NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F017227

Metagenome / Metatranscriptome Family F017227

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F017227
Family Type Metagenome / Metatranscriptome
Number of Sequences 242
Average Sequence Length 42 residues
Representative Sequence DLRRRVDTAVYSTGNREVTLREEGFPQALRLVDAILAARQAA
Number of Associated Samples 208
Number of Associated Scaffolds 242

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.41 %
% of genes near scaffold ends (potentially truncated) 100.00 %
% of genes from short scaffolds (< 2000 bps) 95.04 %
Associated GOLD sequencing projects 194
AlphaFold2 3D model prediction Yes
3D model pTM-score0.37

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (60.331 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil
(16.942 % of family members)
Environment Ontology (ENVO) Unclassified
(32.645 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(48.347 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 48.57%    β-sheet: 0.00%    Coil/Unstructured: 51.43%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.37
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 242 Family Scaffolds
PF13624SurA_N_3 84.71
PF03819MazG 4.55
PF03952Enolase_N 2.89
PF13623SurA_N_2 1.65
PF12697Abhydrolase_6 0.41
PF12844HTH_19 0.41
PF03461TRCF 0.41
PF05977MFS_3 0.41
PF09312SurA_N 0.41

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 242 Family Scaffolds
COG0148EnolaseCarbohydrate transport and metabolism [G] 2.89
COG1197Transcription-repair coupling factor (superfamily II helicase)Transcription [K] 0.83
COG0760Peptidyl-prolyl isomerase, parvulin familyPosttranslational modification, protein turnover, chaperones [O] 0.41
COG2814Predicted arabinose efflux permease AraJ, MFS familyCarbohydrate transport and metabolism [G] 0.41


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms60.33 %
UnclassifiedrootN/A39.67 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2124908045|KansclcFeb2_ConsensusfromContig809494Not Available807Open in IMG/M
2170459005|F1BAP7Q01DBWE6All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M14504Open in IMG/M
2170459008|GA8OVOZ01DNSF8Not Available506Open in IMG/M
2228664022|INPgaii200_c0563061Not Available625Open in IMG/M
3300000364|INPhiseqgaiiFebDRAFT_101906221Not Available1200Open in IMG/M
3300000364|INPhiseqgaiiFebDRAFT_104714284All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium610Open in IMG/M
3300000956|JGI10216J12902_102702650All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M14537Open in IMG/M
3300000956|JGI10216J12902_117209810All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1202Open in IMG/M
3300001380|JGI1356J14229_10176190All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria636Open in IMG/M
3300002347|JGIcombinedJ26865_1021069All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1056Open in IMG/M
3300002568|C688J35102_119927441Not Available816Open in IMG/M
3300004081|Ga0063454_100145238Not Available1243Open in IMG/M
3300004114|Ga0062593_101798630All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium673Open in IMG/M
3300005093|Ga0062594_101990380Not Available620Open in IMG/M
3300005146|Ga0066817_1017205All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M14636Open in IMG/M
3300005167|Ga0066672_10814959Not Available586Open in IMG/M
3300005181|Ga0066678_10648963All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium703Open in IMG/M
3300005187|Ga0066675_11416295Not Available509Open in IMG/M
3300005332|Ga0066388_103711056All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria779Open in IMG/M
3300005339|Ga0070660_101745192Not Available530Open in IMG/M
3300005434|Ga0070709_11609224All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium529Open in IMG/M
3300005434|Ga0070709_11764132Not Available506Open in IMG/M
3300005435|Ga0070714_101899663Not Available581Open in IMG/M
3300005436|Ga0070713_102401334All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia510Open in IMG/M
3300005518|Ga0070699_101932186All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium540Open in IMG/M
3300005526|Ga0073909_10405543All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M14643Open in IMG/M
3300005529|Ga0070741_10621443Not Available962Open in IMG/M
3300005529|Ga0070741_11191414Not Available643Open in IMG/M
3300005535|Ga0070684_100187219All Organisms → cellular organisms → Bacteria1883Open in IMG/M
3300005544|Ga0070686_100883547Not Available726Open in IMG/M
3300005556|Ga0066707_10663695All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium658Open in IMG/M
3300005558|Ga0066698_10762179Not Available631Open in IMG/M
3300005558|Ga0066698_10951107Not Available547Open in IMG/M
3300005558|Ga0066698_11101311All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium502Open in IMG/M
3300005561|Ga0066699_10686460All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium731Open in IMG/M
3300005569|Ga0066705_10563684Not Available704Open in IMG/M
3300005578|Ga0068854_100943145All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium761Open in IMG/M
3300005578|Ga0068854_101009331Not Available737Open in IMG/M
3300005587|Ga0066654_10299644All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium861Open in IMG/M
3300005598|Ga0066706_11410595All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M14525Open in IMG/M
3300005614|Ga0068856_101880412All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria610Open in IMG/M
3300005614|Ga0068856_101998751Not Available590Open in IMG/M
3300005764|Ga0066903_101328656All Organisms → cellular organisms → Bacteria1345Open in IMG/M
3300005901|Ga0075274_1008366All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1257Open in IMG/M
3300006163|Ga0070715_11051582Not Available510Open in IMG/M
3300006175|Ga0070712_100833272Not Available793Open in IMG/M
3300006237|Ga0097621_100286499All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1451Open in IMG/M
3300006237|Ga0097621_100575904Not Available1027Open in IMG/M
3300006573|Ga0074055_11029020All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium524Open in IMG/M
3300006755|Ga0079222_10717497Not Available795Open in IMG/M
3300006800|Ga0066660_11640707Not Available511Open in IMG/M
3300006800|Ga0066660_11693547All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M14504Open in IMG/M
3300006852|Ga0075433_10511103All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1057Open in IMG/M
3300006903|Ga0075426_10357586All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1074Open in IMG/M
3300006954|Ga0079219_11455276Not Available616Open in IMG/M
3300007265|Ga0099794_10397093All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M14720Open in IMG/M
3300009088|Ga0099830_11606976All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M14542Open in IMG/M
3300009090|Ga0099827_11961929All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium509Open in IMG/M
3300009093|Ga0105240_10143191All Organisms → cellular organisms → Bacteria2856Open in IMG/M
3300009137|Ga0066709_100167383All Organisms → cellular organisms → Bacteria2839Open in IMG/M
3300009147|Ga0114129_10365632All Organisms → cellular organisms → Bacteria1908Open in IMG/M
3300009147|Ga0114129_11908537All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium720Open in IMG/M
3300009174|Ga0105241_11367421All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium677Open in IMG/M
3300009176|Ga0105242_11909807All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M14634Open in IMG/M
3300009789|Ga0126307_10236092All Organisms → cellular organisms → Bacteria1469Open in IMG/M
3300009801|Ga0105056_1017420All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M14861Open in IMG/M
3300010036|Ga0126305_11305599All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M14501Open in IMG/M
