG/M |
| 3300010376|Ga0126381_101990343 | Not Available | 837 | Open in IMG/M |
| 3300010398|Ga0126383_13537650 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 510 | Open in IMG/M |
| 3300010401|Ga0134121_12882917 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium | 527 | Open in IMG/M |
| 3300010896|Ga0138111_1069036 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M14 | 527 | Open in IMG/M |
| 3300011270|Ga0137391_10264130 | Not Available | 1490 | Open in IMG/M |
| 3300011399|Ga0137466_1013827 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1007 | Open in IMG/M |
| 3300011991|Ga0120153_1085107 | Not Available | 521 | Open in IMG/M |
| 3300011994|Ga0120157_1040263 | Not Available | 1039 | Open in IMG/M |
| 3300012014|Ga0120159_1050798 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1312 | Open in IMG/M |
| 3300012096|Ga0137389_10374575 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1214 | Open in IMG/M |
| 3300012198|Ga0137364_10140776 | All Organisms → cellular organisms → Bacteria | 1736 | Open in IMG/M |
| 3300012198|Ga0137364_10227488 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M14 | 1373 | Open in IMG/M |
| 3300012198|Ga0137364_10580921 | Not Available | 844 | Open in IMG/M |
| 3300012200|Ga0137382_10998624 | Not Available | 601 | Open in IMG/M |
| 3300012206|Ga0137380_11217983 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 638 | Open in IMG/M |
| 3300012206|Ga0137380_11580911 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 540 | Open in IMG/M |
| 3300012207|Ga0137381_11362425 | Not Available | 602 | Open in IMG/M |
| 3300012208|Ga0137376_10934289 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 744 | Open in IMG/M |
| 3300012208|Ga0137376_11392889 | Not Available | 592 | Open in IMG/M |
| 3300012210|Ga0137378_11273859 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M14 | 652 | Open in IMG/M |
| 3300012211|Ga0137377_10364385 | Not Available | 1382 | Open in IMG/M |
| 3300012211|Ga0137377_11694074 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M14 | 554 | Open in IMG/M |
| 3300012212|Ga0150985_111013901 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 893 | Open in IMG/M |
| 3300012224|Ga0134028_1084681 | Not Available | 619 | Open in IMG/M |
| 3300012224|Ga0134028_1237727 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 790 | Open in IMG/M |
| 3300012349|Ga0137387_10343360 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M14 | 1081 | Open in IMG/M |
| 3300012349|Ga0137387_11036803 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M14 | 587 | Open in IMG/M |
| 3300012349|Ga0137387_11310810 | Not Available | 506 | Open in IMG/M |
| 3300012350|Ga0137372_11120551 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M14 | 538 | Open in IMG/M |
| 3300012351|Ga0137386_10741116 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 706 | Open in IMG/M |
| 3300012351|Ga0137386_11151161 | Not Available | 545 | Open in IMG/M |
| 3300012355|Ga0137369_10105617 | All Organisms → cellular organisms → Bacteria | 2302 | Open in IMG/M |
| 3300012355|Ga0137369_10704019 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M14 | 694 | Open in IMG/M |
| 3300012356|Ga0137371_10243017 | All Organisms → cellular organisms → Bacteria | 1406 | Open in IMG/M |
| 3300012357|Ga0137384_10801778 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 762 | Open in IMG/M |
| 3300012358|Ga0137368_10112666 | All Organisms → cellular organisms → Bacteria | 2081 | Open in IMG/M |
| 3300012359|Ga0137385_10968608 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M14 | 702 | Open in IMG/M |
| 3300012359|Ga0137385_11129306 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M14 | 644 | Open in IMG/M |
| 3300012360|Ga0137375_10506729 | Not Available | 1026 | Open in IMG/M |
| 3300012360|Ga0137375_10785135 | Not Available | 768 | Open in IMG/M |
| 3300012363|Ga0137390_10779675 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 914 | Open in IMG/M |
| 3300012373|Ga0134042_1081312 | Not Available | 627 | Open in IMG/M |
| 3300012383|Ga0134033_1119498 | Not Available | 508 | Open in IMG/M |
| 3300012385|Ga0134023_1265144 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 676 | Open in IMG/M |
| 3300012393|Ga0134052_1210097 | Not Available | 770 | Open in IMG/M |
| 3300012399|Ga0134061_1099689 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M14 | 791 | Open in IMG/M |
| 3300012401|Ga0134055_1382487 | Not Available | 825 | Open in IMG/M |
| 3300012403|Ga0134049_1252014 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1065 | Open in IMG/M |
| 3300012407|Ga0134050_1434407 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M14 | 783 | Open in IMG/M |
| 3300012410|Ga0134060_1181759 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M14 | 583 | Open in IMG/M |
| 3300012469|Ga0150984_105468077 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium | 510 | Open in IMG/M |
| 3300012684|Ga0136614_10810341 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 653 | Open in IMG/M |
| 3300012918|Ga0137396_10258078 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1286 | Open in IMG/M |
| 3300012927|Ga0137416_11221585 | Not Available | 677 | Open in IMG/M |
| 3300012944|Ga0137410_10721921 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 832 | Open in IMG/M |
| 3300012951|Ga0164300_10427377 | Not Available | 736 | Open in IMG/M |
| 3300012960|Ga0164301_10979023 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M14 | 663 | Open in IMG/M |
| 3300012960|Ga0164301_11358489 | Not Available | 579 | Open in IMG/M |
| 3300012961|Ga0164302_10188079 | Not Available | 1257 | Open in IMG/M |
| 3300012972|Ga0134077_10349520 | Not Available | 630 | Open in IMG/M |
| 3300012976|Ga0134076_10497396 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 556 | Open in IMG/M |
| 3300012982|Ga0168317_1064948 | Not Available | 869 | Open in IMG/M |
| 3300012982|Ga0168317_1081988 | Not Available | 734 | Open in IMG/M |
| 3300012986|Ga0164304_10161313 | Not Available | 1424 | Open in IMG/M |
| 3300012988|Ga0164306_10394154 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M14 | 1039 | Open in IMG/M |
| 3300012989|Ga0164305_10074717 | All Organisms → cellular organisms → Bacteria | 2085 | Open in IMG/M |
| 3300012989|Ga0164305_10178130 | Not Available | 1472 | Open in IMG/M |
| 3300012989|Ga0164305_10563573 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M14 | 908 | Open in IMG/M |
