| Basic Information | |
|---|---|
| Family ID | F017059 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 243 |
| Average Sequence Length | 42 residues |
| Representative Sequence | MGRVVALMDDLFFQMKLAETAKQLGVEVKVATNGDALMGLM |
| Number of Associated Samples | 191 |
| Number of Associated Scaffolds | 243 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 99.59 % |
| % of genes near scaffold ends (potentially truncated) | 96.71 % |
| % of genes from short scaffolds (< 2000 bps) | 88.89 % |
| Associated GOLD sequencing projects | 180 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.62 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (99.588 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (20.165 % of family members) |
| Environment Ontology (ENVO) | Unclassified (31.276 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (49.383 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 30.43% β-sheet: 14.49% Coil/Unstructured: 55.07% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.62 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 243 Family Scaffolds |
|---|---|---|
| PF12867 | DinB_2 | 33.74 |
| PF05768 | Glrx-like | 27.57 |
| PF00291 | PALP | 4.53 |
| PF13620 | CarboxypepD_reg | 3.70 |
| PF00899 | ThiF | 1.23 |
| PF00150 | Cellulase | 0.82 |
| PF01619 | Pro_dh | 0.41 |
| PF05569 | Peptidase_M56 | 0.41 |
| PF13715 | CarbopepD_reg_2 | 0.41 |
| PF09360 | zf-CDGSH | 0.41 |
| PF04973 | NMN_transporter | 0.41 |
| PF02597 | ThiS | 0.41 |
| PF00990 | GGDEF | 0.41 |
| PF00069 | Pkinase | 0.41 |
| PF13439 | Glyco_transf_4 | 0.41 |
| PF04932 | Wzy_C | 0.41 |
| COG ID | Name | Functional Category | % Frequency in 243 Family Scaffolds |
|---|---|---|---|
| COG0695 | Glutaredoxin | Posttranslational modification, protein turnover, chaperones [O] | 27.57 |
| COG3118 | Chaperedoxin CnoX, contains thioredoxin-like and TPR-like domains, YbbN/TrxSC family | Posttranslational modification, protein turnover, chaperones [O] | 27.57 |
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 1.65 |
| COG2730 | Aryl-phospho-beta-D-glucosidase BglC, GH1 family | Carbohydrate transport and metabolism [G] | 0.82 |
| COG3934 | Endo-1,4-beta-mannosidase | Carbohydrate transport and metabolism [G] | 0.82 |
| COG0506 | Proline dehydrogenase | Amino acid transport and metabolism [E] | 0.41 |
| COG1977 | Molybdopterin synthase sulfur carrier subunit MoaD | Coenzyme transport and metabolism [H] | 0.41 |
| COG2104 | Sulfur carrier protein ThiS (thiamine biosynthesis) | Coenzyme transport and metabolism [H] | 0.41 |
| COG3201 | Nicotinamide riboside transporter PnuC | Coenzyme transport and metabolism [H] | 0.41 |
| COG3307 | O-antigen ligase | Cell wall/membrane/envelope biogenesis [M] | 0.41 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 99.59 % |
| Unclassified | root | N/A | 0.41 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000955|JGI1027J12803_101123014 | All Organisms → cellular organisms → Bacteria | 1086 | Open in IMG/M |
| 3300001082|JGI12664J13189_1012373 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 504 | Open in IMG/M |
| 3300001154|JGI12636J13339_1043729 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 564 | Open in IMG/M |
| 3300001431|F14TB_103789420 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
| 3300001593|JGI12635J15846_10857296 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 519 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100931389 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 752 | Open in IMG/M |
| 3300002916|JGI25389J43894_1095122 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300003372|JGI26336J50218_1000210 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 2685 | Open in IMG/M |
| 3300004091|Ga0062387_100701567 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 741 | Open in IMG/M |
| 3300004091|Ga0062387_100728717 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 729 | Open in IMG/M |
| 3300004635|Ga0062388_102918640 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 504 | Open in IMG/M |
| 3300005174|Ga0066680_10585020 | All Organisms → cellular organisms → Bacteria | 700 | Open in IMG/M |
| 3300005175|Ga0066673_10109772 | All Organisms → cellular organisms → Bacteria | 1492 | Open in IMG/M |
| 3300005180|Ga0066685_10122357 | All Organisms → cellular organisms → Bacteria | 1753 | Open in IMG/M |
| 3300005186|Ga0066676_10737905 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 670 | Open in IMG/M |
| 3300005445|Ga0070708_101372067 | All Organisms → cellular organisms → Bacteria | 660 | Open in IMG/M |
| 3300005454|Ga0066687_10000682 | All Organisms → cellular organisms → Bacteria | 9334 | Open in IMG/M |
| 3300005467|Ga0070706_101682743 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 578 | Open in IMG/M |
| 3300005557|Ga0066704_11051120 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 502 | Open in IMG/M |
| 3300005712|Ga0070764_10526392 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 713 | Open in IMG/M |
| 3300005764|Ga0066903_103495519 | All Organisms → cellular organisms → Bacteria | 847 | Open in IMG/M |
| 3300006034|Ga0066656_10079922 | All Organisms → cellular organisms → Bacteria | 1949 | Open in IMG/M |
| 3300006052|Ga0075029_100570816 | All Organisms → cellular organisms → Bacteria | 753 | Open in IMG/M |
| 3300006086|Ga0075019_10018102 | All Organisms → cellular organisms → Bacteria | 3935 | Open in IMG/M |
| 3300006163|Ga0070715_10565665 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 661 | Open in IMG/M |
| 3300006175|Ga0070712_100150756 | All Organisms → cellular organisms → Bacteria | 1785 | Open in IMG/M |
| 3300006176|Ga0070765_101110461 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 747 | Open in IMG/M |
| 3300006176|Ga0070765_101393444 | All Organisms → cellular organisms → Bacteria | 661 | Open in IMG/M |
| 3300006755|Ga0079222_10680626 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 808 | Open in IMG/M |
| 3300006806|Ga0079220_10911791 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 684 | Open in IMG/M |
| 3300006904|Ga0075424_101141632 | All Organisms → cellular organisms → Bacteria | 830 | Open in IMG/M |
| 3300007265|Ga0099794_10277036 | All Organisms → cellular organisms → Bacteria | 867 | Open in IMG/M |
| 3300009038|Ga0099829_10108618 | All Organisms → cellular organisms → Bacteria | 2168 | Open in IMG/M |
| 3300009038|Ga0099829_10793003 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 787 | Open in IMG/M |
| 3300009038|Ga0099829_11501614 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 556 | Open in IMG/M |
| 3300009088|Ga0099830_11017347 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 686 | Open in IMG/M |
| 3300009090|Ga0099827_10909259 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 762 | Open in IMG/M |
| 3300009143|Ga0099792_10865136 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 596 | Open in IMG/M |
| 3300009162|Ga0075423_12686659 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
| 3300009551|Ga0105238_12343062 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 569 | Open in IMG/M |
| 3300009553|Ga0105249_11076641 | All Organisms → cellular organisms → Bacteria | 874 | Open in IMG/M |
| 3300010047|Ga0126382_11489221 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
| 3300010048|Ga0126373_11616329 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 713 | Open in IMG/M |