3300010038|Ga0126315_10093545All Organisms → cellular organisms → Bacteria1713Open in IMG/M
3300010046|Ga0126384_11196239Not Available701Open in IMG/M
3300010088|Ga0127476_1076503Not Available567Open in IMG/M
3300010166|Ga0126306_10680822All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium824Open in IMG/M
3300010166|Ga0126306_11260109Not Available609Open in IMG/M
3300010326|Ga0134065_10485057Not Available512Open in IMG/M
3300010366|Ga0126379_10896129Not Available989Open in IMG/M
3300010371|Ga0134125_11627070Not Available703Open in IMG/M
3300010376|Ga0126381_101990343Not Available837Open in IMG/M
3300010398|Ga0126383_13537650All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria510Open in IMG/M
3300010401|Ga0134121_12882917All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium527Open in IMG/M
3300010896|Ga0138111_1069036All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M14527Open in IMG/M
3300011270|Ga0137391_10264130Not Available1490Open in IMG/M
3300011399|Ga0137466_1013827All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1007Open in IMG/M
3300011991|Ga0120153_1085107Not Available521Open in IMG/M
3300011994|Ga0120157_1040263Not Available1039Open in IMG/M
3300012014|Ga0120159_1050798All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1312Open in IMG/M
3300012096|Ga0137389_10374575All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1214Open in IMG/M
3300012198|Ga0137364_10140776All Organisms → cellular organisms → Bacteria1736Open in IMG/M
3300012198|Ga0137364_10227488All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M141373Open in IMG/M
3300012198|Ga0137364_10580921Not Available844Open in IMG/M
3300012200|Ga0137382_10998624Not Available601Open in IMG/M
3300012206|Ga0137380_11217983All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium638Open in IMG/M
3300012206|Ga0137380_11580911All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium540Open in IMG/M
3300012207|Ga0137381_11362425Not Available602Open in IMG/M
3300012208|Ga0137376_10934289All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium744Open in IMG/M
3300012208|Ga0137376_11392889Not Available592Open in IMG/M
3300012210|Ga0137378_11273859All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M14652Open in IMG/M
3300012211|Ga0137377_10364385Not Available1382Open in IMG/M
3300012211|Ga0137377_11694074All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M14554Open in IMG/M
3300012212|Ga0150985_111013901All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium893Open in IMG/M
3300012224|Ga0134028_1084681Not Available619Open in IMG/M
3300012224|Ga0134028_1237727All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium790Open in IMG/M
3300012349|Ga0137387_10343360All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M141081Open in IMG/M
3300012349|Ga0137387_11036803All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M14587Open in IMG/M
3300012349|Ga0137387_11310810Not Available506Open in IMG/M
3300012350|Ga0137372_11120551All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M14538Open in IMG/M
3300012351|Ga0137386_10741116All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium706Open in IMG/M
3300012351|Ga0137386_11151161Not Available545Open in IMG/M
3300012355|Ga0137369_10105617All Organisms → cellular organisms → Bacteria2302Open in IMG/M
3300012355|Ga0137369_10704019All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M14694Open in IMG/M
3300012356|Ga0137371_10243017All Organisms → cellular organisms → Bacteria1406Open in IMG/M
3300012357|Ga0137384_10801778All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium762Open in IMG/M
3300012358|Ga0137368_10112666All Organisms → cellular organisms → Bacteria2081Open in IMG/M
3300012359|Ga0137385_10968608All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M14702Open in IMG/M
3300012359|Ga0137385_11129306All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M14644Open in IMG/M
3300012360|Ga0137375_10506729Not Available1026Open in IMG/M
3300012360|Ga0137375_10785135Not Available768Open in IMG/M
3300012363|Ga0137390_10779675All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria914Open in IMG/M
3300012373|Ga0134042_1081312Not Available627Open in IMG/M
3300012383|Ga0134033_1119498Not Available508Open in IMG/M
3300012385|Ga0134023_1265144All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium676Open in IMG/M
3300012393|Ga0134052_1210097Not Available770Open in IMG/M
3300012399|Ga0134061_1099689All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M14791Open in IMG/M
3300012401|Ga0134055_1382487Not Available825Open in IMG/M
3300012403|Ga0134049_1252014All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1065Open in IMG/M
3300012407|Ga0134050_1434407All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M14783Open in IMG/M
3300012410|Ga0134060_1181759All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M14583Open in IMG/M
3300012469|Ga0150984_105468077All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium510Open in IMG/M
3300012684|Ga0136614_10810341All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium653Open in IMG/M
3300012918|Ga0137396_10258078All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1286Open in IMG/M
3300012927|Ga0137416_11221585Not Available677Open in IMG/M
3300012944|Ga0137410_10721921All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium832Open in IMG/M
3300012951|Ga0164300_10427377Not Available736Open in IMG/M
3300012960|Ga0164301_10979023All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M14663Open in IMG/M
3300012960|Ga0164301_11358489Not Available579Open in IMG/M
3300012961|Ga0164302_10188079Not Available1257Open in IMG/M
3300012972|Ga0134077_10349520Not Available630Open in IMG/M
3300012976|Ga0134076_10497396All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium556Open in IMG/M
3300012982|Ga0168317_1064948Not Available869Open in IMG/M
3300012982|Ga0168317_1081988Not Available734Open in IMG/M
3300012986|Ga0164304_10161313Not Available1424Open in IMG/M
3300012988|Ga0164306_10394154All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M141039Open in IMG/M
3300012989|Ga0164305_10074717All Organisms → cellular organisms → Bacteria2085Open in IMG/M
3300012989|Ga0164305_10178130Not Available1472Open in IMG/M
3300012989|Ga0164305_10563573All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M14908Open in IMG/M
3300013102|Ga0157371_10887139All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria676Open in IMG/M
3300013296|Ga0157374_12369181All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium558Open in IMG/M
3300013307|Ga0157372_12489943All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria594Open in IMG/M
3300013503|Ga0120127_10028668Not Available1029Open in IMG/M
3300013768|Ga0120155_1134171Not Available677Open in IMG/M
3300013770|Ga0120123_1044744Not Available942Open in IMG/M
3300013770|Ga0120123_1120144All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium610Open in IMG/M
3300014052|Ga0120109_1070881All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium795Open in IMG/M
3300014498|Ga0182019_11135246All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium572Open in IMG/M
3300014829|Ga0120104_1015861Not Available1332Open in IMG/M
3300014968|Ga0157379_11705756All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M14617Open in IMG/M
3300015241|Ga0137418_10772717Not Available724Open in IMG/M
3300015372|Ga0132256_102975486Not Available570Open in IMG/M
3300016294|Ga0182041_12061644Not Available532Open in IMG/M
3300016341|Ga0182035_11273056Not Available658Open in IMG/M
3300016387|Ga0182040_11481265Not Available576Open in IMG/M
3300016422|Ga0182039_12109959Not Available519Open in IMG/M
3300016422|Ga0182039_12110749Not Available519Open in IMG/M
3300018027|Ga0184605_10090485Not Available1342Open in IMG/M