| 3300013102|Ga0157371_10887139 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 676 | Open in IMG/M |
| 3300013296|Ga0157374_12369181 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium | 558 | Open in IMG/M |
| 3300013307|Ga0157372_12489943 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 594 | Open in IMG/M |
| 3300013503|Ga0120127_10028668 | Not Available | 1029 | Open in IMG/M |
| 3300013768|Ga0120155_1134171 | Not Available | 677 | Open in IMG/M |
| 3300013770|Ga0120123_1044744 | Not Available | 942 | Open in IMG/M |
| 3300013770|Ga0120123_1120144 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium | 610 | Open in IMG/M |
| 3300014052|Ga0120109_1070881 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium | 795 | Open in IMG/M |
| 3300014498|Ga0182019_11135246 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium | 572 | Open in IMG/M |
| 3300014829|Ga0120104_1015861 | Not Available | 1332 | Open in IMG/M |
| 3300014968|Ga0157379_11705756 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M14 | 617 | Open in IMG/M |
| 3300015241|Ga0137418_10772717 | Not Available | 724 | Open in IMG/M |
| 3300015372|Ga0132256_102975486 | Not Available | 570 | Open in IMG/M |
| 3300016294|Ga0182041_12061644 | Not Available | 532 | Open in IMG/M |
| 3300016341|Ga0182035_11273056 | Not Available | 658 | Open in IMG/M |
| 3300016387|Ga0182040_11481265 | Not Available | 576 | Open in IMG/M |
| 3300016422|Ga0182039_12109959 | Not Available | 519 | Open in IMG/M |
| 3300016422|Ga0182039_12110749 | Not Available | 519 | Open in IMG/M |
| 3300018027|Ga0184605_10090485 | Not Available | 1342 | Open in IMG/M |
| 3300018029|Ga0187787_10116458 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 874 | Open in IMG/M |
| 3300018032|Ga0187788_10101165 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1042 | Open in IMG/M |
| 3300018056|Ga0184623_10067752 | All Organisms → cellular organisms → Bacteria | 1640 | Open in IMG/M |
| 3300018071|Ga0184618_10050178 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1514 | Open in IMG/M |
| 3300018468|Ga0066662_10950797 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 847 | Open in IMG/M |
| 3300018468|Ga0066662_11528399 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 695 | Open in IMG/M |
| 3300018482|Ga0066669_10071293 | All Organisms → cellular organisms → Bacteria | 2297 | Open in IMG/M |
| 3300019767|Ga0190267_10729439 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 644 | Open in IMG/M |
| 3300019875|Ga0193701_1059471 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M14 | 764 | Open in IMG/M |
| 3300020070|Ga0206356_10056882 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium | 667 | Open in IMG/M |
| 3300020080|Ga0206350_10228991 | Not Available | 1109 | Open in IMG/M |
| 3300020081|Ga0206354_11444095 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium | 563 | Open in IMG/M |
| 3300020082|Ga0206353_11466234 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium | 652 | Open in IMG/M |
| 3300024222|Ga0247691_1056488 | Not Available | 592 | Open in IMG/M |
| 3300024288|Ga0179589_10455142 | Not Available | 591 | Open in IMG/M |
| 3300025441|Ga0208456_1035926 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 995 | Open in IMG/M |
| 3300025460|Ga0208562_1028071 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1313 | Open in IMG/M |
| 3300025764|Ga0209539_1029373 | All Organisms → cellular organisms → Bacteria | 2445 | Open in IMG/M |
| 3300025909|Ga0207705_11494121 | Not Available | 512 | Open in IMG/M |
| 3300025913|Ga0207695_10443708 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1181 | Open in IMG/M |
| 3300025916|Ga0207663_11595576 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium | 525 | Open in IMG/M |
| 3300025919|Ga0207657_10715888 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 777 | Open in IMG/M |
| 3300025921|Ga0207652_10906224 | Not Available | 779 | Open in IMG/M |
| 3300025921|Ga0207652_11170749 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium | 670 | Open in IMG/M |
| 3300025927|Ga0207687_10979103 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium | 725 | Open in IMG/M |
| 3300025928|Ga0207700_11767321 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 544 | Open in IMG/M |
| 3300025929|Ga0207664_10848018 | Not Available | 821 | Open in IMG/M |
| 3300025934|Ga0207686_11162591 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M14 | 631 | Open in IMG/M |
| 3300025944|Ga0207661_11638966 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium | 588 | Open in IMG/M |
| 3300026022|Ga0208649_1006289 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 925 | Open in IMG/M |
| 3300026041|Ga0207639_11552233 | Not Available | 621 | Open in IMG/M |
| 3300026078|Ga0207702_12102351 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 554 | Open in IMG/M |
| 3300026116|Ga0207674_11420795 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium | 663 | Open in IMG/M |
| 3300026312|Ga0209153_1003811 | All Organisms → cellular organisms → Bacteria | 4756 | Open in IMG/M |
| 3300026313|Ga0209761_1203444 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M14 | 865 | Open in IMG/M |
| 3300026530|Ga0209807_1043067 | All Organisms → cellular organisms → Bacteria | 2117 | Open in IMG/M |
| 3300026548|Ga0209161_10467479 | Not Available | 556 | Open in IMG/M |
| 3300026550|Ga0209474_10181609 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M14 | 1353 | Open in IMG/M |
| 3300026552|Ga0209577_10192340 | All Organisms → cellular organisms → Bacteria | 1573 | Open in IMG/M |
| 3300027371|Ga0209418_1048268 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 755 | Open in IMG/M |
| 3300027691|Ga0209485_1129353 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 738 | Open in IMG/M |
| 3300027842|Ga0209580_10403282 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 682 | Open in IMG/M |
| 3300027846|Ga0209180_10724360 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium | 539 | Open in IMG/M |
| 3300027875|Ga0209283_10401090 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 894 | Open in IMG/M |
| 3300027876|Ga0209974_10412911 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 531 | Open in IMG/M |
| 3300027882|Ga0209590_10848744 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M14 | 578 | Open in IMG/M |
| 3300028708|Ga0307295_10047494 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1104 | Open in IMG/M |