| 3300010048|Ga0126373_12209887 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 611 | Open in IMG/M |
| 3300010048|Ga0126373_13036764 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
| 3300010159|Ga0099796_10520436 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300010325|Ga0134064_10219349 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 690 | Open in IMG/M |
| 3300010358|Ga0126370_10106452 | All Organisms → cellular organisms → Bacteria | 1953 | Open in IMG/M |
| 3300010359|Ga0126376_11766241 | All Organisms → cellular organisms → Bacteria | 655 | Open in IMG/M |
| 3300010359|Ga0126376_12072662 | All Organisms → cellular organisms → Bacteria | 612 | Open in IMG/M |
| 3300010361|Ga0126378_11291519 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 825 | Open in IMG/M |
| 3300010376|Ga0126381_103343260 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 632 | Open in IMG/M |
| 3300011269|Ga0137392_10430052 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1096 | Open in IMG/M |
| 3300011270|Ga0137391_10234046 | All Organisms → cellular organisms → Bacteria | 1594 | Open in IMG/M |
| 3300012096|Ga0137389_11688694 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 529 | Open in IMG/M |
| 3300012189|Ga0137388_11987581 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 510 | Open in IMG/M |
| 3300012198|Ga0137364_11015300 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 627 | Open in IMG/M |
| 3300012202|Ga0137363_10665842 | All Organisms → cellular organisms → Bacteria | 880 | Open in IMG/M |
| 3300012203|Ga0137399_10920062 | All Organisms → cellular organisms → Bacteria | 736 | Open in IMG/M |
| 3300012205|Ga0137362_10814252 | All Organisms → cellular organisms → Bacteria | 800 | Open in IMG/M |
| 3300012208|Ga0137376_10023937 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium | 4738 | Open in IMG/M |
| 3300012351|Ga0137386_10007099 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 7452 | Open in IMG/M |
| 3300012361|Ga0137360_10161927 | All Organisms → cellular organisms → Bacteria | 1784 | Open in IMG/M |
| 3300012361|Ga0137360_10263386 | All Organisms → cellular organisms → Bacteria | 1420 | Open in IMG/M |
| 3300012361|Ga0137360_10768262 | All Organisms → cellular organisms → Bacteria | 829 | Open in IMG/M |
| 3300012361|Ga0137360_11674910 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
| 3300012362|Ga0137361_10407159 | All Organisms → cellular organisms → Bacteria | 1249 | Open in IMG/M |
| 3300012362|Ga0137361_10464582 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium | 1162 | Open in IMG/M |
| 3300012362|Ga0137361_11907123 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 511 | Open in IMG/M |
| 3300012582|Ga0137358_10994177 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 543 | Open in IMG/M |
| 3300012683|Ga0137398_10995001 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 581 | Open in IMG/M |
| 3300012685|Ga0137397_10553780 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 856 | Open in IMG/M |
| 3300012685|Ga0137397_10909796 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 652 | Open in IMG/M |
| 3300012917|Ga0137395_10899442 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 640 | Open in IMG/M |
| 3300012922|Ga0137394_10145243 | All Organisms → cellular organisms → Bacteria | 2016 | Open in IMG/M |
| 3300012922|Ga0137394_10833874 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 772 | Open in IMG/M |
| 3300012924|Ga0137413_11109593 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 626 | Open in IMG/M |
| 3300012929|Ga0137404_10866415 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 823 | Open in IMG/M |
| 3300012929|Ga0137404_10971948 | All Organisms → cellular organisms → Bacteria | 776 | Open in IMG/M |
| 3300012961|Ga0164302_10340604 | All Organisms → cellular organisms → Bacteria | 998 | Open in IMG/M |
| 3300013306|Ga0163162_10636044 | All Organisms → cellular organisms → Bacteria | 1191 | Open in IMG/M |
| 3300013503|Ga0120127_10046593 | All Organisms → cellular organisms → Bacteria | 858 | Open in IMG/M |
| 3300014150|Ga0134081_10162604 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 739 | Open in IMG/M |
| 3300014166|Ga0134079_10177008 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 879 | Open in IMG/M |
| 3300014968|Ga0157379_12432027 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
| 3300015051|Ga0137414_1205954 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 946 | Open in IMG/M |
| 3300015053|Ga0137405_1336176 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4781 | Open in IMG/M |
| 3300015197|Ga0167638_1096736 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
| 3300015264|Ga0137403_11413152 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 544 | Open in IMG/M |
| 3300016404|Ga0182037_10082263 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2265 | Open in IMG/M |
| 3300016422|Ga0182039_10058313 | All Organisms → cellular organisms → Bacteria | 2668 | Open in IMG/M |
| 3300016422|Ga0182039_10321644 | All Organisms → cellular organisms → Bacteria | 1289 | Open in IMG/M |
| 3300016422|Ga0182039_10367630 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1212 | Open in IMG/M |
| 3300016445|Ga0182038_10570988 | All Organisms → cellular organisms → Bacteria | 973 | Open in IMG/M |
| 3300017930|Ga0187825_10055389 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1345 | Open in IMG/M |
| 3300017932|Ga0187814_10212422 | All Organisms → cellular organisms → Bacteria | 729 | Open in IMG/M |
| 3300017934|Ga0187803_10021494 | All Organisms → cellular organisms → Bacteria | 2573 | Open in IMG/M |
| 3300017955|Ga0187817_10075906 | All Organisms → cellular organisms → Bacteria | 2096 | Open in IMG/M |
| 3300017955|Ga0187817_10303515 | All Organisms → cellular organisms → Bacteria | 1018 | Open in IMG/M |
| 3300017955|Ga0187817_10857592 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 580 | Open in IMG/M |
| 3300017995|Ga0187816_10369712 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 635 | Open in IMG/M |
| 3300018006|Ga0187804_10005921 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3979 | Open in IMG/M |
| 3300018060|Ga0187765_10640077 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 691 | Open in IMG/M |
| 3300018086|Ga0187769_10667604 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 786 | Open in IMG/M |
| 3300018088|Ga0187771_11552735 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300018482|Ga0066669_10539746 | All Organisms → cellular organisms → Bacteria | 1015 | Open in IMG/M |
| 3300019786|Ga0182025_1215755 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1786 | Open in IMG/M |
| 3300020021|Ga0193726_1036194 | All Organisms → cellular organisms → Bacteria | 2419 | Open in IMG/M |
| 3300020170|Ga0179594_10399808 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 521 | Open in IMG/M |
| 3300020579|Ga0210407_10211207 | All Organisms → cellular organisms → Bacteria | 1509 | Open in IMG/M |
| 3300020580|Ga0210403_10977849 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 663 | Open in IMG/M |
| 3300020580|Ga0210403_11108362 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 614 | Open in IMG/M |
| 3300020581|Ga0210399_11595250 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 503 | Open in IMG/M |
| 3300020583|Ga0210401_10019944 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 6446 | Open in IMG/M |
| 3300021168|Ga0210406_10162858 | All Organisms → cellular organisms → Bacteria | 1868 | Open in IMG/M |