3300018029|Ga0187787_10116458All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium874Open in IMG/M
3300018032|Ga0187788_10101165All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1042Open in IMG/M
3300018056|Ga0184623_10067752All Organisms → cellular organisms → Bacteria1640Open in IMG/M
3300018071|Ga0184618_10050178All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1514Open in IMG/M
3300018468|Ga0066662_10950797All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium847Open in IMG/M
3300018468|Ga0066662_11528399All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium695Open in IMG/M
3300018482|Ga0066669_10071293All Organisms → cellular organisms → Bacteria2297Open in IMG/M
3300019767|Ga0190267_10729439All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium644Open in IMG/M
3300019875|Ga0193701_1059471All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M14764Open in IMG/M
3300020070|Ga0206356_10056882All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium667Open in IMG/M
3300020080|Ga0206350_10228991Not Available1109Open in IMG/M
3300020081|Ga0206354_11444095All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium563Open in IMG/M
3300020082|Ga0206353_11466234All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium652Open in IMG/M
3300024222|Ga0247691_1056488Not Available592Open in IMG/M
3300024288|Ga0179589_10455142Not Available591Open in IMG/M
3300025441|Ga0208456_1035926All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium995Open in IMG/M
3300025460|Ga0208562_1028071All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1313Open in IMG/M
3300025764|Ga0209539_1029373All Organisms → cellular organisms → Bacteria2445Open in IMG/M
3300025909|Ga0207705_11494121Not Available512Open in IMG/M
3300025913|Ga0207695_10443708All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1181Open in IMG/M
3300025916|Ga0207663_11595576All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium525Open in IMG/M
3300025919|Ga0207657_10715888All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria777Open in IMG/M
3300025921|Ga0207652_10906224Not Available779Open in IMG/M
3300025921|Ga0207652_11170749All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium670Open in IMG/M
3300025927|Ga0207687_10979103All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium725Open in IMG/M
3300025928|Ga0207700_11767321All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria544Open in IMG/M
3300025929|Ga0207664_10848018Not Available821Open in IMG/M
3300025934|Ga0207686_11162591All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M14631Open in IMG/M
3300025944|Ga0207661_11638966All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium588Open in IMG/M
3300026022|Ga0208649_1006289All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium925Open in IMG/M
3300026041|Ga0207639_11552233Not Available621Open in IMG/M
3300026078|Ga0207702_12102351All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria554Open in IMG/M
3300026116|Ga0207674_11420795All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium663Open in IMG/M
3300026312|Ga0209153_1003811All Organisms → cellular organisms → Bacteria4756Open in IMG/M
3300026313|Ga0209761_1203444All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M14865Open in IMG/M
3300026530|Ga0209807_1043067All Organisms → cellular organisms → Bacteria2117Open in IMG/M
3300026548|Ga0209161_10467479Not Available556Open in IMG/M
3300026550|Ga0209474_10181609All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M141353Open in IMG/M
3300026552|Ga0209577_10192340All Organisms → cellular organisms → Bacteria1573Open in IMG/M
3300027371|Ga0209418_1048268All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium755Open in IMG/M
3300027691|Ga0209485_1129353All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium738Open in IMG/M
3300027842|Ga0209580_10403282All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium682Open in IMG/M
3300027846|Ga0209180_10724360All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium539Open in IMG/M
3300027875|Ga0209283_10401090All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria894Open in IMG/M
3300027876|Ga0209974_10412911All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium531Open in IMG/M
3300027882|Ga0209590_10848744All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M14578Open in IMG/M
3300028708|Ga0307295_10047494All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1104Open in IMG/M
3300028718|Ga0307307_10064622All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1086Open in IMG/M
3300028720|Ga0307317_10310126All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M14533Open in IMG/M
3300028721|Ga0307315_10212075All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium602Open in IMG/M
3300028784|Ga0307282_10341334Not Available724Open in IMG/M
3300028811|Ga0307292_10103706All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1120Open in IMG/M
3300028819|Ga0307296_10698141All Organisms → cellular organisms → Bacteria554Open in IMG/M
3300028828|Ga0307312_10554862All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M14759Open in IMG/M
3300028885|Ga0307304_10154056Not Available960Open in IMG/M
3300030829|Ga0308203_1020723All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M14852Open in IMG/M
3300031249|Ga0265339_10437936Not Available608Open in IMG/M
3300031544|Ga0318534_10651701Not Available596Open in IMG/M
3300031680|Ga0318574_10813897Not Available547Open in IMG/M
3300031713|Ga0318496_10524005Not Available655Open in IMG/M
3300031795|Ga0318557_10267687Not Available783Open in IMG/M
3300031796|Ga0318576_10242924Not Available849Open in IMG/M
3300031820|Ga0307473_10955196Not Available623Open in IMG/M
3300031831|Ga0318564_10533223Not Available508Open in IMG/M
3300031890|Ga0306925_10797900All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M14980Open in IMG/M
3300031938|Ga0308175_100222579All Organisms → cellular organisms → Bacteria1875Open in IMG/M
3300031938|Ga0308175_102749194All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria550Open in IMG/M
3300031938|Ga0308175_103226474Not Available506Open in IMG/M
3300031996|Ga0308176_12105234All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium603Open in IMG/M
3300032001|Ga0306922_10174334Not Available2305Open in IMG/M
3300032008|Ga0318562_10111837All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1556Open in IMG/M
3300032009|Ga0318563_10065722All Organisms → cellular organisms → Bacteria1878Open in IMG/M
3300032044|Ga0318558_10209206Not Available953Open in IMG/M
3300032067|Ga0318524_10018611All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium3070Open in IMG/M
3300032090|Ga0318518_10456069Not Available655Open in IMG/M
3300032892|Ga0335081_11929873Not Available633Open in IMG/M
3300032897|Ga0335071_10383524Not Available1359Open in IMG/M
3300032955|Ga0335076_10099907All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2831Open in IMG/M
3300033803|Ga0314862_0037237Not Available1017Open in IMG/M