| 3300028718|Ga0307307_10064622 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1086 | Open in IMG/M |
| 3300028720|Ga0307317_10310126 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M14 | 533 | Open in IMG/M |
| 3300028721|Ga0307315_10212075 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium | 602 | Open in IMG/M |
| 3300028784|Ga0307282_10341334 | Not Available | 724 | Open in IMG/M |
| 3300028811|Ga0307292_10103706 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1120 | Open in IMG/M |
| 3300028819|Ga0307296_10698141 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
| 3300028828|Ga0307312_10554862 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M14 | 759 | Open in IMG/M |
| 3300028885|Ga0307304_10154056 | Not Available | 960 | Open in IMG/M |
| 3300030829|Ga0308203_1020723 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M14 | 852 | Open in IMG/M |
| 3300031249|Ga0265339_10437936 | Not Available | 608 | Open in IMG/M |
| 3300031544|Ga0318534_10651701 | Not Available | 596 | Open in IMG/M |
| 3300031680|Ga0318574_10813897 | Not Available | 547 | Open in IMG/M |
| 3300031713|Ga0318496_10524005 | Not Available | 655 | Open in IMG/M |
| 3300031795|Ga0318557_10267687 | Not Available | 783 | Open in IMG/M |
| 3300031796|Ga0318576_10242924 | Not Available | 849 | Open in IMG/M |
| 3300031820|Ga0307473_10955196 | Not Available | 623 | Open in IMG/M |
| 3300031831|Ga0318564_10533223 | Not Available | 508 | Open in IMG/M |
| 3300031890|Ga0306925_10797900 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M14 | 980 | Open in IMG/M |
| 3300031938|Ga0308175_100222579 | All Organisms → cellular organisms → Bacteria | 1875 | Open in IMG/M |
| 3300031938|Ga0308175_102749194 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 550 | Open in IMG/M |
| 3300031938|Ga0308175_103226474 | Not Available | 506 | Open in IMG/M |
| 3300031996|Ga0308176_12105234 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium | 603 | Open in IMG/M |
| 3300032001|Ga0306922_10174334 | Not Available | 2305 | Open in IMG/M |
| 3300032008|Ga0318562_10111837 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1556 | Open in IMG/M |
| 3300032009|Ga0318563_10065722 | All Organisms → cellular organisms → Bacteria | 1878 | Open in IMG/M |
| 3300032044|Ga0318558_10209206 | Not Available | 953 | Open in IMG/M |
| 3300032067|Ga0318524_10018611 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 3070 | Open in IMG/M |
| 3300032090|Ga0318518_10456069 | Not Available | 655 | Open in IMG/M |
| 3300032892|Ga0335081_11929873 | Not Available | 633 | Open in IMG/M |
| 3300032897|Ga0335071_10383524 | Not Available | 1359 | Open in IMG/M |
| 3300032955|Ga0335076_10099907 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2831 | Open in IMG/M |
| 3300033803|Ga0314862_0037237 | Not Available | 1017 | Open in IMG/M |
| 3300034268|Ga0372943_0374312 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 915 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 16.94% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 9.92% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 8.68% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 6.61% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.37% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.31% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 3.72% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.89% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.89% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 2.07% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.07% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.65% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.65% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 1.65% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.65% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.65% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.65% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.24% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.24% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.24% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.24% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.24% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.24% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.83% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.83% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.83% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.83% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.83% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.83% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.83% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.83% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.83% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.83% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.83% |
| Weathered Mine Tailings | Environmental → Terrestrial → Geologic → Mine → Unclassified → Weathered Mine Tailings | 0.83% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.83% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.83% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater | 0.41% |
| Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 0.41% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.41% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.41% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.41% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 0.41% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.41% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.41% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.41% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.41% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.41% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.41% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.41% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.41% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.41% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.41% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2124908045 | Soil microbial communities from Great Prairies - Kansas assembly 1 01_01_2011 | Environmental | Open in IMG/M |
| 2170459005 | Grass soil microbial communities from Rothamsted Park, UK - July 2009 direct MP BIO1O1 lysis 0-21cm | Environmental | Open in IMG/M |
| 2170459008 | Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect DNA Tissue lysis 0-10cm | Environmental | Open in IMG/M |