| 3300021181|Ga0210388_11631676 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 535 | Open in IMG/M |
| 3300021402|Ga0210385_10172151 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1561 | Open in IMG/M |
| 3300021403|Ga0210397_11182548 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 594 | Open in IMG/M |
| 3300021404|Ga0210389_10469015 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 991 | Open in IMG/M |
| 3300021420|Ga0210394_10212767 | All Organisms → cellular organisms → Bacteria | 1687 | Open in IMG/M |
| 3300021420|Ga0210394_10387908 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1228 | Open in IMG/M |
| 3300021432|Ga0210384_10894681 | All Organisms → cellular organisms → Bacteria | 788 | Open in IMG/M |
| 3300021433|Ga0210391_10371070 | All Organisms → cellular organisms → Bacteria | 1123 | Open in IMG/M |
| 3300021476|Ga0187846_10137245 | All Organisms → cellular organisms → Bacteria | 1039 | Open in IMG/M |
| 3300021559|Ga0210409_11277035 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
| 3300022726|Ga0242654_10112041 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 870 | Open in IMG/M |
| 3300024178|Ga0247694_1037753 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 544 | Open in IMG/M |
| 3300024251|Ga0247679_1030540 | All Organisms → cellular organisms → Bacteria | 908 | Open in IMG/M |
| 3300024251|Ga0247679_1070026 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 588 | Open in IMG/M |
| 3300024323|Ga0247666_1088411 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 616 | Open in IMG/M |
| 3300025903|Ga0207680_11298055 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 518 | Open in IMG/M |
| 3300025916|Ga0207663_10464500 | All Organisms → cellular organisms → Bacteria | 978 | Open in IMG/M |
| 3300025916|Ga0207663_10480942 | Not Available | 962 | Open in IMG/M |
| 3300025921|Ga0207652_10099907 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2561 | Open in IMG/M |
| 3300025928|Ga0207700_11526578 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
| 3300025934|Ga0207686_11227172 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
| 3300025942|Ga0207689_11125440 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 662 | Open in IMG/M |
| 3300026298|Ga0209236_1250159 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 585 | Open in IMG/M |
| 3300026304|Ga0209240_1191444 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 618 | Open in IMG/M |
| 3300026304|Ga0209240_1214866 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
| 3300026310|Ga0209239_1050486 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1878 | Open in IMG/M |
| 3300026317|Ga0209154_1252946 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 608 | Open in IMG/M |
| 3300026318|Ga0209471_1181802 | All Organisms → cellular organisms → Bacteria | 827 | Open in IMG/M |
| 3300026322|Ga0209687_1041558 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1496 | Open in IMG/M |
| 3300026333|Ga0209158_1356676 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 509 | Open in IMG/M |
| 3300026480|Ga0257177_1041300 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 700 | Open in IMG/M |
| 3300026515|Ga0257158_1073966 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 652 | Open in IMG/M |
| 3300026515|Ga0257158_1112572 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
| 3300026528|Ga0209378_1256188 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 555 | Open in IMG/M |
| 3300026551|Ga0209648_10684512 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 560 | Open in IMG/M |
| 3300026557|Ga0179587_10200310 | All Organisms → cellular organisms → Bacteria | 1264 | Open in IMG/M |
| 3300026557|Ga0179587_10502434 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 795 | Open in IMG/M |
| 3300026557|Ga0179587_10565675 | All Organisms → cellular organisms → Bacteria | 747 | Open in IMG/M |
| 3300026824|Ga0207723_107812 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 863 | Open in IMG/M |
| 3300026859|Ga0207859_1020683 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 568 | Open in IMG/M |
| 3300026999|Ga0207949_1010538 | All Organisms → cellular organisms → Bacteria | 836 | Open in IMG/M |
| 3300027313|Ga0207780_1001370 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 6593 | Open in IMG/M |
| 3300027633|Ga0208988_1143784 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 576 | Open in IMG/M |
| 3300027643|Ga0209076_1059182 | All Organisms → cellular organisms → Bacteria | 1087 | Open in IMG/M |
| 3300027671|Ga0209588_1003500 | All Organisms → cellular organisms → Bacteria | 4363 | Open in IMG/M |
| 3300027680|Ga0207826_1004151 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3971 | Open in IMG/M |
| 3300027684|Ga0209626_1184950 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 552 | Open in IMG/M |
| 3300027703|Ga0207862_1106359 | All Organisms → cellular organisms → Bacteria | 843 | Open in IMG/M |
| 3300027737|Ga0209038_10240171 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 544 | Open in IMG/M |
| 3300027745|Ga0209908_10053450 | All Organisms → cellular organisms → Bacteria | 900 | Open in IMG/M |
| 3300027768|Ga0209772_10040884 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1366 | Open in IMG/M |
| 3300027768|Ga0209772_10121356 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 811 | Open in IMG/M |
| 3300027795|Ga0209139_10070758 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1224 | Open in IMG/M |
| 3300027812|Ga0209656_10023658 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3727 | Open in IMG/M |
| 3300027812|Ga0209656_10440735 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
| 3300027825|Ga0209039_10067364 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1592 | Open in IMG/M |
| 3300027825|Ga0209039_10339150 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 586 | Open in IMG/M |
| 3300027846|Ga0209180_10108826 | All Organisms → cellular organisms → Bacteria | 1583 | Open in IMG/M |
| 3300027846|Ga0209180_10228087 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1073 | Open in IMG/M |
| 3300027853|Ga0209274_10214613 | All Organisms → cellular organisms → Bacteria | 981 | Open in IMG/M |
| 3300027862|Ga0209701_10371638 | All Organisms → cellular organisms → Bacteria | 804 | Open in IMG/M |
| 3300027867|Ga0209167_10385887 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 763 | Open in IMG/M |
| 3300027875|Ga0209283_10063828 | All Organisms → cellular organisms → Bacteria | 2364 | Open in IMG/M |
| 3300027875|Ga0209283_10107092 | All Organisms → cellular organisms → Bacteria | 1832 | Open in IMG/M |
| 3300027908|Ga0209006_10317760 | All Organisms → cellular organisms → Bacteria | 1325 | Open in IMG/M |
| 3300027908|Ga0209006_10912298 | All Organisms → cellular organisms → Bacteria | 705 | Open in IMG/M |
| 3300027910|Ga0209583_10249201 | All Organisms → cellular organisms → Bacteria | 783 | Open in IMG/M |
| 3300027911|Ga0209698_10052602 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3562 | Open in IMG/M |
| 3300027911|Ga0209698_10426722 | All Organisms → cellular organisms → Bacteria | 1033 | Open in IMG/M |
| 3300028047|Ga0209526_10806085 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 581 | Open in IMG/M |
| 3300028065|Ga0247685_1030531 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 650 | Open in IMG/M |