3300034268|Ga0372943_0374312All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium915Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil16.94%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil9.92%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil8.68%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil6.61%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil5.37%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere3.31%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost3.72%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil2.89%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere2.89%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil2.07%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil2.07%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil1.65%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil1.65%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere1.65%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil1.65%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere1.65%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere1.65%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.24%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.24%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.24%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.24%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.24%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere1.24%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland0.83%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.83%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.83%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.83%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil0.83%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil0.83%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil0.83%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.83%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.83%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.83%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.83%
Weathered Mine TailingsEnvironmental → Terrestrial → Geologic → Mine → Unclassified → Weathered Mine Tailings0.83%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.83%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.83%
GroundwaterEnvironmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater0.41%
Polar Desert SandEnvironmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand0.41%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil0.41%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.41%
PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland0.41%
FenEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Fen0.41%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.41%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.41%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand0.41%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere0.41%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.41%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.41%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.41%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere0.41%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.41%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere0.41%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2124908045Soil microbial communities from Great Prairies - Kansas assembly 1 01_01_2011EnvironmentalOpen in IMG/M
2170459005Grass soil microbial communities from Rothamsted Park, UK - July 2009 direct MP BIO1O1 lysis 0-21cmEnvironmentalOpen in IMG/M
2170459008Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect DNA Tissue lysis 0-10cmEnvironmentalOpen in IMG/M
2228664022Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300001380Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW37 contaminated, 5.8 mEnvironmentalOpen in IMG/M
3300002347Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-1 deep-072012 (NGEE Surface samples 415 (1, 2, 3 deep-072012) AP id is 1030520, ASSEMBLY_DATE=20131219)EnvironmentalOpen in IMG/M
3300002568Grasslands soil microbial communities from Hopland, California, USA - 2EnvironmentalOpen in IMG/M
3300004081Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2)EnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005146Soil and rhizosphere microbial communities from Laval, Canada - mgHABEnvironmentalOpen in IMG/M
3300005167Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121EnvironmentalOpen in IMG/M
3300005181Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127EnvironmentalOpen in IMG/M
3300005187Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005339Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaGHost-AssociatedOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005518Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaGEnvironmentalOpen in IMG/M
3300005526Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1EnvironmentalOpen in IMG/M
3300005529Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1EnvironmentalOpen in IMG/M
3300005535Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaGEnvironmentalOpen in IMG/M
3300005544Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaGEnvironmentalOpen in IMG/M
3300005556Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156EnvironmentalOpen in IMG/M
3300005558Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147EnvironmentalOpen in IMG/M
3300005561Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148EnvironmentalOpen in IMG/M
3300005569Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154EnvironmentalOpen in IMG/M
3300005578Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2Host-AssociatedOpen in IMG/M
3300005587Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103EnvironmentalOpen in IMG/M
3300005598Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155EnvironmentalOpen in IMG/M
3300005614Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005901Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_80N_201EnvironmentalOpen in IMG/M
3300006163Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaGEnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006237Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)Host-AssociatedOpen in IMG/M
3300006573Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAC (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006800Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109EnvironmentalOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006903Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5Host-AssociatedOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300007265Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1EnvironmentalOpen in IMG/M
3300009088Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaGEnvironmentalOpen in IMG/M
3300009090Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaGEnvironmentalOpen in IMG/M
3300009093Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaGHost-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009789Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28EnvironmentalOpen in IMG/M
3300009801Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_20_30EnvironmentalOpen in IMG/M
3300010036Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26EnvironmentalOpen in IMG/M
3300010038Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106EnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010088Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_5_24_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010166Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27EnvironmentalOpen in IMG/M
3300010326Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300010896Grasslands soil microbial communities from Angelo Coastal Reserve, California, USA - 15_R_Wat_40_2_4_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300011270Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaGEnvironmentalOpen in IMG/M
3300011399Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT842_2EnvironmentalOpen in IMG/M
3300011991Permafrost microbial communities from Nunavut, Canada - A34_65cm_12MEnvironmentalOpen in IMG/M
3300011994Permafrost microbial communities from Nunavut, Canada - A7_65cm_12MEnvironmentalOpen in IMG/M
3300012014Permafrost microbial communities from Nunavut, Canada - A10_80cm_6MEnvironmentalOpen in IMG/M
3300012096Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaGEnvironmentalOpen in IMG/M