| 2228664022 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001380 | Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW37 contaminated, 5.8 m | Environmental | Open in IMG/M |
| 3300002347 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-1 deep-072012 (NGEE Surface samples 415 (1, 2, 3 deep-072012) AP id is 1030520, ASSEMBLY_DATE=20131219) | Environmental | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300004081 | Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2) | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005146 | Soil and rhizosphere microbial communities from Laval, Canada - mgHAB | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
| 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005901 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_80N_201 | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006573 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAC (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
| 3300009801 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_20_30 | Environmental | Open in IMG/M |
| 3300010036 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26 | Environmental | Open in IMG/M |
| 3300010038 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010088 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_5_24_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010166 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27 | Environmental | Open in IMG/M |
| 3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300010896 | Grasslands soil microbial communities from Angelo Coastal Reserve, California, USA - 15_R_Wat_40_2_4_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011399 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT842_2 | Environmental | Open in IMG/M |
| 3300011991 | Permafrost microbial communities from Nunavut, Canada - A34_65cm_12M | Environmental | Open in IMG/M |
| 3300011994 | Permafrost microbial communities from Nunavut, Canada - A7_65cm_12M | Environmental | Open in IMG/M |
| 3300012014 | Permafrost microbial communities from Nunavut, Canada - A10_80cm_6M | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012224 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_4_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012358 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012373 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_0_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012383 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_4_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012385 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_4_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012393 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_0_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012399 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_24_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012401 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_16_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012403 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_8_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012407 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_16_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012410 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_16_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012684 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ279 (21.06) | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300012982 | Weathered mine tailings microbial communities from Hibbing, Minnesota, USA - DCWfield | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013503 | Permafrost microbial communities from Nunavut, Canada - A23_5cm_12M | Environmental | Open in IMG/M |
| 3300013768 | Permafrost microbial communities from Nunavut, Canada - A35_65cm_0M | Environmental | Open in IMG/M |
| 3300013770 | Permafrost microbial communities from Nunavut, Canada - A15_5cm_18M | Environmental | Open in IMG/M |
| 3300014052 | Permafrost microbial communities from Nunavut, Canada - A23_35cm_12M | Environmental | Open in IMG/M |
| 3300014498 | Permafrost microbial communities from Stordalen Mire, Sweden - 812E2M metaG | Environmental | Open in IMG/M |
| 3300014829 | Permafrost microbial communities from Nunavut, Canada - A10_35cm_6M | Environmental | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
| 3300018029 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP06_20_MG | Environmental | Open in IMG/M |
| 3300018032 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP10_20_MG | Environmental | Open in IMG/M |
| 3300018056 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1 | Environmental | Open in IMG/M |
| 3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019767 | Populus adjacent soil microbial communities from riparian zone of Oak Creek, Arizona, USA - 239 T | Environmental | Open in IMG/M |
| 3300019875 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3s2 | Environmental | Open in IMG/M |
| 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300024222 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK32 | Environmental | Open in IMG/M |
| 3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300025441 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_100 (SPAdes) | Environmental | Open in IMG/M |
| 3300025460 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300025764 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0011-312 (SPAdes) | Environmental | Open in IMG/M |
| 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026022 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_80N_201 (SPAdes) | Environmental | Open in IMG/M |
| 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026312 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 (SPAdes) | Environmental | Open in IMG/M |
| 3300026313 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026530 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 (SPAdes) | Environmental | Open in IMG/M |
| 3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
| 3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300027371 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027691 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 (SPAdes) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028708 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_152 | Environmental | Open in IMG/M |