| 3300028146|Ga0247682_1048794 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 762 | Open in IMG/M |
| 3300028789|Ga0302232_10562831 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
| 3300028792|Ga0307504_10472287 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 506 | Open in IMG/M |
| 3300028800|Ga0265338_10915919 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 596 | Open in IMG/M |
| 3300028801|Ga0302226_10299302 | All Organisms → cellular organisms → Bacteria | 678 | Open in IMG/M |
| 3300028808|Ga0302228_10156831 | All Organisms → cellular organisms → Bacteria | 1048 | Open in IMG/M |
| 3300028906|Ga0308309_10012427 | All Organisms → cellular organisms → Bacteria | 5364 | Open in IMG/M |
| 3300028906|Ga0308309_10144537 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1906 | Open in IMG/M |
| 3300028906|Ga0308309_10657546 | All Organisms → cellular organisms → Bacteria | 910 | Open in IMG/M |
| 3300028906|Ga0308309_10894643 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 771 | Open in IMG/M |
| 3300029636|Ga0222749_10010349 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3754 | Open in IMG/M |
| 3300031545|Ga0318541_10559726 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 640 | Open in IMG/M |
| 3300031679|Ga0318561_10582393 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 616 | Open in IMG/M |
| 3300031681|Ga0318572_10464001 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 754 | Open in IMG/M |
| 3300031720|Ga0307469_10490076 | All Organisms → cellular organisms → Bacteria | 1074 | Open in IMG/M |
| 3300031724|Ga0318500_10547644 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 584 | Open in IMG/M |
| 3300031748|Ga0318492_10509350 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 639 | Open in IMG/M |
| 3300031751|Ga0318494_10415257 | All Organisms → cellular organisms → Bacteria | 781 | Open in IMG/M |
| 3300031753|Ga0307477_10124911 | All Organisms → cellular organisms → Bacteria | 1795 | Open in IMG/M |
| 3300031754|Ga0307475_10050198 | All Organisms → cellular organisms → Bacteria | 3130 | Open in IMG/M |
| 3300031754|Ga0307475_10461206 | All Organisms → cellular organisms → Bacteria | 1021 | Open in IMG/M |
| 3300031754|Ga0307475_10728398 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 790 | Open in IMG/M |
| 3300031754|Ga0307475_10906246 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 696 | Open in IMG/M |
| 3300031768|Ga0318509_10074289 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1790 | Open in IMG/M |
| 3300031769|Ga0318526_10463984 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 517 | Open in IMG/M |
| 3300031777|Ga0318543_10286362 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 736 | Open in IMG/M |
| 3300031823|Ga0307478_10077582 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2528 | Open in IMG/M |
| 3300031833|Ga0310917_10685388 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 694 | Open in IMG/M |
| 3300031879|Ga0306919_11229205 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 569 | Open in IMG/M |
| 3300031912|Ga0306921_11750697 | All Organisms → cellular organisms → Bacteria | 670 | Open in IMG/M |
| 3300031912|Ga0306921_12051353 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 607 | Open in IMG/M |
| 3300031941|Ga0310912_10266619 | All Organisms → cellular organisms → Bacteria | 1321 | Open in IMG/M |
| 3300031941|Ga0310912_10507547 | All Organisms → cellular organisms → Bacteria | 940 | Open in IMG/M |
| 3300031942|Ga0310916_10772149 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 810 | Open in IMG/M |
| 3300031945|Ga0310913_10818405 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 656 | Open in IMG/M |
| 3300031946|Ga0310910_11158377 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 601 | Open in IMG/M |
| 3300031962|Ga0307479_11564192 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
| 3300032001|Ga0306922_10007245 | All Organisms → cellular organisms → Bacteria | 10696 | Open in IMG/M |
| 3300032001|Ga0306922_10666231 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1098 | Open in IMG/M |
| 3300032001|Ga0306922_10760638 | All Organisms → cellular organisms → Bacteria | 1015 | Open in IMG/M |
| 3300032054|Ga0318570_10058921 | All Organisms → cellular organisms → Bacteria | 1612 | Open in IMG/M |
| 3300032059|Ga0318533_10496201 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 895 | Open in IMG/M |
| 3300032174|Ga0307470_11264273 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
| 3300032180|Ga0307471_101538385 | All Organisms → cellular organisms → Bacteria | 823 | Open in IMG/M |
| 3300032180|Ga0307471_101679399 | All Organisms → cellular organisms → Bacteria | 789 | Open in IMG/M |
| 3300032180|Ga0307471_101715463 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 781 | Open in IMG/M |
| 3300032180|Ga0307471_102031558 | All Organisms → cellular organisms → Bacteria | 721 | Open in IMG/M |
| 3300032180|Ga0307471_102312458 | All Organisms → cellular organisms → Bacteria | 678 | Open in IMG/M |
| 3300032180|Ga0307471_103685798 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
| 3300032205|Ga0307472_100243461 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1404 | Open in IMG/M |
| 3300032205|Ga0307472_100464738 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1080 | Open in IMG/M |
| 3300032205|Ga0307472_101804158 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 607 | Open in IMG/M |
| 3300032205|Ga0307472_102535415 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 522 | Open in IMG/M |
| 3300032828|Ga0335080_10915296 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 898 | Open in IMG/M |
| 3300032893|Ga0335069_11243608 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 813 | Open in IMG/M |
| 3300033480|Ga0316620_10254157 | All Organisms → cellular organisms → Bacteria | 1508 | Open in IMG/M |
| 3300033977|Ga0314861_0346712 | All Organisms → cellular organisms → Bacteria | 660 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 20.16% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 17.70% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 7.82% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 4.94% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.94% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.53% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.12% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.70% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.29% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 3.29% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.88% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.88% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.47% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.06% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.23% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.23% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.23% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.23% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.23% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.41% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.41% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.41% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.41% |
| Thawing Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Thawing Permafrost | 0.41% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.41% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.41% |
| Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 0.41% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.41% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.41% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.41% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.41% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.41% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.41% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.41% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.41% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.82% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.82% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.82% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001082 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O3 | Environmental | Open in IMG/M |
| 3300001154 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 | Environmental | Open in IMG/M |
| 3300001431 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemly | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300002916 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm | Environmental | Open in IMG/M |
| 3300003372 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM1 | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
| 3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013503 | Permafrost microbial communities from Nunavut, Canada - A23_5cm_12M | Environmental | Open in IMG/M |
| 3300014150 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015051 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015197 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G6B, Proglacial plain, adjacent to northern proglacial tributary) | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017930 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5 | Environmental | Open in IMG/M |
| 3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
| 3300017934 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019786 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300020021 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c1 | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021476 | Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2) | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300022726 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300024178 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK35 | Environmental | Open in IMG/M |
| 3300024251 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK20 | Environmental | Open in IMG/M |
| 3300024323 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK07 | Environmental | Open in IMG/M |
| 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026298 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026317 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes) | Environmental | Open in IMG/M |
| 3300026318 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes) | Environmental | Open in IMG/M |
| 3300026322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 (SPAdes) | Environmental | Open in IMG/M |
| 3300026333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes) | Environmental | Open in IMG/M |
| 3300026480 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-07-B | Environmental | Open in IMG/M |
| 3300026515 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-03-A | Environmental | Open in IMG/M |
| 3300026528 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 (SPAdes) | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300026824 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 27 (SPAdes) | Environmental | Open in IMG/M |
| 3300026859 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 25 (SPAdes) | Environmental | Open in IMG/M |
| 3300026999 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF044 (SPAdes) | Environmental | Open in IMG/M |
| 3300027313 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 45 (SPAdes) | Environmental | Open in IMG/M |
| 3300027633 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027643 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027680 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 80 (SPAdes) | Environmental | Open in IMG/M |
| 3300027684 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027703 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 81 (SPAdes) | Environmental | Open in IMG/M |
| 3300027737 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027745 | Thawing permafrost microbial communities from the Arctic, studying carbon transformations - Permafrost 812P2M | Environmental | Open in IMG/M |
| 3300027768 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027795 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027825 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027910 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028065 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK26 | Environmental | Open in IMG/M |
| 3300028146 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK23 | Environmental | Open in IMG/M |
| 3300028789 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_3 | Environmental | Open in IMG/M |
| 3300028792 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S | Environmental | Open in IMG/M |
| 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Host-Associated | Open in IMG/M |
| 3300028801 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_3 | Environmental | Open in IMG/M |
| 3300028808 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_2 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
| 3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031769 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24 | Environmental | Open in IMG/M |
| 3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032054 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
| 3300033480 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D5_B | Environmental | Open in IMG/M |
| 3300033977 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - SJ75 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI1027J12803_1011230141 | 3300000955 | Soil | MGKVIALMDDLFFQMKLAETAKQLGVELKVATSGDALMGLMESN |
| JGI12664J13189_10123732 | 3300001082 | Forest Soil | MAEIVGLMDDLFFQMKVLETAKQLGLQFKVANTADSLMELIATSP |
| JGI12636J13339_10437293 | 3300001154 | Forest Soil | MGKVIALMDDLFFQMKLAETAKQLGVEVKVAANGDA |
| F14TB_1037894201 | 3300001431 | Soil | MPRVVAYMDDLFFQMKLAETAKHLGLEVKVASNAD |
| JGI12635J15846_108572962 | 3300001593 | Forest Soil | MAIVAALMDDLFFQMKVAETAKQLGLQLKVAANGEALLALLDS |
| JGIcombinedJ26739_1009313893 | 3300002245 | Forest Soil | MGRVVALMDDIFFQMKIAETAKHLGIEFKVATNTDA |
| JGI25389J43894_10951222 | 3300002916 | Grasslands Soil | MPRVVAYMDDLFFQMKLAETAKHLHIEVKVAASPDALLQLMDPLPKL |
| JGI26336J50218_10002106 | 3300003372 | Bog Forest Soil | MGRVVAMMDDLFFQMKVAETAKHLGLELKVASNGDALLGLLDPVPKL |
| Ga0062387_1007015672 | 3300004091 | Bog Forest Soil | MARIVALMDDLFFQMKVAETAKHLGLELKVASNADALLGL |
| Ga0062387_1007287173 | 3300004091 | Bog Forest Soil | MGKVVALMDDLFFQMKLAETAKQLGVEVKVATNGDAFLGLMAI |
| Ga0062388_1029186402 | 3300004635 | Bog Forest Soil | MGRVVALMDDLFFQMKVLETAKHLGLEFKVAGNADVLVGLLDPST |
| Ga0066680_105850203 | 3300005174 | Soil | MGRVVALMDDLFFQMKLAETAKQLGVEVKVATSGEALMGLLA |
| Ga0066673_101097721 | 3300005175 | Soil | MPRVVAYMDDLFFQMKLAETAKHLHVEVKVAARPDALLQPMD* |
| Ga0066685_101223571 | 3300005180 | Soil | MGRVVALMDDLFFQMKLAETAKQVGVEVKVAVNSEALMGLM |
| Ga0066676_107379051 | 3300005186 | Soil | MGRVVALMDDLFFQMKLAETAKQLGVEVKVATNGEALMGLMAAELRLVI |
