| Basic Information | |
|---|---|
| Family ID | F017056 |
| Family Type | Metagenome |
| Number of Sequences | 243 |
| Average Sequence Length | 48 residues |
| Representative Sequence | SYMMQPGGNYRHTTSCDKASECVFFVESNGRFDLKLVEPGKAPAKK |
| Number of Associated Samples | 168 |
| Number of Associated Scaffolds | 243 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 2.47 % |
| % of genes near scaffold ends (potentially truncated) | 93.83 % |
| % of genes from short scaffolds (< 2000 bps) | 91.77 % |
| Associated GOLD sequencing projects | 159 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.40 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (92.181 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (14.815 % of family members) |
| Environment Ontology (ENVO) | Unclassified (33.745 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (48.971 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 21.62% Coil/Unstructured: 78.38% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.40 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 243 Family Scaffolds |
|---|---|---|
| PF14499 | DUF4437 | 3.70 |
| PF05368 | NmrA | 2.47 |
| PF12704 | MacB_PCD | 2.06 |
| PF12680 | SnoaL_2 | 1.65 |
| PF00291 | PALP | 1.65 |
| PF13517 | FG-GAP_3 | 1.65 |
| PF00326 | Peptidase_S9 | 1.65 |
| PF01894 | UPF0047 | 1.65 |
| PF04237 | YjbR | 1.23 |
| PF01432 | Peptidase_M3 | 1.23 |
| PF01979 | Amidohydro_1 | 1.23 |
| PF00496 | SBP_bac_5 | 0.82 |
| PF10604 | Polyketide_cyc2 | 0.82 |
| PF05960 | DUF885 | 0.82 |
| PF00069 | Pkinase | 0.82 |
| PF00106 | adh_short | 0.82 |
| PF08570 | DUF1761 | 0.82 |
| PF07883 | Cupin_2 | 0.82 |
| PF12695 | Abhydrolase_5 | 0.82 |
| PF00072 | Response_reg | 0.82 |
| PF13649 | Methyltransf_25 | 0.82 |
| PF03465 | eRF1_3 | 0.82 |
| PF12706 | Lactamase_B_2 | 0.82 |
| PF12681 | Glyoxalase_2 | 0.82 |
| PF00118 | Cpn60_TCP1 | 0.82 |
| PF13620 | CarboxypepD_reg | 0.41 |
| PF16576 | HlyD_D23 | 0.41 |
| PF13646 | HEAT_2 | 0.41 |
| PF00583 | Acetyltransf_1 | 0.41 |
| PF13802 | Gal_mutarotas_2 | 0.41 |
| PF06283 | ThuA | 0.41 |
| PF12867 | DinB_2 | 0.41 |
| PF07311 | Dodecin | 0.41 |
| PF12823 | DUF3817 | 0.41 |
| PF12697 | Abhydrolase_6 | 0.41 |
| PF10012 | DUF2255 | 0.41 |
| PF10643 | Cytochrome-c551 | 0.41 |
| PF13975 | gag-asp_proteas | 0.41 |
| PF06718 | DUF1203 | 0.41 |
| PF07238 | PilZ | 0.41 |
| PF13365 | Trypsin_2 | 0.41 |
| PF13594 | Obsolete Pfam Family | 0.41 |
| PF00135 | COesterase | 0.41 |
| PF01433 | Peptidase_M1 | 0.41 |
| PF09970 | DUF2204 | 0.41 |
| PF07676 | PD40 | 0.41 |
| PF16263 | DUF4917 | 0.41 |
| PF03098 | An_peroxidase | 0.41 |
| PF06271 | RDD | 0.41 |
| PF14384 | BrnA_antitoxin | 0.41 |
| PF08818 | DUF1801 | 0.41 |
| PF04972 | BON | 0.41 |
| PF01513 | NAD_kinase | 0.41 |
| PF07690 | MFS_1 | 0.41 |
| PF02687 | FtsX | 0.41 |
| PF00753 | Lactamase_B | 0.41 |
| PF13692 | Glyco_trans_1_4 | 0.41 |
| PF03992 | ABM | 0.41 |
| PF09098 | Dehyd-heme_bind | 0.41 |
| PF03551 | PadR | 0.41 |
| PF01850 | PIN | 0.41 |
| PF00005 | ABC_tran | 0.41 |
| PF08327 | AHSA1 | 0.41 |
| PF13429 | TPR_15 | 0.41 |
| PF01494 | FAD_binding_3 | 0.41 |
| PF13354 | Beta-lactamase2 | 0.41 |
| PF01209 | Ubie_methyltran | 0.41 |
| PF00175 | NAD_binding_1 | 0.41 |
| PF00144 | Beta-lactamase | 0.41 |
| PF07635 | PSCyt1 | 0.41 |
| PF13561 | adh_short_C2 | 0.41 |
| PF13418 | Kelch_4 | 0.41 |
| PF00149 | Metallophos | 0.41 |
| PF00196 | GerE | 0.41 |
| PF05193 | Peptidase_M16_C | 0.41 |
| PF12847 | Methyltransf_18 | 0.41 |
| PF13193 | AMP-binding_C | 0.41 |
| PF01451 | LMWPc | 0.41 |
| PF03576 | Peptidase_S58 | 0.41 |
| PF04055 | Radical_SAM | 0.41 |
| PF02852 | Pyr_redox_dim | 0.41 |
| PF00497 | SBP_bac_3 | 0.41 |
| PF00756 | Esterase | 0.41 |
| PF10116 | Host_attach | 0.41 |
| PF01370 | Epimerase | 0.41 |
| PF01402 | RHH_1 | 0.41 |
| PF01872 | RibD_C | 0.41 |
| PF01553 | Acyltransferase | 0.41 |
| PF03422 | CBM_6 | 0.41 |
| PF00893 | Multi_Drug_Res | 0.41 |
| PF13650 | Asp_protease_2 | 0.41 |
| PF03965 | Penicillinase_R | 0.41 |
| PF01594 | AI-2E_transport | 0.41 |
| COG ID | Name | Functional Category | % Frequency in 243 Family Scaffolds |
|---|---|---|---|
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 3.29 |
| COG0432 | Thiamin phosphate synthase YjbQ, UPF0047 family | Coenzyme transport and metabolism [H] | 1.65 |
| COG0339 | Zn-dependent oligopeptidase, M3 family | Posttranslational modification, protein turnover, chaperones [O] | 1.23 |