| 3300028718 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_194 | Environmental | Open in IMG/M |
| 3300028720 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_357 | Environmental | Open in IMG/M |
| 3300028721 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_355 | Environmental | Open in IMG/M |
| 3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
| 3300028811 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149 | Environmental | Open in IMG/M |
| 3300028819 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153 | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300028885 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185 | Environmental | Open in IMG/M |
| 3300030829 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_357 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Host-Associated | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031795 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19 | Environmental | Open in IMG/M |
| 3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031831 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| 3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032008 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18 | Environmental | Open in IMG/M |
| 3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
| 3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
| 3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
| 3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032897 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300033803 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_0_10 | Environmental | Open in IMG/M |
| 3300034268 | Forest soil microbial communities from Eldorado National Forest, California, USA - SNFC_MG_FRD_1.2 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| KansclcFeb2_07102380 | 2124908045 | Soil | ERVDTAVYTTAKREVSLRDEEFGGAIRLLDAMLAARQAA |
| E41_06554620 | 2170459005 | Grass Soil | RLRDLRRRVDTAVYTTSNHEVSVREDGFPQALRLVDAILAARQAA |
| F48_08089280 | 2170459008 | Grass Soil | PVVLGSAELRELRSIAETAVYSTANREVTSRREEFIGAVELVDAMLAARQAA |
| INPgaii200_05630612 | 2228664022 | Soil | LGSQELRELRSRIHTAVYTTGNSEVTLRSEDGFNQAIRLVDAILESRQAA |
| INPhiseqgaiiFebDRAFT_1019062212 | 3300000364 | Soil | LREHVDTAVYTTAKREVSLRDEDFGGAVRLLDAMLSARQAA* |
| INPhiseqgaiiFebDRAFT_1047142842 | 3300000364 | Soil | SGELRDLRNRIAAAVYSTGNREVTLRTDEFAGAIRLVDAIVDARQAV* |
| JGI10216J12902_1027026501 | 3300000956 | Soil | DTAVYTVANREVTLREEGFPQALRLVDAILAARRAA* |
| JGI10216J12902_1172098103 | 3300000956 | Soil | LRRRIDTAVYTIANHEVSLREEGFPQALRLVDAIQSVRNGNGE* |
| JGI1356J14229_101761901 | 3300001380 | Groundwater | LILGSQELRELRSRIHTAVYTTGSSEVTLRSEDGFPQAIRLVDAILEARQAA* |
| JGIcombinedJ26865_10210691 | 3300002347 | Arctic Peat Soil | RIHTAVYTTGSSEVTLRSEDGFAQAIRLVDAILEARQAA* |
| C688J35102_1199274412 | 3300002568 | Soil | LRGLVDTAVYTSAKREITLRNEEFRGAIKLVDAMLAARQAA* |
| Ga0063454_1001452381 | 3300004081 | Soil | ELRELRGQVDTAVYSTGNREVTLRGDEFQAALELVDAMLAARQAA* |
| Ga0062593_1017986301 | 3300004114 | Soil | LRSRIHTAVYTVGSREVTLRSEDPFPEALRLVDAILEARQAA* |
| Ga0062594_1019903802 | 3300005093 | Soil | ELRDRIDTAVYTSARREVSLRDVDLTGALLLLDAMLAARQAA* |
| Ga0066817_10172052 | 3300005146 | Soil | RRRVDTAVYTTSNHEVTLREDGFPQALRLVDAILAARQAA* |
| Ga0066672_108149591 | 3300005167 | Soil | LGSGELRELRSRIHTAVYTVGSREVTLRSEDPFPEALRLVDAILEARQAA* |
| Ga0066678_106489631 | 3300005181 | Soil | RGRIDTAVYSTGNREVSLRHDSFGGAIELVDAILAARQAA* |
| Ga0066675_114162952 | 3300005187 | Soil | ELRELRSQVETAVYSTGNREVTLRRDEFRSALDLVDAMLAARQAA* |
| Ga0066388_1037110561 | 3300005332 | Tropical Forest Soil | VLGSGELRLLRGAIDTAVYSTANREITLRSDSFAGAASLIDAILAARQAA* |
| Ga0070660_1017451922 | 3300005339 | Corn Rhizosphere | RSRIHTAVYTVGSREVTLRSEDPFPEALRLVDAILEARQAA* |
| Ga0070709_116092242 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | LRRDVETAVYTTARREVTVRGEEFGEALRLVDAILDARQAA* |
| Ga0070709_117641321 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | RALRDEVDTAVYSTAKREVSFRSEEFGGAIRLLYAMLSARQAA* |
| Ga0070714_1018996632 | 3300005435 | Agricultural Soil | VGKLVLGSGELKELRDRIHTAVYTVGMSEVSLRSEDGFPQALRLVDAILEARQAA* |
| Ga0070713_1024013341 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | LVLGSGELKELRSRIHTAVYTTGNQEVTLRSEQGFPQALRLVDAIVEARQAA* |
| Ga0070699_1019321861 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | ERIRTAVYSVSSREVALRGEDGFTQALALVDAILEARQAA* |
| Ga0073909_104055432 | 3300005526 | Surface Soil | RVDTAVYSTGNREITLREDGFPQALRLVDAILAARQAA* |
| Ga0070741_106214431 | 3300005529 | Surface Soil | REIDTAVYTTAKREVTLRDEELKGALRLVDAMLAARQAA* |
| Ga0070741_111914141 | 3300005529 | Surface Soil | IAETAVYSTANREVAARREEFSGALELVDAMLAARQAA* |
| Ga0070684_1001872193 | 3300005535 | Corn Rhizosphere | SRIHTAVYAVGNREVSLRSQEFPQALGLVDAILEARQAA* |
| Ga0070686_1008835471 | 3300005544 | Switchgrass Rhizosphere | GELRELRSQVETAVYSTGNREITLRGDKFQGAVDLVDAMLAARQAA* |
| Ga0066707_106636952 | 3300005556 | Soil | LVLGSGELRTLRGRIDTAVYSTGNREVSLRDDSFTGAIGLVDAILAARQAA* |
| Ga0066698_107621791 | 3300005558 | Soil | REQIDTAVYTTAKREVSLRHEELGGALRLLDAMLAARQAA* |
| Ga0066698_109511072 | 3300005558 | Soil | IHTAVYTVGAREVSLRSEDGFPQAIRLVDAILEARQAA* |
| Ga0066698_111013111 | 3300005558 | Soil | ELRSSVETAVYSTGNREVTLRHGEFAGALELVDAMLAARRAA* |
| Ga0066699_106864601 | 3300005561 | Soil | SRIHTAVYTVGAREVSLRSDDGFPQALRLVDAILDARRAG* |
| Ga0066705_105636842 | 3300005569 | Soil | AVYSVGMSEVSLRSDDGFPQAVRLVDAILEARQAI* |
| Ga0068854_1009431452 | 3300005578 | Corn Rhizosphere | VLGSGELRDLRAQVETAVYSTGNREVTLRGSEFQGALDLVDAMLAARQAA* |
| Ga0068854_1010093312 | 3300005578 | Corn Rhizosphere | TAVYSTGNREVTLRGDEFQGALDLVDAMLAARQAA* |
| Ga0066654_102996442 | 3300005587 | Soil | KELQELRGRIHTAVYTVGNREVSLRSEDGFPQALRLVDAILEARRAA* |
| Ga0066706_114105952 | 3300005598 | Soil | TAVYTVANREITLREQGFPQALRLVDAILAARQAA* |
| Ga0068856_1018804122 | 3300005614 | Corn Rhizosphere | KELHNRIHTAVYAVGNREVSLRSQEFPQALGLVDAILEARQAA* |
| Ga0068856_1019987511 | 3300005614 | Corn Rhizosphere | GSEELKELRGRIHTAVYTVGAREVSLRSEDGFPQALRLVDAILEARQAA* |
| Ga0066903_1013286563 | 3300005764 | Tropical Forest Soil | RSLVDTAVYSTGLREVTLRGDELGGAIRLVDAMIAARAAA* |
| Ga0075274_10083662 | 3300005901 | Rice Paddy Soil | ELRDRIHTAVYTVGNREVSLRSQDGFPQALRLVDAILEARRAA* |
| Ga0070715_110515822 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | LGSGELRELRSAVETAVYSTGNREVTLRHTEFIGALDLVDAMLAARQAA* |
| Ga0070712_1008332721 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | QVETAVYSTGNREVTLRGDEFTGALHLVDAMLAARQAA* |