3300012198Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012200Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012206Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012207Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaGEnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012224Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_4_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012349Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaGEnvironmentalOpen in IMG/M
3300012350Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012351Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012355Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaGEnvironmentalOpen in IMG/M
3300012356Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012357Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012358Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012359Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012360Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaGEnvironmentalOpen in IMG/M
3300012363Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaGEnvironmentalOpen in IMG/M
3300012373Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_0_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012383Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_4_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012385Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_4_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012393Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_0_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012399Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_24_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012401Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_16_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012403Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_8_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012407Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_16_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012410Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_16_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012684Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ279 (21.06)EnvironmentalOpen in IMG/M
3300012918Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaGEnvironmentalOpen in IMG/M
3300012927Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012944Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012951Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MGEnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300012961Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MGEnvironmentalOpen in IMG/M
3300012972Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300012976Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaGEnvironmentalOpen in IMG/M
3300012982Weathered mine tailings microbial communities from Hibbing, Minnesota, USA - DCWfieldEnvironmentalOpen in IMG/M
3300012986Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MGEnvironmentalOpen in IMG/M
3300012988Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300013102Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaGHost-AssociatedOpen in IMG/M
3300013296Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaGHost-AssociatedOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300013503Permafrost microbial communities from Nunavut, Canada - A23_5cm_12MEnvironmentalOpen in IMG/M
3300013768Permafrost microbial communities from Nunavut, Canada - A35_65cm_0MEnvironmentalOpen in IMG/M
3300013770Permafrost microbial communities from Nunavut, Canada - A15_5cm_18MEnvironmentalOpen in IMG/M
3300014052Permafrost microbial communities from Nunavut, Canada - A23_35cm_12MEnvironmentalOpen in IMG/M
3300014498Permafrost microbial communities from Stordalen Mire, Sweden - 812E2M metaGEnvironmentalOpen in IMG/M
3300014829Permafrost microbial communities from Nunavut, Canada - A10_35cm_6MEnvironmentalOpen in IMG/M
3300014968Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaGHost-AssociatedOpen in IMG/M
3300015241Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300016387Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176EnvironmentalOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300018027Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coexEnvironmentalOpen in IMG/M
3300018029Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP06_20_MGEnvironmentalOpen in IMG/M
3300018032Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP10_20_MGEnvironmentalOpen in IMG/M
3300018056Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1EnvironmentalOpen in IMG/M
3300018071Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1EnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300019767Populus adjacent soil microbial communities from riparian zone of Oak Creek, Arizona, USA - 239 TEnvironmentalOpen in IMG/M
3300019875Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3s2EnvironmentalOpen in IMG/M
3300020070Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300020080Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300020081Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300020082Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300024222Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK32EnvironmentalOpen in IMG/M
3300024288Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungalEnvironmentalOpen in IMG/M
3300025441Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_100 (SPAdes)EnvironmentalOpen in IMG/M
3300025460Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_150 (SPAdes)EnvironmentalOpen in IMG/M
3300025764Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0011-312 (SPAdes)EnvironmentalOpen in IMG/M
3300025909Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025913Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025919Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025921Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025927Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025934Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025944Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026022Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_80N_201 (SPAdes)EnvironmentalOpen in IMG/M
3300026041Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026078Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026116Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026312Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 (SPAdes)EnvironmentalOpen in IMG/M
3300026313Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes)EnvironmentalOpen in IMG/M
3300026530Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 (SPAdes)EnvironmentalOpen in IMG/M
3300026548Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes)EnvironmentalOpen in IMG/M
3300026550Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes)EnvironmentalOpen in IMG/M
3300026552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes)EnvironmentalOpen in IMG/M
3300027371Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM2H0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027691Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 (SPAdes)EnvironmentalOpen in IMG/M
3300027842Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027846Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027875Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027876Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes)Host-AssociatedOpen in IMG/M
3300027882Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300028708Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_152EnvironmentalOpen in IMG/M
3300028718Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_194EnvironmentalOpen in IMG/M
3300028720Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_357EnvironmentalOpen in IMG/M
3300028721Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_355EnvironmentalOpen in IMG/M