| COG2315 | Predicted DNA-binding protein with ‘double-wing’ structural motif, MmcQ/YjbR family | Transcription [K] | 1.23 |
| COG1164 | Oligoendopeptidase F | Amino acid transport and metabolism [E] | 1.23 |
| COG0459 | Chaperonin GroEL (HSP60 family) | Posttranslational modification, protein turnover, chaperones [O] | 0.82 |
| COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 0.82 |
| COG4805 | Uncharacterized conserved protein, DUF885 family | Function unknown [S] | 0.82 |
| COG0654 | 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases | Energy production and conversion [C] | 0.82 |
| COG3191 | L-aminopeptidase/D-esterase | Amino acid transport and metabolism [E] | 0.82 |
| COG4430 | Uncharacterized conserved protein YdeI, YjbR/CyaY-like superfamily, DUF1801 family | Function unknown [S] | 0.41 |
| COG2227 | 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase | Coenzyme transport and metabolism [H] | 0.41 |
| COG2272 | Carboxylesterase type B | Lipid transport and metabolism [I] | 0.41 |
| COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 0.41 |
| COG3360 | Flavin-binding protein dodecin | General function prediction only [R] | 0.41 |
| COG3682 | Transcriptional regulator, CopY/TcrY family | Transcription [K] | 0.41 |
| COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 0.41 |
| COG4813 | Trehalose utilization protein | Carbohydrate transport and metabolism [G] | 0.41 |
| COG5646 | Iron-binding protein Fra/YdhG, frataxin family (Fe-S cluster biosynthesis) | Posttranslational modification, protein turnover, chaperones [O] | 0.41 |
| COG5649 | Uncharacterized conserved protein, DUF1801 domain | Function unknown [S] | 0.41 |
| COG2226 | Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenG | Coenzyme transport and metabolism [H] | 0.41 |
| COG2076 | Multidrug transporter EmrE and related cation transporters | Defense mechanisms [V] | 0.41 |
| COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 0.41 |
| COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 0.41 |
| COG1714 | Uncharacterized membrane protein YckC, RDD family | Function unknown [S] | 0.41 |
| COG1695 | DNA-binding transcriptional regulator, PadR family | Transcription [K] | 0.41 |
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.41 |
| COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 0.41 |
| COG0665 | Glycine/D-amino acid oxidase (deaminating) | Amino acid transport and metabolism [E] | 0.41 |
| COG0644 | Dehydrogenase (flavoprotein) | Energy production and conversion [C] | 0.41 |
| COG0628 | Predicted PurR-regulated permease PerM | General function prediction only [R] | 0.41 |
| COG0578 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 0.41 |
| COG0308 | Aminopeptidase N, contains DUF3458 domain | Amino acid transport and metabolism [E] | 0.41 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 92.18 % |
| Unclassified | root | N/A | 7.82 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000550|F24TB_12145735 | All Organisms → cellular organisms → Bacteria | 621 | Open in IMG/M |
| 3300000787|JGI11643J11755_11351290 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
| 3300000956|JGI10216J12902_101085605 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales | 1476 | Open in IMG/M |
| 3300000956|JGI10216J12902_107861912 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales | 703 | Open in IMG/M |
| 3300000956|JGI10216J12902_112446030 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
| 3300000956|JGI10216J12902_117445692 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 521 | Open in IMG/M |
| 3300000956|JGI10216J12902_125228751 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300001593|JGI12635J15846_10394663 | All Organisms → cellular organisms → Bacteria | 836 | Open in IMG/M |
| 3300001867|JGI12627J18819_10439942 | Not Available | 533 | Open in IMG/M |
| 3300004157|Ga0062590_101822268 | All Organisms → cellular organisms → Bacteria | 625 | Open in IMG/M |
| 3300004157|Ga0062590_102271256 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
| 3300004463|Ga0063356_102262032 | All Organisms → cellular organisms → Bacteria | 829 | Open in IMG/M |
| 3300004479|Ga0062595_101804699 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 581 | Open in IMG/M |
| 3300004480|Ga0062592_100705672 | All Organisms → cellular organisms → Bacteria | 878 | Open in IMG/M |
| 3300004480|Ga0062592_102146788 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 555 | Open in IMG/M |
| 3300004643|Ga0062591_101945137 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