| Ga0097621_1002864991 | 3300006237 | Miscanthus Rhizosphere | GSGELRELRSQVETAVYSTGNREITLRGDKFQGAVDLVDAMLAARQAA* |
| Ga0097621_1005759041 | 3300006237 | Miscanthus Rhizosphere | TAVYSTGNREVTLRHTEFIGALDLVDAMLAARQAA* |
| Ga0074055_110290202 | 3300006573 | Soil | LRELRSSVETAVYSSGNREVTLRHGEFKSALDLVDAMLAARQAA* |
| Ga0079222_107174971 | 3300006755 | Agricultural Soil | DTAVYSTAKREVSFRSEEFGGAIRLLDAMLSARQAA* |
| Ga0066660_116407072 | 3300006800 | Soil | GRIHTAVYTVGNREVSLRSEDGFPQALRLVDAILEARRAA* |
| Ga0066660_116935472 | 3300006800 | Soil | RRRVDTAVYTTANREVSLREEGFPQALRLVDAILAARQAA* |
| Ga0075433_105111032 | 3300006852 | Populus Rhizosphere | LGSGELRDLRNRIAAAVYSTGNREVTLRTDEFAGAIRLVDAIVDARQAV* |
| Ga0075426_103575861 | 3300006903 | Populus Rhizosphere | ELRSLRNRVSTAVYTVANREITLREEGFPQALRLVDAILAARQAA* |
| Ga0079219_114552761 | 3300006954 | Agricultural Soil | ELRELRERLDTAVYSSAKREVTLRHEELNGALNLVDAMLAARQAA* |
| Ga0099794_103970932 | 3300007265 | Vadose Zone Soil | TAVYTTGNHEVSLREEGFPQALRLVDAILAARQAA* |
| Ga0099830_116069762 | 3300009088 | Vadose Zone Soil | ALRNRVSTAVYTVANREITLREEGFPQALRLVDAILAARQAA* |
| Ga0099827_119619292 | 3300009090 | Vadose Zone Soil | GELRALRNRVSTAVYTVANREITLREEGFPQALRLVDAILAARQAA* |
| Ga0105240_101431914 | 3300009093 | Corn Rhizosphere | VDTAVYSTGNREVTLRGDEFQGALDLVDAMLAARQAA* |
| Ga0066709_1001673831 | 3300009137 | Grasslands Soil | RVSTAVYTVANREVTLREEGFPQALRLVDAILAARQAA* |
| Ga0114129_103656324 | 3300009147 | Populus Rhizosphere | GTAVYTTARKEVTVRGEEFGQALRLVDAILDARQAA* |
| Ga0114129_119085371 | 3300009147 | Populus Rhizosphere | STAVYTVANREITLREEGFPQALRLVDAILAARQAA* |
| Ga0105241_113674212 | 3300009174 | Corn Rhizosphere | VLGSGELRDLRAQVETAVYSTGNREVTLRNSEFQGALDLVDAMLAARQAA* |
| Ga0105242_119098071 | 3300009176 | Miscanthus Rhizosphere | VDTAVYTIANHEVSLREEGFPQALRLVDAILAARQAA* |
| Ga0126307_102360921 | 3300009789 | Serpentine Soil | RVETAVYATAKRELTLRDDEFAGAIRLVDAMIEARHAA* |
| Ga0105056_10174202 | 3300009801 | Groundwater Sand | DTAVYTTANHEVSLREEGFPAALRLVDAILAARQAA* |
| Ga0126305_113055992 | 3300010036 | Serpentine Soil | DLRRRVDTAVYSTGNREVTLREEGFPQALRLVDAILAARQAA* |
| Ga0126315_100935451 | 3300010038 | Serpentine Soil | ELRELRNRVATAIYSTGNREITLRTDKFDGATRLVDAILDARQAA* |
| Ga0126384_111962392 | 3300010046 | Tropical Forest Soil | AVYTTANREVTLREGEIHGALKLVDAMLEARQAA* |
| Ga0127476_10765031 | 3300010088 | Grasslands Soil | ATVGKLVLGSGELRELRSRIHTAVYTVGSREVTLRSEDPFPEALRLVDAILEARQAA* |
| Ga0126306_106808221 | 3300010166 | Serpentine Soil | VDTAVYMTAKRAVSLRDDVFSGALRLVDAILQARQAA* |
| Ga0126306_112601092 | 3300010166 | Serpentine Soil | RELRSQVETAVYSTGNREVSLRHGEFDGALRLVDAMIAARQAA* |
| Ga0134065_104850571 | 3300010326 | Grasslands Soil | LGSEELKGLRGRIHTAVYAVGAREVSLRSEDGFPQAIRLVDAILETRQAA* |
| Ga0126379_108961291 | 3300010366 | Tropical Forest Soil | ELRSRVDTAVYTTANREVTLREGEIHGALKLVDAMLEARQAA* |
| Ga0134125_116270702 | 3300010371 | Terrestrial Soil | ELRELRSQVETAIYSSGNREVTLRLSEFTGALELVDAMLLARQAA* |
| Ga0126381_1019903431 | 3300010376 | Tropical Forest Soil | RELRTSVETAVYSTGNREVTLRHAEFAGALELVDAMLAARQAA* |
| Ga0126383_135376502 | 3300010398 | Tropical Forest Soil | SGELRELRVRIDTAVYSTGNREITLRTGSFAGAAGLVDAILGARQTA* |
| Ga0134121_128829172 | 3300010401 | Terrestrial Soil | ELRSAVETAVYSTGNREVTLRHSEFTGALDLVDAMLAARQAA* |
| Ga0138111_10690362 | 3300010896 | Grasslands Soil | GSAELRDLRRRFDTAVYSTGNREITLREDGFPEALRLVDAILAARQAA* |
| Ga0137391_102641303 | 3300011270 | Vadose Zone Soil | VLGSGELRELRTSVETAVYSIGNREVTLRHGEFAGALDLVDAMLAARQAA* |
| Ga0137466_10138271 | 3300011399 | Soil | SGELRELRNRVAAAVYSTGNREITFRTDEFSGATRLVDAILDARQAA* |
| Ga0120153_10851071 | 3300011991 | Permafrost | YTVANHEVSLREEGFPQALRLVDAIQSVRAGNGA* |
| Ga0120157_10402631 | 3300011994 | Permafrost | GELRELRAQVETAVYSSGNREVTLRHDEFGGALDLVDAMLLARQAA* |
| Ga0120159_10507981 | 3300012014 | Permafrost | LRELRSRIHTAVYTVGSREVTLRSEDPFPEALRLVDAILEARQAA* |
| Ga0137389_103745752 | 3300012096 | Vadose Zone Soil | GELQELRDRIHTAVYAVANREVSLRSEDGFPQAIRLVDAILEARQAA* |
| Ga0137364_101407761 | 3300012198 | Vadose Zone Soil | LRRRIDTAVYSTGNREITLREDGFPQALRLVDAILAARQAA* |
| Ga0137364_102274881 | 3300012198 | Vadose Zone Soil | RRVETAVYSTGNRAIALRGDGFPQALRLVDAILAARQAA* |
| Ga0137364_105809211 | 3300012198 | Vadose Zone Soil | ETAVYSTGNREVTLRHGEFAGALDLVDAMLAARQAA* |
| Ga0137382_109986242 | 3300012200 | Vadose Zone Soil | RELRTRIHTAVYTVGSREVTLRSEDPFPEALRLVDAILEARQAA* |
| Ga0137380_112179831 | 3300012206 | Vadose Zone Soil | TAVYTVANREITLREEGFPQALRLVDAILAARQAA* |
| Ga0137380_115809111 | 3300012206 | Vadose Zone Soil | IHTAVYTVGTSEVSLRSEDGFPQALRLVDAILESRRAA* |
| Ga0137381_113624252 | 3300012207 | Vadose Zone Soil | SGELQELRNRIHTAVYTVGAREVSLRSEDGFPQALRLVDAILEARQAA* |
| Ga0137376_109342893 | 3300012208 | Vadose Zone Soil | VSTAVYTVANREVTLREEGFPQALRLVDAILAARQAA* |
| Ga0137376_113928892 | 3300012208 | Vadose Zone Soil | VETAVYSTGNREVTLRGDEFTGAVDLVDAMLAARQAA* |
| Ga0137378_112738591 | 3300012210 | Vadose Zone Soil | RDLRRRVDTAVYATSNHEVSLREDGFPQALRLVDAILAARQAA* |
| Ga0137377_103643851 | 3300012211 | Vadose Zone Soil | AVYSTGTREVTLRHGEFAGALDLVDAMLAARQAA* |
| Ga0137377_116940741 | 3300012211 | Vadose Zone Soil | DTAVYTTANREVSLREDGFPQALRLVDAILAARQAA* |
| Ga0150985_1110139011 | 3300012212 | Avena Fatua Rhizosphere | DRIHTAVYTVGNSEVTLRSQDGFPQALRLVDAILEARQAA* |
| Ga0134028_10846811 | 3300012224 | Grasslands Soil | EQIDTAVYTTAKREVSLRHEELGGALRLLDAMLAARQAA* |
| Ga0134028_12377271 | 3300012224 | Grasslands Soil | TAVYTVGSREVTLRSEDPFPEALRLVDAILEARQAA* |
| Ga0137387_103433602 | 3300012349 | Vadose Zone Soil | DLRRRVDTAVYTTANREVSLREDGFPQALRLVDAILAARQAA* |
| Ga0137387_110368032 | 3300012349 | Vadose Zone Soil | RDLRRRVDTAVYTTGNHEVSLREEGFPQALRLVDAILAARRAA* |
| Ga0137387_113108101 | 3300012349 | Vadose Zone Soil | GRIDTAVYSTGNREVSLRHDSFDGAIELVDAILAARQAA* |
| Ga0137372_111205512 | 3300012350 | Vadose Zone Soil | DLRRRVDTAVYTTANREISLREQGFPQALRLVDAILAARQAA* |
| Ga0137386_107411161 | 3300012351 | Vadose Zone Soil | NRVSTAVYTVANREITLREEGFSQALRLVDAILAARQAA* |
| Ga0137386_111511611 | 3300012351 | Vadose Zone Soil | ELQELRDRIHTAVYAVANRDVSLRSEDGFPQAIRLVDAILEARQAA* |
| Ga0137369_101056171 | 3300012355 | Vadose Zone Soil | LVLGSGELRTLRSQIDTAVYSTAHREVTLRSDSFAGAASLVAAILAARQAA* |
| Ga0137369_107040192 | 3300012355 | Vadose Zone Soil | VDTAVYTTANREISLREDGFPQALRLVDAILAARQAA* |
| Ga0137371_102430173 | 3300012356 | Vadose Zone Soil | RIDTAVYSTGNREVSLRHDSFGGAIELVDAILAARQAA* |
| Ga0137384_108017781 | 3300012357 | Vadose Zone Soil | DRIDIAVYSSGNREITLRSDTFNGAVELVDAIVAARQAA* |