3300028784Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121EnvironmentalOpen in IMG/M
3300028811Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149EnvironmentalOpen in IMG/M
3300028819Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153EnvironmentalOpen in IMG/M
3300028828Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202EnvironmentalOpen in IMG/M
3300028885Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185EnvironmentalOpen in IMG/M
3300030829Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_357 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031249Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaGHost-AssociatedOpen in IMG/M
3300031544Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26EnvironmentalOpen in IMG/M
3300031680Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22EnvironmentalOpen in IMG/M
3300031713Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22EnvironmentalOpen in IMG/M
3300031795Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19EnvironmentalOpen in IMG/M
3300031796Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24EnvironmentalOpen in IMG/M
3300031820Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515EnvironmentalOpen in IMG/M
3300031831Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031938Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1EnvironmentalOpen in IMG/M
3300031996Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032008Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18EnvironmentalOpen in IMG/M
3300032009Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19EnvironmentalOpen in IMG/M
3300032044Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20EnvironmentalOpen in IMG/M
3300032067Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22EnvironmentalOpen in IMG/M
3300032090Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22EnvironmentalOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M
3300032897Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5EnvironmentalOpen in IMG/M
3300032955Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5EnvironmentalOpen in IMG/M
3300033803Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_0_10EnvironmentalOpen in IMG/M
3300034268Forest soil microbial communities from Eldorado National Forest, California, USA - SNFC_MG_FRD_1.2EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
KansclcFeb2_071023802124908045SoilERVDTAVYTTAKREVSLRDEEFGGAIRLLDAMLAARQAA
E41_065546202170459005Grass SoilRLRDLRRRVDTAVYTTSNHEVSVREDGFPQALRLVDAILAARQAA
F48_080892802170459008Grass SoilPVVLGSAELRELRSIAETAVYSTANREVTSRREEFIGAVELVDAMLAARQAA
INPgaii200_056306122228664022SoilLGSQELRELRSRIHTAVYTTGNSEVTLRSEDGFNQAIRLVDAILESRQAA
INPhiseqgaiiFebDRAFT_10190622123300000364SoilLREHVDTAVYTTAKREVSLRDEDFGGAVRLLDAMLSARQAA*
INPhiseqgaiiFebDRAFT_10471428423300000364SoilSGELRDLRNRIAAAVYSTGNREVTLRTDEFAGAIRLVDAIVDARQAV*
JGI10216J12902_10270265013300000956SoilDTAVYTVANREVTLREEGFPQALRLVDAILAARRAA*
JGI10216J12902_11720981033300000956SoilLRRRIDTAVYTIANHEVSLREEGFPQALRLVDAIQSVRNGNGE*
JGI1356J14229_1017619013300001380GroundwaterLILGSQELRELRSRIHTAVYTTGSSEVTLRSEDGFPQAIRLVDAILEARQAA*
JGIcombinedJ26865_102106913300002347Arctic Peat SoilRIHTAVYTTGSSEVTLRSEDGFAQAIRLVDAILEARQAA*
C688J35102_11992744123300002568SoilLRGLVDTAVYTSAKREITLRNEEFRGAIKLVDAMLAARQAA*
Ga0063454_10014523813300004081SoilELRELRGQVDTAVYSTGNREVTLRGDEFQAALELVDAMLAARQAA*
Ga0062593_10179863013300004114SoilLRSRIHTAVYTVGSREVTLRSEDPFPEALRLVDAILEARQAA*
Ga0062594_10199038023300005093SoilELRDRIDTAVYTSARREVSLRDVDLTGALLLLDAMLAARQAA*
Ga0066817_101720523300005146SoilRRRVDTAVYTTSNHEVTLREDGFPQALRLVDAILAARQAA*
Ga0066672_1081495913300005167SoilLGSGELRELRSRIHTAVYTVGSREVTLRSEDPFPEALRLVDAILEARQAA*
Ga0066678_1064896313300005181SoilRGRIDTAVYSTGNREVSLRHDSFGGAIELVDAILAARQAA*
Ga0066675_1141629523300005187SoilELRELRSQVETAVYSTGNREVTLRRDEFRSALDLVDAMLAARQAA*
Ga0066388_10371105613300005332Tropical Forest SoilVLGSGELRLLRGAIDTAVYSTANREITLRSDSFAGAASLIDAILAARQAA*
Ga0070660_10174519223300005339Corn RhizosphereRSRIHTAVYTVGSREVTLRSEDPFPEALRLVDAILEARQAA*
Ga0070709_1160922423300005434Corn, Switchgrass And Miscanthus RhizosphereLRRDVETAVYTTARREVTVRGEEFGEALRLVDAILDARQAA*
Ga0070709_1176413213300005434Corn, Switchgrass And Miscanthus RhizosphereRALRDEVDTAVYSTAKREVSFRSEEFGGAIRLLYAMLSARQAA*
Ga0070714_10189966323300005435Agricultural SoilVGKLVLGSGELKELRDRIHTAVYTVGMSEVSLRSEDGFPQALRLVDAILEARQAA*
Ga0070713_10240133413300005436Corn, Switchgrass And Miscanthus RhizosphereLVLGSGELKELRSRIHTAVYTTGNQEVTLRSEQGFPQALRLVDAIVEARQAA*
Ga0070699_10193218613300005518Corn, Switchgrass And Miscanthus RhizosphereERIRTAVYSVSSREVALRGEDGFTQALALVDAILEARQAA*
Ga0073909_1040554323300005526Surface SoilRVDTAVYSTGNREITLREDGFPQALRLVDAILAARQAA*
Ga0070741_1062144313300005529Surface SoilREIDTAVYTTAKREVTLRDEELKGALRLVDAMLAARQAA*
Ga0070741_1119141413300005529Surface SoilIAETAVYSTANREVAARREEFSGALELVDAMLAARQAA*
Ga0070684_10018721933300005535Corn RhizosphereSRIHTAVYAVGNREVSLRSQEFPQALGLVDAILEARQAA*
Ga0070686_10088354713300005544Switchgrass RhizosphereGELRELRSQVETAVYSTGNREITLRGDKFQGAVDLVDAMLAARQAA*
Ga0066707_1066369523300005556SoilLVLGSGELRTLRGRIDTAVYSTGNREVSLRDDSFTGAIGLVDAILAARQAA*
Ga0066698_1076217913300005558SoilREQIDTAVYTTAKREVSLRHEELGGALRLLDAMLAARQAA*
Ga0066698_1095110723300005558SoilIHTAVYTVGAREVSLRSEDGFPQAIRLVDAILEARQAA*
Ga0066698_1110131113300005558SoilELRSSVETAVYSTGNREVTLRHGEFAGALELVDAMLAARRAA*
Ga0066699_1068646013300005561SoilSRIHTAVYTVGAREVSLRSDDGFPQALRLVDAILDARRAG*
Ga0066705_1056368423300005569SoilAVYSVGMSEVSLRSDDGFPQAVRLVDAILEARQAI*
Ga0068854_10094314523300005578Corn RhizosphereVLGSGELRDLRAQVETAVYSTGNREVTLRGSEFQGALDLVDAMLAARQAA*
Ga0068854_10100933123300005578Corn RhizosphereTAVYSTGNREVTLRGDEFQGALDLVDAMLAARQAA*
Ga0066654_1029964423300005587SoilKELQELRGRIHTAVYTVGNREVSLRSEDGFPQALRLVDAILEARRAA*
Ga0066706_1141059523300005598SoilTAVYTVANREITLREQGFPQALRLVDAILAARQAA*
Ga0068856_10188041223300005614Corn RhizosphereKELHNRIHTAVYAVGNREVSLRSQEFPQALGLVDAILEARQAA*
Ga0068856_10199875113300005614Corn RhizosphereGSEELKELRGRIHTAVYTVGAREVSLRSEDGFPQALRLVDAILEARQAA*
Ga0066903_10132865633300005764Tropical Forest SoilRSLVDTAVYSTGLREVTLRGDELGGAIRLVDAMIAARAAA*
Ga0075274_100836623300005901Rice Paddy SoilELRDRIHTAVYTVGNREVSLRSQDGFPQALRLVDAILEARRAA*
Ga0070715_1105158223300006163Corn, Switchgrass And Miscanthus RhizosphereLGSGELRELRSAVETAVYSTGNREVTLRHTEFIGALDLVDAMLAARQAA*
Ga0070712_10083327213300006175Corn, Switchgrass And Miscanthus RhizosphereQVETAVYSTGNREVTLRGDEFTGALHLVDAMLAARQAA*
Ga0097621_10028649913300006237Miscanthus RhizosphereGSGELRELRSQVETAVYSTGNREITLRGDKFQGAVDLVDAMLAARQAA*
Ga0097621_10057590413300006237Miscanthus RhizosphereTAVYSTGNREVTLRHTEFIGALDLVDAMLAARQAA*
Ga0074055_1102902023300006573SoilLRELRSSVETAVYSSGNREVTLRHGEFKSALDLVDAMLAARQAA*
Ga0079222_1071749713300006755Agricultural SoilDTAVYSTAKREVSFRSEEFGGAIRLLDAMLSARQAA*
Ga0066660_1164070723300006800SoilGRIHTAVYTVGNREVSLRSEDGFPQALRLVDAILEARRAA*
Ga0066660_1169354723300006800SoilRRRVDTAVYTTANREVSLREEGFPQALRLVDAILAARQAA*
Ga0075433_1051110323300006852Populus RhizosphereLGSGELRDLRNRIAAAVYSTGNREVTLRTDEFAGAIRLVDAIVDARQAV*
Ga0075426_1035758613300006903Populus RhizosphereELRSLRNRVSTAVYTVANREITLREEGFPQALRLVDAILAARQAA*
Ga0079219_1145527613300006954Agricultural SoilELRELRERLDTAVYSSAKREVTLRHEELNGALNLVDAMLAARQAA*
Ga0099794_1039709323300007265Vadose Zone SoilTAVYTTGNHEVSLREEGFPQALRLVDAILAARQAA*
Ga0099830_1160697623300009088Vadose Zone SoilALRNRVSTAVYTVANREITLREEGFPQALRLVDAILAARQAA*
Ga0099827_1196192923300009090Vadose Zone SoilGELRALRNRVSTAVYTVANREITLREEGFPQALRLVDAILAARQAA*
Ga0105240_1014319143300009093Corn RhizosphereVDTAVYSTGNREVTLRGDEFQGALDLVDAMLAARQAA*
Ga0066709_10016738313300009137Grasslands SoilRVSTAVYTVANREVTLREEGFPQALRLVDAILAARQAA*
Ga0114129_1036563243300009147Populus RhizosphereGTAVYTTARKEVTVRGEEFGQALRLVDAILDARQAA*