| Ga0070708_1013720672 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MPRVVAYMDDLFFQMKLLETAKHLGVEVKVASNADSLLQLID |
| Ga0066687_1000068213 | 3300005454 | Soil | MGRVVALVDDLFFQMKLAETAKQLGVEVKVATNSDALAGLME |
| Ga0070706_1016827432 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MGRAVGFMDDLFFQMKIAETAKHLGVDFKVASTGEALMGMLDASTKLV |
| Ga0066704_110511201 | 3300005557 | Soil | MGRVVALVDDLFFQMKLAETAKQLGVEVKVAANGEALMGL |
| Ga0070764_105263922 | 3300005712 | Soil | MGRVAALIDDLFFQLKVAETAKQLGIEFKVASSPDA |
| Ga0066903_1034955192 | 3300005764 | Tropical Forest Soil | MQRVVAYMDDLFFQMKLAETAKRLGLEVKVAANADSLLELLEPPPLLVIV |
| Ga0066656_100799225 | 3300006034 | Soil | MGKVVALMDDLFFQMKLAETAKQLGVELKVATNGDALMGLIESN |
| Ga0075029_1005708161 | 3300006052 | Watersheds | MARAVGYMDDLFFQMKIAETAKQLGVEFKVASNPSGLNGLLEPPTK |
| Ga0075019_100181021 | 3300006086 | Watersheds | MGRVVALMDDLFFQMKLAETAKQLGVEVKVATNGEAFGELMASEPKLVI |
| Ga0070715_105656652 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | MGRAVGFMDDLFFQMKIAETAKHVGVDFMVASTGE |
| Ga0070712_1001507561 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MHRVVAYMDDLFFQMKLAETAKHLGLEVKVASNADSLLQLLDPVPALVIFDLN |
| Ga0070765_1011104612 | 3300006176 | Soil | MGRVVALMDDLFFQMKVAETARHLGVELKVATNGDALLTLLEPAPKLV |
| Ga0070765_1013934442 | 3300006176 | Soil | MERVVALIDDLFFQMKVAETAKHLGMELKVAANGDAL |
| Ga0079222_106806262 | 3300006755 | Agricultural Soil | MKDAESTMTRIVAMMDDLFFQMKVAETAKQLGLELKVAANGDALVGLLEPAPKLVIID |
| Ga0079220_109117911 | 3300006806 | Agricultural Soil | MGRVVALVDDLFFQMKLAETAKQLGVEVKVATNGDAL |
| Ga0075424_1011416321 | 3300006904 | Populus Rhizosphere | MPRVVAYMDDLFFQMKLAESAKHLGLEVKVASNADSLLQLLDPVP |
| Ga0099794_102770363 | 3300007265 | Vadose Zone Soil | MGKVVALMDDLFFQMKLAETAKLLGVEVKVATNGEAFMGLMASEPRLVI |
| Ga0099829_101086181 | 3300009038 | Vadose Zone Soil | MGKVVALMDDLFFQMKLAETAKQLGVEVKVATSGEALEGLMLS |
| Ga0099829_107930033 | 3300009038 | Vadose Zone Soil | MGRVVALMDDLFFQMKLAETAKQLGVEVKVATNGDVLMELMAS* |
| Ga0099829_115016142 | 3300009038 | Vadose Zone Soil | MDDLFFQMKLAETAKQLGVEVKVAANGEALMGLMASEP |
| Ga0099830_110173471 | 3300009088 | Vadose Zone Soil | MGRVVALMDDLFFQMKLAETAKQLGVEVKVATNGEAL |
| Ga0099827_109092592 | 3300009090 | Vadose Zone Soil | MGRVVALMDDLFFQMKLAETAKQLGVEVKVATNGE |
| Ga0099792_108651361 | 3300009143 | Vadose Zone Soil | MGRVVALMDDLFFQMKLAETAKQMGVEVKVATNGEALEGLMSS |
| Ga0075423_126866592 | 3300009162 | Populus Rhizosphere | MPRVVAYMDDLFFQMKLAETAKQLGVEAKVASNAES |
| Ga0105238_123430621 | 3300009551 | Corn Rhizosphere | MARVVALMDDLFFQMKVAETAKQLGMELKVAATADSLMQLLQM |
| Ga0105249_110766412 | 3300009553 | Switchgrass Rhizosphere | MPRVVAYMDDLFFQMKLAETAKHLGLEGEVGSNADSLLQL |
| Ga0126382_114892212 | 3300010047 | Tropical Forest Soil | MPRVVAYMDDLFFQMKLAETAKHLGLEVKVASNSD |
| Ga0126373_116163292 | 3300010048 | Tropical Forest Soil | MGRVAALIDDLFFQMKVAETAKHLGLEFKVASSPEAFTALLGPPT |
| Ga0126373_122098871 | 3300010048 | Tropical Forest Soil | MGRVVALVDDLFFQMKLAETAKQLGVEVKVATNGDALLGLMESAPKLVI |
| Ga0126373_130367641 | 3300010048 | Tropical Forest Soil | MPRVVAYMDDLFFQMKLAETAKHLHIEVRVATNPEALLQLMDPLPK |
| Ga0099796_105204361 | 3300010159 | Vadose Zone Soil | MDDLFFQMKLAETAKHLGVEVKVAATGEALQALLEPPPKLL |
| Ga0134064_102193492 | 3300010325 | Grasslands Soil | MSRVVALMDDLFFQMKLAETAKQLGVEVKVATNGDALM |
| Ga0126370_101064524 | 3300010358 | Tropical Forest Soil | MDDLFFQMKVAETAKQLGVEFKVASNGAVLATMLEPPTK |
| Ga0126376_117662412 | 3300010359 | Tropical Forest Soil | MPRVVAYVDDLFFQMKLAETAKHLHIEVKVAANPEAL |
| Ga0126376_120726621 | 3300010359 | Tropical Forest Soil | MTQVVALMDDLFFQMKLAETAKHLGVQVRVAANYDALAP |
| Ga0126378_112915191 | 3300010361 | Tropical Forest Soil | MGRVVALVDDLFFQMKLAETAKQLGVEVKVATNGDALVGLMENAPKL |
| Ga0126381_1033432601 | 3300010376 | Tropical Forest Soil | MGRVVVFVDDLFFQMKLAETAKQLGIEVKVAASEQALMGLMESAPK |
| Ga0137392_104300521 | 3300011269 | Vadose Zone Soil | MGRAIGLMDDLFFQMKVAETAKHLGVEFKVATNAEALLSLLDAPTKLLIVD |
| Ga0137391_102340461 | 3300011270 | Vadose Zone Soil | MGRVVALMDDLFFQMKLAETAKQLGVEVKVATSGEALEGLMLSEPKL |
| Ga0137389_116886941 | 3300012096 | Vadose Zone Soil | MGRVVALMDDLFFQMKLAETAKQLGVEVKVATTAEALLPLL |
| Ga0137388_119875811 | 3300012189 | Vadose Zone Soil | MGRVVALMDDLFFQMKLAETAKQLGVEVKVATNGEALAGLMASELKLVIVA |
| Ga0137364_110153003 | 3300012198 | Vadose Zone Soil | MARVVALMDDLFFQMKVAETAKHLGMELKVAATADSLMQLVEME |
| Ga0137363_106658421 | 3300012202 | Vadose Zone Soil | MDDLFFQMKLAETAKQLGVEVKVAANGEALMGLMTSDPKLVIV |
| Ga0137399_109200623 | 3300012203 | Vadose Zone Soil | MDDLFFQMKLAETAKQLGVEVKVATNAEALMGLMASD |
| Ga0137362_108142521 | 3300012205 | Vadose Zone Soil | MPRIVAYMDDLFFQMKLAETAKHLALEVRVASTAESL |
| Ga0137376_100239371 | 3300012208 | Vadose Zone Soil | MGRVVALMDDLFFQMKLAETAKQLGVEVKVATNGEALMGLMAAELRLV |
| Ga0137386_100070997 | 3300012351 | Vadose Zone Soil | MGRVVALMDDLFFQMKLAETAKQLGVEVKVAKNGEALMELMATEP |
| Ga0137360_101619271 | 3300012361 | Vadose Zone Soil | MLRIVAYMDDLFFQMKLAETAKHLGLEVKVASTAESLLQLLDPP |
| Ga0137360_102633861 | 3300012361 | Vadose Zone Soil | MGRVVALMDDLFFQMKLAETAKHLGVEVKVATTADALMPLLDSP |
| Ga0137360_107682621 | 3300012361 | Vadose Zone Soil | MGRVVALMDDLFFQMKLAETAKQLGVEVKVATNCEALMGLMASDPKL |
| Ga0137360_116749101 | 3300012361 | Vadose Zone Soil | MPRVVAYMDDLFFQMKLAETAKHLGLEVKVASNADSLMQLMEPLP |
| Ga0137361_104071593 | 3300012362 | Vadose Zone Soil | MDDLFFQMKLAETAKQLGVEVKVATNGEALMGLMESEP |
| Ga0137361_104645821 | 3300012362 | Vadose Zone Soil | MDDLFFQMKLAETAKHLGVEVKVAATPEALQALLEPPPKL |
| Ga0137361_119071231 | 3300012362 | Vadose Zone Soil | MGRVVALMDDLFFQMKLAETAKQMGVEVKVATNGEALE |
| Ga0137358_109941771 | 3300012582 | Vadose Zone Soil | MGRVIALMDDLFFQMKLAETAKQLGVEVKVATSGEALMGLM |
| Ga0137398_109950011 | 3300012683 | Vadose Zone Soil | MDDLFFQMKLAETAKQLGVEVKVATNGGALMELMATEAK |
| Ga0137397_105537801 | 3300012685 | Vadose Zone Soil | MGKVVALMDDLFFQMKLAETAKQLGVELKVAANGDALMGLMESNPRL |
| Ga0137397_109097962 | 3300012685 | Vadose Zone Soil | MDDLFFQMKLAETAKQLGVELKVATNGDALMGLIESNPKLVIVDLN |
| Ga0137395_108994423 | 3300012917 | Vadose Zone Soil | MDDLFFQMKLAETAKQLGVEVKVAANGEALMGLMTS |
| Ga0137394_101452431 | 3300012922 | Vadose Zone Soil | MGKVVALMDDLFFQMKLAETAKQLGVELKVATNGEALMDLMESH |
| Ga0137394_108338742 | 3300012922 | Vadose Zone Soil | MDDLFFQMKLAETAKQLGVELKVATNGDALMGLIESNPRLV |
| Ga0137413_111095932 | 3300012924 | Vadose Zone Soil | MGRVVALMDDLFFQMKLAETAKQVGVEVKVATNGEALMGLMAAELRLVIVD* |
| Ga0137404_108664151 | 3300012929 | Vadose Zone Soil | MGKVVALMDDLFFQMKMAETAKLLGVELKVATSGDALM |
| Ga0137404_109719483 | 3300012929 | Vadose Zone Soil | MGRVIALMDDLFFQMKLAETAKQLGVEVKVATSGEALMGLMTSE |
| Ga0164302_103406042 | 3300012961 | Soil | MPRVVAYMDDLFFQMKLAETAKHLGLEVKVASNADSLLQLLE |
| Ga0163162_106360442 | 3300013306 | Switchgrass Rhizosphere | MDDLFFQMKLAETAKHLGLEVKVASNADSLLQLLD |
| Ga0120127_100465931 | 3300013503 | Permafrost | MGRVIALMDDIFFQMKVAETAKHLGLEFKVATNVDALMSLLEPAPQL |
| Ga0134081_101626041 | 3300014150 | Grasslands Soil | MGRVVALVDDLFFQMKLAETAKHLGVEVKVATNGDALL |
| Ga0134079_101770082 | 3300014166 | Grasslands Soil | MGKVVALVDDLFFQMKLAETAKQLGLDVKVAANGDALMGLLES |
| Ga0157379_124320271 | 3300014968 | Switchgrass Rhizosphere | MPRVVAYMDDLFFQMKLAETAKHLGFEVKVASDADSLLELLESPPSLVIMD |
| Ga0137414_12059542 | 3300015051 | Vadose Zone Soil | MGRVVALMDDLFFQMKLAETAKQLGVEVKVATSGEALMGPDGE* |
| Ga0137405_13361765 | 3300015053 | Vadose Zone Soil | MGRVVALMDDLFFQMKLAETAKQLGVEVKVATSGRRWRDSC* |