| Ga0137368_101126661 | 3300012358 | Vadose Zone Soil | VVLGSGELRELRSQIDTAVYSTGNREVTLRHGEFEGALRLVDAMIAARQAA* |
| Ga0137385_109686081 | 3300012359 | Vadose Zone Soil | SGELRALRNRVSTAVYTVANREITLREQGFPQALRLVDAILAARQAA* |
| Ga0137385_111293061 | 3300012359 | Vadose Zone Soil | SGELRALRSRVSTAVYTVANREITLREEGFPQALRLVDAILAARLAA* |
| Ga0137375_105067291 | 3300012360 | Vadose Zone Soil | ELRSQIDTAVYSTGNREVTLRHGEFEGALRLVDAMIAARQAA* |
| Ga0137375_107851351 | 3300012360 | Vadose Zone Soil | LRELRERIDTAVYTSARREVSLRNVDLTGALGLLDAMLAARQAA* |
| Ga0137390_107796752 | 3300012363 | Vadose Zone Soil | GPLVLGSGELRTLRGRIDTAVYSTGNREVSLRDDSFTGAIGLVDAILAARQAA* |
| Ga0134042_10813121 | 3300012373 | Grasslands Soil | VYAVGAREVSLRSEDGFPQALRLVDAILEARQAA* |
| Ga0134033_11194982 | 3300012383 | Grasslands Soil | AVYSTGNREVTLRRDEFQSALDLVDAMLAARQAA* |
| Ga0134023_12651442 | 3300012385 | Grasslands Soil | GELRELRSRIHTAVYTVGSREVTLRSEDPFPEALRLVDAILEARQAA* |
| Ga0134052_12100971 | 3300012393 | Grasslands Soil | LRNRIHTAVYTVGAREVSLRSEDGFPQAIRLVDAILEARQAA* |
| Ga0134061_10996892 | 3300012399 | Grasslands Soil | VDTAVYTTGNHEVSLREEGFPQALRLVDAILAARQAA* |
| Ga0134055_13824872 | 3300012401 | Grasslands Soil | VYTVGAREVSLRSEDGFPQASRLVDAILEARQAA* |
| Ga0134049_12520141 | 3300012403 | Grasslands Soil | RIHTAVYTVGSREVTLRSEDPFPEALRLVDAILEARQAA* |
| Ga0134050_14344071 | 3300012407 | Grasslands Soil | STAVYTVANREITLRGEGFPQALRLVDAILAARRAA* |
| Ga0134060_11817591 | 3300012410 | Grasslands Soil | LRDLRRRVETAVYTTANREVSLREDGFPQALRLVDAILAARQAA* |
| Ga0150984_1054680771 | 3300012469 | Avena Fatua Rhizosphere | AVYSTGNREVTLRNDEFKGALDLVDAMLLARQAA* |
| Ga0136614_108103412 | 3300012684 | Polar Desert Sand | VVGPMVLGSGELRELRNRIAAAVYSTGNREITFRTDEFSGATRLVDAILDARQAA* |
| Ga0137396_102580782 | 3300012918 | Vadose Zone Soil | GKLVLGSGELRELRSRIHTAVYTVGSREVTLRSEDPFPEALRLVDAILEARQAA* |
| Ga0137416_112215852 | 3300012927 | Vadose Zone Soil | TAVYTSARREVSLRDIDLTGALGLLDAMLAARQAA* |
| Ga0137410_107219211 | 3300012944 | Vadose Zone Soil | RIHTAVYTVGNQEVALRGDDGFPQAIRLVDAILEARQAA* |
| Ga0164300_104273771 | 3300012951 | Soil | TAVYSSGNREVTLRGDEFTGALDLVDAMLLARQAA* |
| Ga0164301_109790231 | 3300012960 | Soil | DTAVYTISNHEVSLREEGFPQALRLVDAILAARQAA* |
| Ga0164301_113584892 | 3300012960 | Soil | AVYTIANHEVSLREEGFPQALRLVDAIQTVRAGNGA* |
| Ga0164302_101880793 | 3300012961 | Soil | SSVETAVYSSGNREVTLRHGEFKSALDLVDAMLAARQAA* |
| Ga0134077_103495201 | 3300012972 | Grasslands Soil | SGELRELRSSVETAVYSTGNREVTLRHAEFAGALELVDAMLAARQAA* |
| Ga0134076_104973961 | 3300012976 | Grasslands Soil | NRVSTAVYTVANREITLREEGFPQALRLVDAILAARQAA* |
| Ga0168317_10649481 | 3300012982 | Weathered Mine Tailings | GSGELRELRTRVETAVYSTGNREVTLRGDEFKGALDLVDAMLAARQAA* |
| Ga0168317_10819881 | 3300012982 | Weathered Mine Tailings | LRDRIHSAVYSTGSSEVTLRSEDGFPQAIRLVDAILEARQAA* |
| Ga0164304_101613133 | 3300012986 | Soil | RELRGAVETAVYSTGNREVTLRHTEFIGALDLVDAMLAARQAA* |
| Ga0164306_103941542 | 3300012988 | Soil | RRRVDTAVYSTGNREITLREDGFPQALRLVDAILAARQAA* |
| Ga0164305_100747174 | 3300012989 | Soil | VETAVYSTGNREVTLRHAEFAGALELVDAMLAARQAA* |
| Ga0164305_101781303 | 3300012989 | Soil | VLGSGELRELRGSVETAVYSIGNREVSLRHAEFAGALELVDAMLAARQAA* |
| Ga0164305_105635731 | 3300012989 | Soil | KELRSRIHTAVYTTGNQEVTLRSEQGFPQALRLVDAIVEARQAA* |
| Ga0157371_108871391 | 3300013102 | Corn Rhizosphere | KELHSRIHTAVYAVGNREVSLRSQEFPQALGLVDAILEARQAA* |
| Ga0157374_123691811 | 3300013296 | Miscanthus Rhizosphere | VETAVYSTGNREVTLRGSEFQGALDLVDAMLAARQAA* |
| Ga0157372_124899431 | 3300013307 | Corn Rhizosphere | RIHTAVYAVGNRAVSLRSQEFRQARGLVDAILEARQAA* |
| Ga0120127_100286681 | 3300013503 | Permafrost | VDRQAIRIEQELKELRSRIHTAVYTTGSSEVTLRSEDGFPQAIRLVDAILEAREAA* |
| Ga0120155_11341711 | 3300013768 | Permafrost | LGSGELRELRAQVETAVYSSGNREVTLRHDEFGGALDLVDAMLLARQAA* |
| Ga0120123_10447441 | 3300013770 | Permafrost | SVETAVYSTGNREVTLRHGEFAGALDLVDAMLAARQAA* |
| Ga0120123_11201442 | 3300013770 | Permafrost | VLGSGELRELRASVETAVYSIGNREVTLRHGEFAGALDLVDAMLA |
| Ga0120109_10708812 | 3300014052 | Permafrost | VAGELRELRASVETAVYSTGNREVTLRHGEFAGALDLVDAMLAARQAA* |
| Ga0182019_111352462 | 3300014498 | Fen | QVETAVYSTGNREVTLRGDEFKGALDLVDAMLAARQAA* |
| Ga0120104_10158613 | 3300014829 | Permafrost | TAVYSTGNREVTLRHGEFAGALDLVDAMLAARQAA* |
| Ga0157379_117057561 | 3300014968 | Switchgrass Rhizosphere | TAVYTIANHEVSLREEGFPQALRLVDAILAARQAA* |
| Ga0137418_107727172 | 3300015241 | Vadose Zone Soil | AVYSTGNREVTLRGDKFTGALDLVDAMLAARQAA* |
| Ga0132256_1029754862 | 3300015372 | Arabidopsis Rhizosphere | RELRSRIATAVYPTGHREITLRSESFAGATSLIDAILAARQAA* |
| Ga0182041_120616441 | 3300016294 | Soil | GELRALRSLVDTAVYSTAQREVTLREGELGGAIRLVDAMMAARTAA |
| Ga0182035_112730561 | 3300016341 | Soil | LRSRAETAVYSTANREVTSRRDEFLGALELVDAMLAARQAA |
| Ga0182040_114812651 | 3300016387 | Soil | RGLIDTAVYSSGAREVSLRHGEFKAALDLVDAMLAARRAA |
| Ga0182039_121099592 | 3300016422 | Soil | AELRELRGLIDTAVYSSGAREVSLRHGEFKAALDLVDAMLAARRAA |
| Ga0182039_121107491 | 3300016422 | Soil | ALRSEIDTAVYSTGQREVTLRTDELAGGIRLLQAMVAARAAG |
| Ga0184605_100904853 | 3300018027 | Groundwater Sediment | TAVYTTAKREVSLRHEQLGGALRLLDAMLVARQAA |
| Ga0187787_101164581 | 3300018029 | Tropical Peatland | TAVYTVGNREVSLRGEDGFPQALRLVDAILEARQAA |
| Ga0187788_101011651 | 3300018032 | Tropical Peatland | ELRGRIHTAVYTVGNREVSLRSEDGFPQALRLVDAILESRRAA |
| Ga0184623_100677521 | 3300018056 | Groundwater Sediment | RRVDTAVYTTANREVSLREEGFPQALRLVDAILAARLAA |
| Ga0184618_100501783 | 3300018071 | Groundwater Sediment | AVYTIANHEVSLREEGFPQALRLVDAIQSVRAGNGN |
| Ga0066662_109507971 | 3300018468 | Grasslands Soil | RSRIHTAVYTVGAREVTLRSEDPFPQALRLVDAILEARQAA |
| Ga0066662_115283992 | 3300018468 | Grasslands Soil | DTAIYTSATREITLRNEEFGEALRLVDAILGARQAA |
| Ga0066669_100712931 | 3300018482 | Grasslands Soil | AVYTVGSREVTLRSEDPFPEALRLVDAILEARQAA |
| Ga0190267_107294392 | 3300019767 | Soil | VVGPMVLGSAELRELRNRVAAAVYSTGNREITFRTDEFSGATRLVDAILDARQAA |
| Ga0193701_10594712 | 3300019875 | Soil | RRVDTAVYTTTNHEVSLREDGFPQALRLVDAILAARQAA |
| Ga0206356_100568821 | 3300020070 | Corn, Switchgrass And Miscanthus Rhizosphere | DLRAQVETAVYSTGNREVSLRGSEFQGALDLVDAMLAARQAA |
| Ga0206350_102289911 | 3300020080 | Corn, Switchgrass And Miscanthus Rhizosphere | RTEVETAVYSTGNREVTQRLNEFTGALDLVDAMLAARQAA |
| Ga0206354_114440952 | 3300020081 | Corn, Switchgrass And Miscanthus Rhizosphere | GELRELRQQKETAVYSTGNREVTLRGDEFAQALELVDAMLAARQAA |
| Ga0206353_114662342 | 3300020082 | Corn, Switchgrass And Miscanthus Rhizosphere | RDLRAQVETAVYSTGNREVTLRNSEFRGALDLVAAMLAARQAA |