Ga0114129_1190853713300009147Populus RhizosphereSTAVYTVANREITLREEGFPQALRLVDAILAARQAA*
Ga0105241_1136742123300009174Corn RhizosphereVLGSGELRDLRAQVETAVYSTGNREVTLRNSEFQGALDLVDAMLAARQAA*
Ga0105242_1190980713300009176Miscanthus RhizosphereVDTAVYTIANHEVSLREEGFPQALRLVDAILAARQAA*
Ga0126307_1023609213300009789Serpentine SoilRVETAVYATAKRELTLRDDEFAGAIRLVDAMIEARHAA*
Ga0105056_101742023300009801Groundwater SandDTAVYTTANHEVSLREEGFPAALRLVDAILAARQAA*
Ga0126305_1130559923300010036Serpentine SoilDLRRRVDTAVYSTGNREVTLREEGFPQALRLVDAILAARQAA*
Ga0126315_1009354513300010038Serpentine SoilELRELRNRVATAIYSTGNREITLRTDKFDGATRLVDAILDARQAA*
Ga0126384_1119623923300010046Tropical Forest SoilAVYTTANREVTLREGEIHGALKLVDAMLEARQAA*
Ga0127476_107650313300010088Grasslands SoilATVGKLVLGSGELRELRSRIHTAVYTVGSREVTLRSEDPFPEALRLVDAILEARQAA*
Ga0126306_1068082213300010166Serpentine SoilVDTAVYMTAKRAVSLRDDVFSGALRLVDAILQARQAA*
Ga0126306_1126010923300010166Serpentine SoilRELRSQVETAVYSTGNREVSLRHGEFDGALRLVDAMIAARQAA*
Ga0134065_1048505713300010326Grasslands SoilLGSEELKGLRGRIHTAVYAVGAREVSLRSEDGFPQAIRLVDAILETRQAA*
Ga0126379_1089612913300010366Tropical Forest SoilELRSRVDTAVYTTANREVTLREGEIHGALKLVDAMLEARQAA*
Ga0134125_1162707023300010371Terrestrial SoilELRELRSQVETAIYSSGNREVTLRLSEFTGALELVDAMLLARQAA*
Ga0126381_10199034313300010376Tropical Forest SoilRELRTSVETAVYSTGNREVTLRHAEFAGALELVDAMLAARQAA*
Ga0126383_1353765023300010398Tropical Forest SoilSGELRELRVRIDTAVYSTGNREITLRTGSFAGAAGLVDAILGARQTA*
Ga0134121_1288291723300010401Terrestrial SoilELRSAVETAVYSTGNREVTLRHSEFTGALDLVDAMLAARQAA*
Ga0138111_106903623300010896Grasslands SoilGSAELRDLRRRFDTAVYSTGNREITLREDGFPEALRLVDAILAARQAA*
Ga0137391_1026413033300011270Vadose Zone SoilVLGSGELRELRTSVETAVYSIGNREVTLRHGEFAGALDLVDAMLAARQAA*
Ga0137466_101382713300011399SoilSGELRELRNRVAAAVYSTGNREITFRTDEFSGATRLVDAILDARQAA*
Ga0120153_108510713300011991PermafrostYTVANHEVSLREEGFPQALRLVDAIQSVRAGNGA*
Ga0120157_104026313300011994PermafrostGELRELRAQVETAVYSSGNREVTLRHDEFGGALDLVDAMLLARQAA*
Ga0120159_105079813300012014PermafrostLRELRSRIHTAVYTVGSREVTLRSEDPFPEALRLVDAILEARQAA*
Ga0137389_1037457523300012096Vadose Zone SoilGELQELRDRIHTAVYAVANREVSLRSEDGFPQAIRLVDAILEARQAA*
Ga0137364_1014077613300012198Vadose Zone SoilLRRRIDTAVYSTGNREITLREDGFPQALRLVDAILAARQAA*
Ga0137364_1022748813300012198Vadose Zone SoilRRVETAVYSTGNRAIALRGDGFPQALRLVDAILAARQAA*
Ga0137364_1058092113300012198Vadose Zone SoilETAVYSTGNREVTLRHGEFAGALDLVDAMLAARQAA*
Ga0137382_1099862423300012200Vadose Zone SoilRELRTRIHTAVYTVGSREVTLRSEDPFPEALRLVDAILEARQAA*
Ga0137380_1121798313300012206Vadose Zone SoilTAVYTVANREITLREEGFPQALRLVDAILAARQAA*
Ga0137380_1158091113300012206Vadose Zone SoilIHTAVYTVGTSEVSLRSEDGFPQALRLVDAILESRRAA*
Ga0137381_1136242523300012207Vadose Zone SoilSGELQELRNRIHTAVYTVGAREVSLRSEDGFPQALRLVDAILEARQAA*
Ga0137376_1093428933300012208Vadose Zone SoilVSTAVYTVANREVTLREEGFPQALRLVDAILAARQAA*
Ga0137376_1139288923300012208Vadose Zone SoilVETAVYSTGNREVTLRGDEFTGAVDLVDAMLAARQAA*
Ga0137378_1127385913300012210Vadose Zone SoilRDLRRRVDTAVYATSNHEVSLREDGFPQALRLVDAILAARQAA*
Ga0137377_1036438513300012211Vadose Zone SoilAVYSTGTREVTLRHGEFAGALDLVDAMLAARQAA*
Ga0137377_1169407413300012211Vadose Zone SoilDTAVYTTANREVSLREDGFPQALRLVDAILAARQAA*
Ga0150985_11101390113300012212Avena Fatua RhizosphereDRIHTAVYTVGNSEVTLRSQDGFPQALRLVDAILEARQAA*
Ga0134028_108468113300012224Grasslands SoilEQIDTAVYTTAKREVSLRHEELGGALRLLDAMLAARQAA*
Ga0134028_123772713300012224Grasslands SoilTAVYTVGSREVTLRSEDPFPEALRLVDAILEARQAA*
Ga0137387_1034336023300012349Vadose Zone SoilDLRRRVDTAVYTTANREVSLREDGFPQALRLVDAILAARQAA*
Ga0137387_1103680323300012349Vadose Zone SoilRDLRRRVDTAVYTTGNHEVSLREEGFPQALRLVDAILAARRAA*
Ga0137387_1131081013300012349Vadose Zone SoilGRIDTAVYSTGNREVSLRHDSFDGAIELVDAILAARQAA*
Ga0137372_1112055123300012350Vadose Zone SoilDLRRRVDTAVYTTANREISLREQGFPQALRLVDAILAARQAA*
Ga0137386_1074111613300012351Vadose Zone SoilNRVSTAVYTVANREITLREEGFSQALRLVDAILAARQAA*
Ga0137386_1115116113300012351Vadose Zone SoilELQELRDRIHTAVYAVANRDVSLRSEDGFPQAIRLVDAILEARQAA*
Ga0137369_1010561713300012355Vadose Zone SoilLVLGSGELRTLRSQIDTAVYSTAHREVTLRSDSFAGAASLVAAILAARQAA*
Ga0137369_1070401923300012355Vadose Zone SoilVDTAVYTTANREISLREDGFPQALRLVDAILAARQAA*
Ga0137371_1024301733300012356Vadose Zone SoilRIDTAVYSTGNREVSLRHDSFGGAIELVDAILAARQAA*
Ga0137384_1080177813300012357Vadose Zone SoilDRIDIAVYSSGNREITLRSDTFNGAVELVDAIVAARQAA*
Ga0137368_1011266613300012358Vadose Zone SoilVVLGSGELRELRSQIDTAVYSTGNREVTLRHGEFEGALRLVDAMIAARQAA*
Ga0137385_1096860813300012359Vadose Zone SoilSGELRALRNRVSTAVYTVANREITLREQGFPQALRLVDAILAARQAA*
Ga0137385_1112930613300012359Vadose Zone SoilSGELRALRSRVSTAVYTVANREITLREEGFPQALRLVDAILAARLAA*
Ga0137375_1050672913300012360Vadose Zone SoilELRSQIDTAVYSTGNREVTLRHGEFEGALRLVDAMIAARQAA*
Ga0137375_1078513513300012360Vadose Zone SoilLRELRERIDTAVYTSARREVSLRNVDLTGALGLLDAMLAARQAA*
Ga0137390_1077967523300012363Vadose Zone SoilGPLVLGSGELRTLRGRIDTAVYSTGNREVSLRDDSFTGAIGLVDAILAARQAA*
Ga0134042_108131213300012373Grasslands SoilVYAVGAREVSLRSEDGFPQALRLVDAILEARQAA*
Ga0134033_111949823300012383Grasslands SoilAVYSTGNREVTLRRDEFQSALDLVDAMLAARQAA*
Ga0134023_126514423300012385Grasslands SoilGELRELRSRIHTAVYTVGSREVTLRSEDPFPEALRLVDAILEARQAA*
Ga0134052_121009713300012393Grasslands SoilLRNRIHTAVYTVGAREVSLRSEDGFPQAIRLVDAILEARQAA*
Ga0134061_109968923300012399Grasslands SoilVDTAVYTTGNHEVSLREEGFPQALRLVDAILAARQAA*
Ga0134055_138248723300012401Grasslands SoilVYTVGAREVSLRSEDGFPQASRLVDAILEARQAA*
Ga0134049_125201413300012403Grasslands SoilRIHTAVYTVGSREVTLRSEDPFPEALRLVDAILEARQAA*
Ga0134050_143440713300012407Grasslands SoilSTAVYTVANREITLRGEGFPQALRLVDAILAARRAA*
Ga0134060_118175913300012410Grasslands SoilLRDLRRRVETAVYTTANREVSLREDGFPQALRLVDAILAARQAA*
Ga0150984_10546807713300012469Avena Fatua RhizosphereAVYSTGNREVTLRNDEFKGALDLVDAMLLARQAA*
Ga0136614_1081034123300012684Polar Desert SandVVGPMVLGSGELRELRNRIAAAVYSTGNREITFRTDEFSGATRLVDAILDARQAA*
Ga0137396_1025807823300012918Vadose Zone SoilGKLVLGSGELRELRSRIHTAVYTVGSREVTLRSEDPFPEALRLVDAILEARQAA*
Ga0137416_1122158523300012927Vadose Zone SoilTAVYTSARREVSLRDIDLTGALGLLDAMLAARQAA*
Ga0137410_1072192113300012944Vadose Zone SoilRIHTAVYTVGNQEVALRGDDGFPQAIRLVDAILEARQAA*
Ga0164300_1042737713300012951SoilTAVYSSGNREVTLRGDEFTGALDLVDAMLLARQAA*
Ga0164301_1097902313300012960SoilDTAVYTISNHEVSLREEGFPQALRLVDAILAARQAA*
Ga0164301_1135848923300012960SoilAVYTIANHEVSLREEGFPQALRLVDAIQTVRAGNGA*
Ga0164302_1018807933300012961SoilSSVETAVYSSGNREVTLRHGEFKSALDLVDAMLAARQAA*
Ga0134077_1034952013300012972Grasslands SoilSGELRELRSSVETAVYSTGNREVTLRHAEFAGALELVDAMLAARQAA*
Ga0134076_1049739613300012976Grasslands SoilNRVSTAVYTVANREITLREEGFPQALRLVDAILAARQAA*
Ga0168317_106494813300012982Weathered Mine TailingsGSGELRELRTRVETAVYSTGNREVTLRGDEFKGALDLVDAMLAARQAA*
Ga0168317_108198813300012982Weathered Mine TailingsLRDRIHSAVYSTGSSEVTLRSEDGFPQAIRLVDAILEARQAA*
Ga0164304_1016131333300012986SoilRELRGAVETAVYSTGNREVTLRHTEFIGALDLVDAMLAARQAA*
Ga0164306_1039415423300012988SoilRRRVDTAVYSTGNREITLREDGFPQALRLVDAILAARQAA*
Ga0164305_1007471743300012989SoilVETAVYSTGNREVTLRHAEFAGALELVDAMLAARQAA*
Ga0164305_1017813033300012989SoilVLGSGELRELRGSVETAVYSIGNREVSLRHAEFAGALELVDAMLAARQAA*
Ga0164305_1056357313300012989SoilKELRSRIHTAVYTTGNQEVTLRSEQGFPQALRLVDAIVEARQAA*
Ga0157371_1088713913300013102Corn RhizosphereKELHSRIHTAVYAVGNREVSLRSQEFPQALGLVDAILEARQAA*
Ga0157374_1236918113300013296Miscanthus RhizosphereVETAVYSTGNREVTLRGSEFQGALDLVDAMLAARQAA*
Ga0157372_1248994313300013307Corn RhizosphereRIHTAVYAVGNRAVSLRSQEFRQARGLVDAILEARQAA*
Ga0120127_1002866813300013503PermafrostVDRQAIRIEQELKELRSRIHTAVYTTGSSEVTLRSEDGFPQAIRLVDAILEAREAA*
Ga0120155_113417113300013768PermafrostLGSGELRELRAQVETAVYSSGNREVTLRHDEFGGALDLVDAMLLARQAA*
Ga0120123_104474413300013770PermafrostSVETAVYSTGNREVTLRHGEFAGALDLVDAMLAARQAA*
Ga0120123_112014423300013770PermafrostVLGSGELRELRASVETAVYSIGNREVTLRHGEFAGALDLVDAMLA