| Ga0167638_10967362 | 3300015197 | Glacier Forefield Soil | MGRVIALMDDIFFQMKVAETAKHLGLEFKVATNVDAL |
| Ga0137403_114131522 | 3300015264 | Vadose Zone Soil | MGRVVALMDDLFFQMKLAETAKQLGVEVKVATSSEALEGLMLS |
| Ga0182037_100822631 | 3300016404 | Soil | MGRVVALVDDLFFQVKLAETAKQLGVEVKVAANGDALMGLMESA |
| Ga0182039_100583131 | 3300016422 | Soil | MGRVVALMDDLFFQMKVAETAKQLGVEFKVASNGAVLATM |
| Ga0182039_103216444 | 3300016422 | Soil | MGRVVALMDDLFFQMKVAETAKHLGMEFKVAANGDVL |
| Ga0182039_103676304 | 3300016422 | Soil | MGRVVALMDDLFFQMKVLETAKHVGVEFKVATTGEALMELLEPPTRLVIID |
| Ga0182038_105709883 | 3300016445 | Soil | MGRVVGLMDDLFFQMKVAETAKQLGVEFKVAANGDVLVTMLEPPTRLVIVDLNA |
| Ga0187825_100553894 | 3300017930 | Freshwater Sediment | MARIVAMMDDLFFQMKVSETAKHLGLELKVAANGDALLGLLDP |
| Ga0187814_102124222 | 3300017932 | Freshwater Sediment | MGRVVALMDDLFFQMKVAETAKHLGVEFKVAANPDVLATMLEPPT |
| Ga0187803_100214941 | 3300017934 | Freshwater Sediment | MARAVALMDDLFFQMKVAETAKQLGVEFKVATTSEAL |
| Ga0187817_100759061 | 3300017955 | Freshwater Sediment | MGRVVALMDDLFFQMKMAETAKHLGVELKVATNGEALMG |
| Ga0187817_103035151 | 3300017955 | Freshwater Sediment | MGRVVALMDDLFFQMKMAETAKQLGVELKVAANGDALMGLLES |
| Ga0187817_108575921 | 3300017955 | Freshwater Sediment | MGRVAALMDDLFFQMKVAETAKQLGLEFKVATSADALF |
| Ga0187816_103697121 | 3300017995 | Freshwater Sediment | MGRVVALLDDLFFQMKMAETAKQLGVELKVAANGDALMGLLESGPKLV |
| Ga0187804_100059218 | 3300018006 | Freshwater Sediment | MGRVVALMDDLFFQMKMAETAKQLGVELKVAANGDALM |
| Ga0187765_106400771 | 3300018060 | Tropical Peatland | MVCIVALMDDLFFQMKVAETAKHLNVEFKVATTTDALLRLLEP |
| Ga0187769_106676042 | 3300018086 | Tropical Peatland | MGRVVALMDDLFFQMKVAETAKHLGVEFKVAANGEVLS |
| Ga0187771_115527351 | 3300018088 | Tropical Peatland | MGRAVALMDDFFFQMKIAETAKQLGVELKVAATGEALL |
| Ga0066669_105397463 | 3300018482 | Grasslands Soil | MGRVVALMDDLFFQMKLAETAKQVGVEVKVAVNSEALMGLMASE |
| Ga0182025_12157552 | 3300019786 | Permafrost | MERVVALMDDIFFQMKVAETAKHLGLEFKVASNADALLGLLEPRPNW |
| Ga0193726_10361944 | 3300020021 | Soil | MGKVVALMDDLFFQMKVAETAKQLGVEFKVAANAEALLSALETSPQLVI |
| Ga0179594_103998082 | 3300020170 | Vadose Zone Soil | MGKVVALMDDLFFQMKLAETAKQLGVELKVATNGDALMHLMESQPKLV |
| Ga0210407_102112074 | 3300020579 | Soil | MGRVVALMDDLFFQMKLAETAKQLGMEVKVATNSDALLGL |
| Ga0210403_109778491 | 3300020580 | Soil | MGRVVALMDDLFFQMKLAETAKQLGVEVKVATNSDALLG |
| Ga0210403_111083622 | 3300020580 | Soil | MGRAVGFMDDLFFQMKIAETAKHVGVDFKVASTGEAL |
| Ga0210399_115952501 | 3300020581 | Soil | MARIVAMMDDLFFQMKVAETAKHLGLELKVATNGDAL |
| Ga0210401_100199446 | 3300020583 | Soil | MGRVAALIDDLFFQLKVAETAKQLGIEFKVASSPDALFTLLE |
| Ga0210406_101628585 | 3300021168 | Soil | MGRILAMMDDLFFQMKVAETAKHLGLELKVATNGDALLGLLEPAP |
| Ga0210388_116316761 | 3300021181 | Soil | MGRVVGFLDDIFFQMKIMETAKHLGLEFKVATKPDALLELLDPP |
| Ga0210385_101721514 | 3300021402 | Soil | MAEIVGLMDDLFFQMKVLETAKQLGLQFKVANTADSL |
| Ga0210397_111825481 | 3300021403 | Soil | MGRVVALMDDLFFQMKVAETAKHLGVELKVATNGDALL |
| Ga0210389_104690153 | 3300021404 | Soil | MAEIVGLMDDLFFQMKVLETAKQLGLQFKVANTADSLME |
| Ga0210394_102127671 | 3300021420 | Soil | MGRVIALMDDLFFQMKLAETAKQLGVEVKVATNGEALMALME |
| Ga0210394_103879081 | 3300021420 | Soil | MGRIVAMMDDLFFQMKVAETAKHLGLELKVATNGDALLG |
| Ga0210384_108946811 | 3300021432 | Soil | MERVVALIDDLFFQMKVAETAKHLGMELKVAANGDALLT |
| Ga0210391_103710703 | 3300021433 | Soil | MGKVVALMDDLFFQMKLAETAKQLGVELKVATNSDAL |
| Ga0187846_101372451 | 3300021476 | Biofilm | MTRVVALMDDLFFQMKVAETAKHLGMEFKVAANGDVL |
| Ga0210409_112770352 | 3300021559 | Soil | MGRVVALMDDLFFQMKVAETAKHLGVELKVAANGDAL |
| Ga0242654_101120413 | 3300022726 | Soil | MGRAVGFMDDLFFQMKIAETAKHVGVDFKVASTGEALMGML |
| Ga0247694_10377531 | 3300024178 | Soil | MGRVAALIDDLFFQLKVAETAKQLGIEFKVAGNPEALFTLLEPPT |
| Ga0247679_10305402 | 3300024251 | Soil | MPRVVAYIDDLFFQMKLAETAKHLHIEVKVAASPDALLQ |
| Ga0247679_10700261 | 3300024251 | Soil | MGRVAALIDDLFFQLKVAETAKQLGIEFKVASNPEAL |
| Ga0247666_10884111 | 3300024323 | Soil | MPRVVAYMDDLFFQMKLAETAKHLHIEVKVAASPDALLQLMD |
| Ga0207680_112980551 | 3300025903 | Switchgrass Rhizosphere | MARVVALMDDLFFQMKVAETAKQLGMELKVAATADSLMQLLQMEP |
| Ga0207663_104645001 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MGRAVGFMDDLFFQMKIAETAKHLGVDFKVASTGE |
| Ga0207663_104809422 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MAQIVGLMDDLFFQMKVLETAKHLGLEFKVAANADSL |
| Ga0207652_100999071 | 3300025921 | Corn Rhizosphere | MGRVVALMDDLFFQMKVAETAKHLGLELKVATNGDALLGLL |
| Ga0207700_115265782 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MPRIVAYMDDLFFQMKLAETAKHLGLEVKVATTVESLLQL |
| Ga0207686_112271721 | 3300025934 | Miscanthus Rhizosphere | MPRVVAYMDDLFFQMKLAETAKHLGLEVKVASNADSLLQ |
| Ga0207689_111254402 | 3300025942 | Miscanthus Rhizosphere | MARVVALMDDLFFQMKVAETAKQLGMELKVAATADSLMQLLQ |
| Ga0209236_12501591 | 3300026298 | Grasslands Soil | MGRVVALMDDLFFQMKLAETAKQLGVEVKVATNGDALMGLM |
| Ga0209240_11914442 | 3300026304 | Grasslands Soil | MGRVVALMDDLFFQMKLAETAKQLGVEVKVATNGEAFLGLMASEAKLV |
| Ga0209240_12148661 | 3300026304 | Grasslands Soil | MPRVVAYMDDLFFQMKLAETAKHLHIEVKVAANPDALLQLMDP |
| Ga0209239_10504865 | 3300026310 | Grasslands Soil | MGRVVALMDDLFFQMKLAETAKQLGVEVKVAANAEALM |
| Ga0209154_12529462 | 3300026317 | Soil | MGRVVALVDDLFFQMKLAETAKQLGVEVKVATNSDALAGLMESGPKL |
| Ga0209471_11818021 | 3300026318 | Soil | MGRVVALVDDLFFQMKLAETAKQLGVEVKVAANGEAL |
| Ga0209687_10415581 | 3300026322 | Soil | MGRVVALVDDLFFQMKLAETAKQLGVEVKVATNSDALAGLM |
| Ga0209158_13566761 | 3300026333 | Soil | MGKVVALMDDLFFQMKLAETAKQLGVEVRVATNGEALMGLMAS |
| Ga0257177_10413001 | 3300026480 | Soil | MGRVVALMDDLFFQMKLAETAKQLGVEVKVATNAEALMGLMASD |
| Ga0257158_10739661 | 3300026515 | Soil | MGRVVALMDDLFFQMKLAETAKQLGVEVKVAANAEALMGLMASE |
| Ga0257158_11125721 | 3300026515 | Soil | MPRIVAYMDDLFFQMKLAETAKHLGLEVKVAATAESLLQLLEPPP |
| Ga0209378_12561882 | 3300026528 | Soil | MGRVVALMDDLFFQMKLAETAKQLGVEVKVAANGEAL |
| Ga0209648_106845122 | 3300026551 | Grasslands Soil | MGRVVALMDDLFFQMKLAETAKQLGVEVKVATSGEA |
| Ga0179587_102003104 | 3300026557 | Vadose Zone Soil | MGRVAALIDDLFFQLKVAETAKQLGIEFKVASNPDALF |
| Ga0179587_105024341 | 3300026557 | Vadose Zone Soil | MGRVVALMDDLFFQMKLAETAKQLGVEVKVAANGEA |
| Ga0179587_105656753 | 3300026557 | Vadose Zone Soil | MGRVVALMDDLFFQMKLAETAKQLGVEVKVATNAEALMGLMAS |
| Ga0207723_1078123 | 3300026824 | Tropical Forest Soil | MGRVVALMDDLFFQMKVAETAKHLGMEFRVAANGDVLAGMLE |
| Ga0207859_10206831 | 3300026859 | Tropical Forest Soil | MGRVVALMDDLFFQMKVAETAKHLGMEFRVAANGDVLAGMLEPPTKLV |
| Ga0207949_10105383 | 3300026999 | Forest Soil | MGRVVALMDDLFFQMKLAETAKHLGVELKVATSGDALLTL |
| Ga0207780_10013709 | 3300027313 | Tropical Forest Soil | MGRVVGLMDDLFFQMKVLETAKHVGVEFKVAANAEVLATML |
| Ga0208988_11437841 | 3300027633 | Forest Soil | MGRVVALMDDLFFQMKLAETAKQLGVEVKVATNGEALMG |
| Ga0209076_10591823 | 3300027643 | Vadose Zone Soil | MGIVVALMDDLFFQMKLAETAKQLGVEVKVAANGEALMGLMASE |
| Ga0209588_10035001 | 3300027671 | Vadose Zone Soil | MGKVVALIDDLFFQMKLAETAKQLGVELKVATNGDA |
| Ga0207826_10041517 | 3300027680 | Tropical Forest Soil | MGRVVALMDDLFFQMKVAETAKHLGLEFRVAANGDVLAG |
| Ga0209626_11849502 | 3300027684 | Forest Soil | MGRVVALMDDLFFQMKLAETAKQLGVEVKVAANGEALMG |
| Ga0207862_11063591 | 3300027703 | Tropical Forest Soil | MARAVGYMDDLFFQMKIAETAKQLGVEFKVASNPIGLNDLLDPPTRLVIVDLNSRNN |
| Ga0209038_102401711 | 3300027737 | Bog Forest Soil | MGRVVALMDDLFFQMKVAETAKQLGVEFKVATTAEALMGLLEPAPKLL |
| Ga0209908_100534501 | 3300027745 | Thawing Permafrost | MARVVALMDDLFFQMKVAETAKHLGLELKVAANSDALQTLLELSLIHI |