| Ga0247691_10564881 | 3300024222 | Soil | ELRAQVETAVYSTGNREVTLRGDEFTGALHLVDAMLAARQAA |
| Ga0179589_104551422 | 3300024288 | Vadose Zone Soil | TAVYTTSSSEVTLRGDELTQAVQLVDAILESRQAA |
| Ga0208456_10359262 | 3300025441 | Peatland | GRIHTAVYTVGNREVSLRGEDGFPQALRLVDAILEARQAA |
| Ga0208562_10280713 | 3300025460 | Peatland | RLVLGSQELKELRGRIHTAVYTVGNREVSLRGEDGFPQALRLVDAILEARQAA |
| Ga0209539_10293734 | 3300025764 | Arctic Peat Soil | TAVYTTGSSEVTLRSEDGFAQAIRLVDAILEARQAA |
| Ga0207705_114941211 | 3300025909 | Corn Rhizosphere | QVETAVYSTGNREVSLRNDEFKGALDLVDAMLAARQAA |
| Ga0207695_104437081 | 3300025913 | Corn Rhizosphere | ELQELRGRIHTAVYTVGNREVSLRSEDGFPQALRLVDAILEARRAA |
| Ga0207663_115955761 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | RDLRAQVETAVYSTGNREVTLRGSEFQSALDLVDAMLAARQAA |
| Ga0207657_107158882 | 3300025919 | Corn Rhizosphere | GELKELRSRIHTAVYTTGNQEVTLRSEQGFPQALRLVDAIVEARQAA |
| Ga0207652_109062241 | 3300025921 | Corn Rhizosphere | QVETAVYSTGNREVTLRNSEFQGALDLVAAMLAARQAA |
| Ga0207652_111707492 | 3300025921 | Corn Rhizosphere | LRAQVDTAVYSTGNREVTLRGDEFQGALDLVDAMLAARQAA |
| Ga0207687_109791032 | 3300025927 | Miscanthus Rhizosphere | SGELRDLRSQVETAVYSTGNREVTLRNSEFQGALDLVAAMLAARQAA |
| Ga0207700_117673212 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | VLGSGELQELRNRIHTAVYAVGNREVSLRSPEFPQALGLVDAILEARQAA |
| Ga0207664_108480182 | 3300025929 | Agricultural Soil | LGSGELRELRAQVETAVYSTGNREVTLRGDEFTGALHLVDAMLAARQAA |
| Ga0207686_111625912 | 3300025934 | Miscanthus Rhizosphere | RVDTAVYTIANHEVSLREEGFPQALRLVDAILAARQAA |
| Ga0207661_116389662 | 3300025944 | Corn Rhizosphere | GSGELRELRGAVDTAVYSTGNREVTLRHTEFIGALDLVDAMLAARQAA |
| Ga0208649_10062892 | 3300026022 | Rice Paddy Soil | QELRDRIHTAVYTVGNREVSLRSQDGFPQALRLVDAILEARRAA |
| Ga0207639_115522332 | 3300026041 | Corn Rhizosphere | GELRELRAQVETAVYSTGNREVTLRGDEFAGALELVDAMLAARQAA |
| Ga0207702_121023512 | 3300026078 | Corn Rhizosphere | LGSGELKELHNRIHTAVYAVGNREVSLRSQEFPQALGLVDAILEARQAA |
| Ga0207674_114207952 | 3300026116 | Corn Rhizosphere | TAVYSTGNREVTLRIGEFRGALDLVAAMLAARQAA |
| Ga0209153_10038111 | 3300026312 | Soil | ELRSLRNRVSTAVYTVANREITLREEGFPQALRLVDAILAARQAA |
| Ga0209761_12034442 | 3300026313 | Grasslands Soil | LRRRVDTAVYTTGNHEVSLREEGFPQALRLVDAILAARQAA |
| Ga0209807_10430674 | 3300026530 | Soil | GKLVLGSGELSELRSRMHTAVYTVGSREVTLRSEDPFPEALRLVDAILEARQAA |
| Ga0209161_104674791 | 3300026548 | Soil | AVYTVGNREVSLRSEDGFPQALRLVDAILEARRAA |
| Ga0209474_101816091 | 3300026550 | Soil | DLRRRVDTAVYTTANREVSLREDGFPQALRLVDAILAARQAA |
| Ga0209577_101923401 | 3300026552 | Soil | ELRELRSRIHTAVYTVGSREVTLRSEDPFPEALRLVDAILEARQAA |
| Ga0209418_10482681 | 3300027371 | Forest Soil | KELQELRGRIHTAVYTVGNREVSLRSEDGFPQALRLVDAILEARRAA |
| Ga0209485_11293531 | 3300027691 | Agricultural Soil | RNRVAAAVYSTGNREISFRTDEFSGATRLVDAILDARQAA |
| Ga0209580_104032822 | 3300027842 | Surface Soil | GSRELQELRDRIHTAVYTVGNREVSLRGDDGFPQALRLVDAILEARRAA |
| Ga0209180_107243601 | 3300027846 | Vadose Zone Soil | RGRIDTAVYSTGNREVSLRDDSFTGAIGLVDAILAARQAA |
| Ga0209283_104010902 | 3300027875 | Vadose Zone Soil | LRGRIDTAVYSTGNREVSLRDDSFTGAIGLVDAILAARQAA |
| Ga0209974_104129112 | 3300027876 | Arabidopsis Thaliana Rhizosphere | GPMVLGSGELRELRNRVASAVYSTGNREITFRTDEFSGATRLVDAILDARQAA |
| Ga0209590_108487441 | 3300027882 | Vadose Zone Soil | RNRVSTAVYTVANREITLREEGFPHALRLVDAILAARQAA |
| Ga0307295_100474941 | 3300028708 | Soil | VDTAVYSTGNREVTLRHSEFTGALDLVDAMLAARQAA |
| Ga0307307_100646221 | 3300028718 | Soil | ALRGEVDTAVYTTTRREVSLRGEDFSAATRLVDAILEARQAA |
| Ga0307317_103101262 | 3300028720 | Soil | VDTAVYSTGSREITLREDGFPQALRLVDAILAARQAA |
| Ga0307315_102120751 | 3300028721 | Soil | SGELRELRSAVETAVYSTGNREVTLRHSEFTGALDLVDAMLAARQAA |
| Ga0307282_103413342 | 3300028784 | Soil | GELRELRSRIHTAVYTVGSREVTLRSEDPFPEALRLVDAILEARQAA |
| Ga0307292_101037061 | 3300028811 | Soil | VLRSRIGTAVYSTANREVTLRSDSFGGAATLIDAILAARQAA |
| Ga0307296_106981412 | 3300028819 | Soil | AVYSTGNREITLREDGFPQALRLVDAIQAVRSGSGA |
| Ga0307312_105548622 | 3300028828 | Soil | VYTIANHEVSLREEGFPQALRLVDAIQSVRVGNGN |
| Ga0307304_101540562 | 3300028885 | Soil | GELRELRAQVETAVYSTGNREVTLRGDEFTGALDLVDAMLAARQAA |
| Ga0308203_10207232 | 3300030829 | Soil | GTAVYTTSNHEVSLREDGFPQALRLVDAILAARQAA |
| Ga0265339_104379361 | 3300031249 | Rhizosphere | SRIHTAVYTTGSSEVTLRSEDGFTQAIRLVDAILEARQAA |
| Ga0318534_106517011 | 3300031544 | Soil | SVELRELRSRIATAVYSTGHREITLRSDSFGGATSLIDAILAARKAA |
| Ga0318574_108138971 | 3300031680 | Soil | VLGSAELRELRSLAETAVYSTANREVTSRREEFIGAVELVDAMLAARQAA |
| Ga0318496_105240052 | 3300031713 | Soil | RLKTAVYTVAKQEVSLRSGDEFPGAVGLVDAILEARQAA |
| Ga0318557_102676872 | 3300031795 | Soil | LGSAELRELRSLAETAVYSTANREVTSRREEFIGAVELVDAMLAARQAA |
| Ga0318576_102429242 | 3300031796 | Soil | ETAVYSTANREVTSRREEFIGAVELVDAMLAARQAA |
| Ga0307473_109551962 | 3300031820 | Hardwood Forest Soil | RELRSKIDTAVYTTAKREVTFRDEELTGALRLVDAMLAARQAA |
| Ga0318564_105332232 | 3300031831 | Soil | ELRALRSLVDTAVYSTAQREVTLRDGELGGAIRLVDAMIAARAAA |
| Ga0306925_107979001 | 3300031890 | Soil | LRAQIDTAVYSTANREITLRSDSFGGAAALIDAILLASQAA |
| Ga0308175_1002225791 | 3300031938 | Soil | RAEVETAVYSTGNREVTLRGDEFKRALDLVDAMLAARQAA |
| Ga0308175_1027491941 | 3300031938 | Soil | VETAVYQSARREVSLRDEEFDGALRLVDAMLETRQAA |
| Ga0308175_1032264741 | 3300031938 | Soil | RSRIHTAVYTVGSGEVSLRSDNGFPRAIRLVDAILEARQAA |
| Ga0308176_121052341 | 3300031996 | Soil | LRQQKETAVYSTGNREVTLRGDEFAQALELVDAMLAARQAA |
| Ga0306922_101743344 | 3300032001 | Soil | GSAELRELRSLAETAVYSTANREVTSRREEFIGAVELVDAMLAARQAA |
| Ga0318562_101118373 | 3300032008 | Soil | AELRELRSLAETAVYSTANREVTSRREEFIGAVELVDAMLAARQAA |
| Ga0318563_100657221 | 3300032009 | Soil | LRGLIDTAVYSSGAREVSLRHGEFKAALDLVDAMLAARRAA |
| Ga0318558_102092062 | 3300032044 | Soil | PVVLGSAELRELRSLAETAVYSTANREVTSRREEFIGAVELVDAMLAARQAA |
| Ga0318524_100186111 | 3300032067 | Soil | TAVYSTANREVTSRREEFIGAVELVDAMLAARQAA |
| Ga0318518_104560691 | 3300032090 | Soil | MGSGELRALRSLVDTAVYSTAQREVTLREGELGGAIRLVDAMMAARTAA |
| Ga0335081_119298732 | 3300032892 | Soil | TVGRLILGSQELKELRGRIHTAVYTVGNREVSLRGEDGFPQALRLVDAILEARQAA |
| Ga0335071_103835241 | 3300032897 | Soil | AQVETAVYSTGNREVTFRGDEFKEALDLVDAMLAARQAA |
| Ga0335076_100999071 | 3300032955 | Soil | LHTLRELVDTAVYSTAQREVSLRDDALEGAIRLVDAMIAARNAA |
| Ga0314862_0037237_866_1015 | 3300033803 | Peatland | MGSAELRELRGLIDTAVYSSGAREVSLRHSEFKAALDLVDAMLAARRAA |
| Ga0372943_0374312_781_915 | 3300034268 | Soil | KALKDRIHTAVYAVGNHEVTLRSDQGFGQALQLVDAIVDARQAA |
| ⦗Top⦘ |