Ga0120109_107088123300014052PermafrostVAGELRELRASVETAVYSTGNREVTLRHGEFAGALDLVDAMLAARQAA*
Ga0182019_1113524623300014498FenQVETAVYSTGNREVTLRGDEFKGALDLVDAMLAARQAA*
Ga0120104_101586133300014829PermafrostTAVYSTGNREVTLRHGEFAGALDLVDAMLAARQAA*
Ga0157379_1170575613300014968Switchgrass RhizosphereTAVYTIANHEVSLREEGFPQALRLVDAILAARQAA*
Ga0137418_1077271723300015241Vadose Zone SoilAVYSTGNREVTLRGDKFTGALDLVDAMLAARQAA*
Ga0132256_10297548623300015372Arabidopsis RhizosphereRELRSRIATAVYPTGHREITLRSESFAGATSLIDAILAARQAA*
Ga0182041_1206164413300016294SoilGELRALRSLVDTAVYSTAQREVTLREGELGGAIRLVDAMMAARTAA
Ga0182035_1127305613300016341SoilLRSRAETAVYSTANREVTSRRDEFLGALELVDAMLAARQAA
Ga0182040_1148126513300016387SoilRGLIDTAVYSSGAREVSLRHGEFKAALDLVDAMLAARRAA
Ga0182039_1210995923300016422SoilAELRELRGLIDTAVYSSGAREVSLRHGEFKAALDLVDAMLAARRAA
Ga0182039_1211074913300016422SoilALRSEIDTAVYSTGQREVTLRTDELAGGIRLLQAMVAARAAG
Ga0184605_1009048533300018027Groundwater SedimentTAVYTTAKREVSLRHEQLGGALRLLDAMLVARQAA
Ga0187787_1011645813300018029Tropical PeatlandTAVYTVGNREVSLRGEDGFPQALRLVDAILEARQAA
Ga0187788_1010116513300018032Tropical PeatlandELRGRIHTAVYTVGNREVSLRSEDGFPQALRLVDAILESRRAA
Ga0184623_1006775213300018056Groundwater SedimentRRVDTAVYTTANREVSLREEGFPQALRLVDAILAARLAA
Ga0184618_1005017833300018071Groundwater SedimentAVYTIANHEVSLREEGFPQALRLVDAIQSVRAGNGN
Ga0066662_1095079713300018468Grasslands SoilRSRIHTAVYTVGAREVTLRSEDPFPQALRLVDAILEARQAA
Ga0066662_1152839923300018468Grasslands SoilDTAIYTSATREITLRNEEFGEALRLVDAILGARQAA
Ga0066669_1007129313300018482Grasslands SoilAVYTVGSREVTLRSEDPFPEALRLVDAILEARQAA
Ga0190267_1072943923300019767SoilVVGPMVLGSAELRELRNRVAAAVYSTGNREITFRTDEFSGATRLVDAILDARQAA
Ga0193701_105947123300019875SoilRRVDTAVYTTTNHEVSLREDGFPQALRLVDAILAARQAA
Ga0206356_1005688213300020070Corn, Switchgrass And Miscanthus RhizosphereDLRAQVETAVYSTGNREVSLRGSEFQGALDLVDAMLAARQAA
Ga0206350_1022899113300020080Corn, Switchgrass And Miscanthus RhizosphereRTEVETAVYSTGNREVTQRLNEFTGALDLVDAMLAARQAA
Ga0206354_1144409523300020081Corn, Switchgrass And Miscanthus RhizosphereGELRELRQQKETAVYSTGNREVTLRGDEFAQALELVDAMLAARQAA
Ga0206353_1146623423300020082Corn, Switchgrass And Miscanthus RhizosphereRDLRAQVETAVYSTGNREVTLRNSEFRGALDLVAAMLAARQAA
Ga0247691_105648813300024222SoilELRAQVETAVYSTGNREVTLRGDEFTGALHLVDAMLAARQAA
Ga0179589_1045514223300024288Vadose Zone SoilTAVYTTSSSEVTLRGDELTQAVQLVDAILESRQAA
Ga0208456_103592623300025441PeatlandGRIHTAVYTVGNREVSLRGEDGFPQALRLVDAILEARQAA
Ga0208562_102807133300025460PeatlandRLVLGSQELKELRGRIHTAVYTVGNREVSLRGEDGFPQALRLVDAILEARQAA
Ga0209539_102937343300025764Arctic Peat SoilTAVYTTGSSEVTLRSEDGFAQAIRLVDAILEARQAA
Ga0207705_1149412113300025909Corn RhizosphereQVETAVYSTGNREVSLRNDEFKGALDLVDAMLAARQAA
Ga0207695_1044370813300025913Corn RhizosphereELQELRGRIHTAVYTVGNREVSLRSEDGFPQALRLVDAILEARRAA
Ga0207663_1159557613300025916Corn, Switchgrass And Miscanthus RhizosphereRDLRAQVETAVYSTGNREVTLRGSEFQSALDLVDAMLAARQAA
Ga0207657_1071588823300025919Corn RhizosphereGELKELRSRIHTAVYTTGNQEVTLRSEQGFPQALRLVDAIVEARQAA
Ga0207652_1090622413300025921Corn RhizosphereQVETAVYSTGNREVTLRNSEFQGALDLVAAMLAARQAA
Ga0207652_1117074923300025921Corn RhizosphereLRAQVDTAVYSTGNREVTLRGDEFQGALDLVDAMLAARQAA
Ga0207687_1097910323300025927Miscanthus RhizosphereSGELRDLRSQVETAVYSTGNREVTLRNSEFQGALDLVAAMLAARQAA
Ga0207700_1176732123300025928Corn, Switchgrass And Miscanthus RhizosphereVLGSGELQELRNRIHTAVYAVGNREVSLRSPEFPQALGLVDAILEARQAA
Ga0207664_1084801823300025929Agricultural SoilLGSGELRELRAQVETAVYSTGNREVTLRGDEFTGALHLVDAMLAARQAA
Ga0207686_1116259123300025934Miscanthus RhizosphereRVDTAVYTIANHEVSLREEGFPQALRLVDAILAARQAA
Ga0207661_1163896623300025944Corn RhizosphereGSGELRELRGAVDTAVYSTGNREVTLRHTEFIGALDLVDAMLAARQAA
Ga0208649_100628923300026022Rice Paddy SoilQELRDRIHTAVYTVGNREVSLRSQDGFPQALRLVDAILEARRAA
Ga0207639_1155223323300026041Corn RhizosphereGELRELRAQVETAVYSTGNREVTLRGDEFAGALELVDAMLAARQAA
Ga0207702_1210235123300026078Corn RhizosphereLGSGELKELHNRIHTAVYAVGNREVSLRSQEFPQALGLVDAILEARQAA
Ga0207674_1142079523300026116Corn RhizosphereTAVYSTGNREVTLRIGEFRGALDLVAAMLAARQAA
Ga0209153_100381113300026312SoilELRSLRNRVSTAVYTVANREITLREEGFPQALRLVDAILAARQAA
Ga0209761_120344423300026313Grasslands SoilLRRRVDTAVYTTGNHEVSLREEGFPQALRLVDAILAARQAA
Ga0209807_104306743300026530SoilGKLVLGSGELSELRSRMHTAVYTVGSREVTLRSEDPFPEALRLVDAILEARQAA
Ga0209161_1046747913300026548SoilAVYTVGNREVSLRSEDGFPQALRLVDAILEARRAA
Ga0209474_1018160913300026550SoilDLRRRVDTAVYTTANREVSLREDGFPQALRLVDAILAARQAA
Ga0209577_1019234013300026552SoilELRELRSRIHTAVYTVGSREVTLRSEDPFPEALRLVDAILEARQAA
Ga0209418_104826813300027371Forest SoilKELQELRGRIHTAVYTVGNREVSLRSEDGFPQALRLVDAILEARRAA
Ga0209485_112935313300027691Agricultural SoilRNRVAAAVYSTGNREISFRTDEFSGATRLVDAILDARQAA
Ga0209580_1040328223300027842Surface SoilGSRELQELRDRIHTAVYTVGNREVSLRGDDGFPQALRLVDAILEARRAA
Ga0209180_1072436013300027846Vadose Zone SoilRGRIDTAVYSTGNREVSLRDDSFTGAIGLVDAILAARQAA
Ga0209283_1040109023300027875Vadose Zone SoilLRGRIDTAVYSTGNREVSLRDDSFTGAIGLVDAILAARQAA
Ga0209974_1041291123300027876Arabidopsis Thaliana RhizosphereGPMVLGSGELRELRNRVASAVYSTGNREITFRTDEFSGATRLVDAILDARQAA
Ga0209590_1084874413300027882Vadose Zone SoilRNRVSTAVYTVANREITLREEGFPHALRLVDAILAARQAA
Ga0307295_1004749413300028708SoilVDTAVYSTGNREVTLRHSEFTGALDLVDAMLAARQAA
Ga0307307_1006462213300028718SoilALRGEVDTAVYTTTRREVSLRGEDFSAATRLVDAILEARQAA
Ga0307317_1031012623300028720SoilVDTAVYSTGSREITLREDGFPQALRLVDAILAARQAA
Ga0307315_1021207513300028721SoilSGELRELRSAVETAVYSTGNREVTLRHSEFTGALDLVDAMLAARQAA
Ga0307282_1034133423300028784SoilGELRELRSRIHTAVYTVGSREVTLRSEDPFPEALRLVDAILEARQAA
Ga0307292_1010370613300028811SoilVLRSRIGTAVYSTANREVTLRSDSFGGAATLIDAILAARQAA
Ga0307296_1069814123300028819SoilAVYSTGNREITLREDGFPQALRLVDAIQAVRSGSGA
Ga0307312_1055486223300028828SoilVYTIANHEVSLREEGFPQALRLVDAIQSVRVGNGN
Ga0307304_1015405623300028885SoilGELRELRAQVETAVYSTGNREVTLRGDEFTGALDLVDAMLAARQAA
Ga0308203_102072323300030829SoilGTAVYTTSNHEVSLREDGFPQALRLVDAILAARQAA
Ga0265339_1043793613300031249RhizosphereSRIHTAVYTTGSSEVTLRSEDGFTQAIRLVDAILEARQAA
Ga0318534_1065170113300031544SoilSVELRELRSRIATAVYSTGHREITLRSDSFGGATSLIDAILAARKAA
Ga0318574_1081389713300031680SoilVLGSAELRELRSLAETAVYSTANREVTSRREEFIGAVELVDAMLAARQAA
Ga0318496_1052400523300031713SoilRLKTAVYTVAKQEVSLRSGDEFPGAVGLVDAILEARQAA
Ga0318557_1026768723300031795SoilLGSAELRELRSLAETAVYSTANREVTSRREEFIGAVELVDAMLAARQAA
Ga0318576_1024292423300031796SoilETAVYSTANREVTSRREEFIGAVELVDAMLAARQAA
Ga0307473_1095519623300031820Hardwood Forest SoilRELRSKIDTAVYTTAKREVTFRDEELTGALRLVDAMLAARQAA
Ga0318564_1053322323300031831SoilELRALRSLVDTAVYSTAQREVTLRDGELGGAIRLVDAMIAARAAA
Ga0306925_1079790013300031890SoilLRAQIDTAVYSTANREITLRSDSFGGAAALIDAILLASQAA
Ga0308175_10022257913300031938SoilRAEVETAVYSTGNREVTLRGDEFKRALDLVDAMLAARQAA
Ga0308175_10274919413300031938SoilVETAVYQSARREVSLRDEEFDGALRLVDAMLETRQAA
Ga0308175_10322647413300031938SoilRSRIHTAVYTVGSGEVSLRSDNGFPRAIRLVDAILEARQAA
Ga0308176_1210523413300031996SoilLRQQKETAVYSTGNREVTLRGDEFAQALELVDAMLAARQAA
Ga0306922_1017433443300032001SoilGSAELRELRSLAETAVYSTANREVTSRREEFIGAVELVDAMLAARQAA
Ga0318562_1011183733300032008SoilAELRELRSLAETAVYSTANREVTSRREEFIGAVELVDAMLAARQAA
Ga0318563_1006572213300032009SoilLRGLIDTAVYSSGAREVSLRHGEFKAALDLVDAMLAARRAA
Ga0318558_1020920623300032044SoilPVVLGSAELRELRSLAETAVYSTANREVTSRREEFIGAVELVDAMLAARQAA
Ga0318524_1001861113300032067SoilTAVYSTANREVTSRREEFIGAVELVDAMLAARQAA
Ga0318518_1045606913300032090SoilMGSGELRALRSLVDTAVYSTAQREVTLREGELGGAIRLVDAMMAARTAA
Ga0335081_1192987323300032892SoilTVGRLILGSQELKELRGRIHTAVYTVGNREVSLRGEDGFPQALRLVDAILEARQAA
Ga0335071_1038352413300032897SoilAQVETAVYSTGNREVTFRGDEFKEALDLVDAMLAARQAA
Ga0335076_1009990713300032955SoilLHTLRELVDTAVYSTAQREVSLRDDALEGAIRLVDAMIAARNAA
Ga0314862_0037237_866_10153300033803PeatlandMGSAELRELRGLIDTAVYSSGAREVSLRHSEFKAALDLVDAMLAARRAA
Ga0372943_0374312_781_9153300034268SoilKALKDRIHTAVYAVGNHEVTLRSDQGFGQALQLVDAIVDARQAA


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.