| Ga0209772_100408841 | 3300027768 | Bog Forest Soil | MGRVIALMDDLFFQMKLAETAKHLGIEVKVATNADALQTL |
| Ga0209772_101213561 | 3300027768 | Bog Forest Soil | MERIVALMDDLFFQMKVAETAKHLGLELKVATNGDALIGLLEPT |
| Ga0209139_100707581 | 3300027795 | Bog Forest Soil | MERIVALMDDLFFQMKVAETAKHLGLELKVATNGDAL |
| Ga0209656_100236581 | 3300027812 | Bog Forest Soil | MGRVVAYMDDIFFQMKIAETAKHLGITVKVATNSD |
| Ga0209656_104407352 | 3300027812 | Bog Forest Soil | MPRVVAYMDDLFFQMKLAETAKHLGLEVKVASNADSL |
| Ga0209039_100673641 | 3300027825 | Bog Forest Soil | MGRIVAMMDDLFFQMKVAETAKHLGLELKVATNVDALLGLLEPA |
| Ga0209039_103391502 | 3300027825 | Bog Forest Soil | MGRIVALMDDLFFQMKVAETAKQLGVDFQVATTGEAL |
| Ga0209180_101088261 | 3300027846 | Vadose Zone Soil | MGKVVALMDDLFFQMKLAETAKQLGVEVKVATSGE |
| Ga0209180_102280871 | 3300027846 | Vadose Zone Soil | MGRVVALMDDLFFQMKLAETAKQLGVEVKVATSGEALEGLMLS |
| Ga0209274_102146133 | 3300027853 | Soil | MGRIVALMDELFFQMKVAETAKHLGLELKVATTGDALIGLLEP |
| Ga0209701_103716383 | 3300027862 | Vadose Zone Soil | MGRVVALMDDLFFQMKLAETAKQLGVEVKVATSGE |
| Ga0209167_103858871 | 3300027867 | Surface Soil | MGRVAALIDDLFFQMKVAETAKHLGLEFKVAGSADA |
| Ga0209283_100638281 | 3300027875 | Vadose Zone Soil | MGRVVALMDNLFFQMKLAETAKQLGVEVKMATSGEALMGLMASEPKLVI |
| Ga0209283_101070924 | 3300027875 | Vadose Zone Soil | MGKVVALMDDLFFQMKLAETAKQLGVEVKVATSGEALEG |
| Ga0209006_103177603 | 3300027908 | Forest Soil | MGRIVAMMDDLFFQMKVAETAKHLGLELKVATNGDALLGLLEPAPS |
| Ga0209006_109122981 | 3300027908 | Forest Soil | MGRVVALMDDIFFQMKVAETAKHLGIEFKVATNTDALL |
| Ga0209583_102492011 | 3300027910 | Watersheds | MGRVVALMDDLFFQMKVAETAKHLGVELKVATNNDAFLTLL |
| Ga0209698_100526022 | 3300027911 | Watersheds | MGRVAALIDDLFFQMKVNETAKHLGLEFKVARDGDAPPA |
| Ga0209698_104267221 | 3300027911 | Watersheds | MGRVAALIDDLFFQLKVAETAKQLGGIEFKVASNPDALFTLLEPPTKLVIVD |
| Ga0209526_108060852 | 3300028047 | Forest Soil | MGRVAALIDDLFFQLKVAETAKQLGIEFKVASNPDALFTLLDPPTKL |
| Ga0247685_10305312 | 3300028065 | Soil | MGRVVALMDDLFFQMKVAETAKHLGLELKVATNGDALLGLLEPSP |
| Ga0247682_10487942 | 3300028146 | Soil | MGRVAALIDDLFFQLKVAETAKQLGIEFKVASNPEALFTLLDPPTKLVIV |
| Ga0302232_105628311 | 3300028789 | Palsa | MADVIALMDDLFFQMKVAETAKHLGLEFKVAGNGDALLALLERHP |
| Ga0307504_104722871 | 3300028792 | Soil | MGRVVALMDDLFFQMKLAETAKQVGVEVKVATNGEALMGLMAAELRL |
| Ga0265338_109159191 | 3300028800 | Rhizosphere | MARIVAMMDDLFFQMKVAETAKHLGLELKVAANGDALLGLL |
| Ga0302226_102993022 | 3300028801 | Palsa | MADVIALMDDLFFQMKVAETAKHLGLEFKVAGNGD |
| Ga0302228_101568313 | 3300028808 | Palsa | MGRVVALMDDLFFQMKLAETAKHLGIEVKVATNGDALQ |
| Ga0308309_100124271 | 3300028906 | Soil | MGRVVGFLDDIFFQMKILETAKHLGMEFKVATNPDALIELLDPPTNLV |
| Ga0308309_101445373 | 3300028906 | Soil | MGRVVALMDDLFFQMKVAETAKHLGVELKVAANGD |
| Ga0308309_106575461 | 3300028906 | Soil | MGKVVALMDDLFFQMKLAETAKQLGVELKVATNGDAL |
| Ga0308309_108946432 | 3300028906 | Soil | MGRVVALMDDLFFQMKVAETARHLGVELKVATNGDALLT |
| Ga0222749_100103491 | 3300029636 | Soil | MGKVVALMDDLFFQMKLAETAKQLGVEVKVATNGKALMDLMS |
| Ga0318541_105597262 | 3300031545 | Soil | MARVVALMDDLFFQMKVAETAKHLGMEFKVAANGDALASMLEPPTKLVIID |
| Ga0318561_105823931 | 3300031679 | Soil | MGRVVALMDDLFFQMKVAETAKHLGLEFKVAANGDVLAGM |
| Ga0318572_104640011 | 3300031681 | Soil | MGRVVALMDDLFFQMKVAETAKHLGMEFKVAANGDVLA |
| Ga0307469_104900763 | 3300031720 | Hardwood Forest Soil | MGRAVGFMDDLFFQMKIAETAKHVGVDFKVASTGEALMG |
| Ga0318500_105476441 | 3300031724 | Soil | MGRVVALVDDLFFQVKLAETAKQLGVEVKVAANGDA |
| Ga0318492_105093502 | 3300031748 | Soil | MGRVVALMDDLFFQMKVAETAKHLGMEFKVAANGDVLAGLLEPPTKLV |
| Ga0318494_104152571 | 3300031751 | Soil | MARVVAYIDDLFFQMKLAETAKHLGLEAKVAGNAESLLQLLDPLPA |
| Ga0307477_101249111 | 3300031753 | Hardwood Forest Soil | MGRVVALMDDLFFQMKLAETAKQLGVELKVATNGDALLGL |
| Ga0307475_100501986 | 3300031754 | Hardwood Forest Soil | MGRVVALMDDLFFQMKMAETAKQLGVELKVATNCDALM |
| Ga0307475_104612061 | 3300031754 | Hardwood Forest Soil | MGRVAALIDDLFFQLKVAETAKQLGGIEFKVASNPDALFTLLDPPTKLVIVDLN |
| Ga0307475_107283981 | 3300031754 | Hardwood Forest Soil | MGRVVALMDDIFFQMKVAETARHLGIEFKVATNANALLSLLEPRPQLVIVD |
| Ga0307475_109062461 | 3300031754 | Hardwood Forest Soil | MGRVVALMDDLFFQMKLAETAKQLGVEVKVAANGEALMGLMASE |
| Ga0318509_100742893 | 3300031768 | Soil | MARVVAYIDDLFFQMKLAETAKHLGLEAKVAGNAESLLQLLDPLP |
| Ga0318526_104639842 | 3300031769 | Soil | MGRVVALMDDLFFQMKVAETAKQLGVEFKVASNGAVLATMLE |
| Ga0318543_102863621 | 3300031777 | Soil | MGRVVALMDDLFFQMKVLETAKHVGVEFKVATTGEALM |
| Ga0307478_100775821 | 3300031823 | Hardwood Forest Soil | MGRVVALVDDLFFQMKLAETARQLGVEVKVAGNGEALLGLLEPASKLVIV |
| Ga0310917_106853881 | 3300031833 | Soil | MGRVVGLMDDLFFQMKVAETAKQLGVEFKVAANGDV |
| Ga0306919_112292051 | 3300031879 | Soil | MGRVVALMDDLFFQMKVAETAKQLGVEFKVASNGA |
| Ga0306921_117506971 | 3300031912 | Soil | MPRVVAYMDDLFFQMKLAETAKHLGLEVKVARTADSLLQLLEPPPLLV |
| Ga0306921_120513532 | 3300031912 | Soil | MGRVVALVDDLFFQMKLAETAKQLGVDVKVAANGDALM |
| Ga0310912_102666191 | 3300031941 | Soil | MGRVVGLMDDLFFQMKVAETAKQLGVEFKVAANGDVLVTMLEPPTRLVIVDLN |
| Ga0310912_105075471 | 3300031941 | Soil | MPRVVAYMDDLFFQMKLAETAKLLGLEVKVAGNADSLLQLLEPPP |
| Ga0310916_107721491 | 3300031942 | Soil | MGRVVALMDDLFFQMKVAETAKHLGMEFKVAANGDVLAG |
| Ga0310913_108184051 | 3300031945 | Soil | MGRVVALMDDLFFQMKVAETAKHLGLEFKVAANGDVLAGMLEPPTKLVVI |
| Ga0310910_111583771 | 3300031946 | Soil | MGRVVGLMDDLFFQMKVAETAKQLGVEFKVAANGDVL |
| Ga0307479_115641922 | 3300031962 | Hardwood Forest Soil | MPRVVAYMDDLFFQMKLAETAKHLALEVKVASTAESLLQLLDPPPELVI |
| Ga0306922_100072451 | 3300032001 | Soil | MARVVALMDDLFFQMKVAETAKHLGMEFKVAANGDALASMLEP |
| Ga0306922_106662313 | 3300032001 | Soil | MGRAVGFMDDLFFQMKIAETAKHVGVEFKVASTSEALMRMLDAPTKLV |
| Ga0306922_107606381 | 3300032001 | Soil | MGRVVALMDDLFFQMKVAETAKHLGLEFKVAANGDVLAGMLEPPTKLVVID |
| Ga0318570_100589214 | 3300032054 | Soil | MGRVVALMDDLFFQMKVAETAKHLGMEFKVAANGDVLAGLLEPPTKLVI |
| Ga0318533_104962011 | 3300032059 | Soil | MGRVVALMDDLFFQMKVLETAKHVGVEFKVATTGEAL |
| Ga0307470_112642732 | 3300032174 | Hardwood Forest Soil | MPRVVAYMDDLFFQMKLAETAKHLGVEVKVASNADSLL |
| Ga0307471_1015383853 | 3300032180 | Hardwood Forest Soil | MGRVVALMDDLFFQMKLAETAKQLGVEVKVAANGEALMGLMAS |
| Ga0307471_1016793993 | 3300032180 | Hardwood Forest Soil | MGKVVALMDDLFFQMKLAETAKQLGVEVKVATNAEALMGLLA |
| Ga0307471_1017154632 | 3300032180 | Hardwood Forest Soil | MGRVAALIDDLFFQLKVAETAKQLGIEFKVASNPEA |
| Ga0307471_1020315581 | 3300032180 | Hardwood Forest Soil | MGRVVALMDDIFFQMKIAETAKHLGIEFKVATNTDALLGLLEPR |
| Ga0307471_1023124582 | 3300032180 | Hardwood Forest Soil | MGRVVALMDDLFFQMKLAETAKHLGVEVKVATTADALMPLLDSPP |
| Ga0307471_1036857982 | 3300032180 | Hardwood Forest Soil | MGRVVALMDDLFFQMKLAETAKHLGVEVKVATTADALAG |
| Ga0307472_1002434611 | 3300032205 | Hardwood Forest Soil | MGRVVALMDDLFFQMKLAETAKQLGVEVKVATNGEALMGLM |
| Ga0307472_1004647382 | 3300032205 | Hardwood Forest Soil | MARVVALMDDLFFQMKVAETAKHLGMELKVAATADALMQLLEMQ |
| Ga0307472_1018041581 | 3300032205 | Hardwood Forest Soil | MGKVVALMDDLFFQMKLAETAKQLGVELKVATNGD |
| Ga0307472_1025354151 | 3300032205 | Hardwood Forest Soil | MGKVVALMDDLFFQMKLAETAKQLGVELKVATNGDALMHL |
| Ga0335080_109152961 | 3300032828 | Soil | MARIVALMDDLFFQMKVAETAKHLGIEFKVATTGDALLGLLEPLPRLV |
| Ga0335069_112436083 | 3300032893 | Soil | MGRVAALIDDLFFQMKVAETAKHLGLEFKVASNADALMNL |
| Ga0316620_102541574 | 3300033480 | Soil | MGRVVALMDDLFFQMKVAETAKHLGLELKVATNGNALLSLLEPA |
| Ga0314861_0346712_522_659 | 3300033977 | Peatland | MGRAVALMDDLFFQMKVAETAKQLGVEFKVATTGEALLGMLDPPTN |
| ⦗Top⦘ |