| 3300005093|Ga0062594_100407640 | All Organisms → cellular organisms → Bacteria | 1102 | Open in IMG/M |
| 3300005093|Ga0062594_102810842 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 541 | Open in IMG/M |
| 3300005181|Ga0066678_10680376 | All Organisms → cellular organisms → Bacteria | 686 | Open in IMG/M |
| 3300005288|Ga0065714_10164678 | All Organisms → cellular organisms → Bacteria | 1025 | Open in IMG/M |
| 3300005334|Ga0068869_100116671 | All Organisms → cellular organisms → Bacteria | 2037 | Open in IMG/M |
| 3300005335|Ga0070666_11189705 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 568 | Open in IMG/M |
| 3300005344|Ga0070661_100978675 | All Organisms → cellular organisms → Bacteria | 701 | Open in IMG/M |
| 3300005347|Ga0070668_100322524 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1301 | Open in IMG/M |
| 3300005347|Ga0070668_101748961 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
| 3300005355|Ga0070671_100128286 | All Organisms → cellular organisms → Bacteria | 2135 | Open in IMG/M |
| 3300005356|Ga0070674_102164085 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 508 | Open in IMG/M |
| 3300005444|Ga0070694_101389114 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 592 | Open in IMG/M |
| 3300005445|Ga0070708_100530507 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1110 | Open in IMG/M |
| 3300005445|Ga0070708_101721520 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
| 3300005446|Ga0066686_10286780 | All Organisms → cellular organisms → Bacteria | 1117 | Open in IMG/M |
| 3300005447|Ga0066689_10715603 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 626 | Open in IMG/M |
| 3300005451|Ga0066681_10573056 | All Organisms → cellular organisms → Bacteria | 697 | Open in IMG/M |
| 3300005455|Ga0070663_102085304 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
| 3300005459|Ga0068867_100065273 | All Organisms → cellular organisms → Bacteria | 2708 | Open in IMG/M |
| 3300005459|Ga0068867_101024426 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 750 | Open in IMG/M |
| 3300005468|Ga0070707_100093248 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 2915 | Open in IMG/M |
| 3300005468|Ga0070707_100540610 | All Organisms → cellular organisms → Bacteria | 1127 | Open in IMG/M |
| 3300005471|Ga0070698_100970206 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 797 | Open in IMG/M |
| 3300005543|Ga0070672_100077676 | All Organisms → cellular organisms → Bacteria | 2656 | Open in IMG/M |
| 3300005544|Ga0070686_101552081 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
| 3300005545|Ga0070695_101322593 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
| 3300005546|Ga0070696_101371207 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 602 | Open in IMG/M |
| 3300005555|Ga0066692_10567828 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 715 | Open in IMG/M |
| 3300005556|Ga0066707_10577365 | All Organisms → cellular organisms → Bacteria | 721 | Open in IMG/M |
| 3300005556|Ga0066707_10637833 | Not Available | 675 | Open in IMG/M |
| 3300005557|Ga0066704_10308091 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1069 | Open in IMG/M |
| 3300005558|Ga0066698_10732067 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
| 3300005578|Ga0068854_100352008 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1206 | Open in IMG/M |
| 3300005719|Ga0068861_102251139 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 546 | Open in IMG/M |
| 3300005764|Ga0066903_105135846 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 693 | Open in IMG/M |
| 3300005764|Ga0066903_106224026 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
| 3300005843|Ga0068860_101112066 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 810 | Open in IMG/M |
| 3300005844|Ga0068862_100901250 | All Organisms → cellular organisms → Bacteria | 869 | Open in IMG/M |
| 3300005844|Ga0068862_102134588 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 571 | Open in IMG/M |
| 3300006046|Ga0066652_100464329 | All Organisms → cellular organisms → Bacteria | 1168 | Open in IMG/M |
| 3300006046|Ga0066652_101186207 | Not Available | 723 | Open in IMG/M |
| 3300006163|Ga0070715_10874101 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 551 | Open in IMG/M |
| 3300006755|Ga0079222_11930829 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 577 | Open in IMG/M |
| 3300006796|Ga0066665_10261339 | All Organisms → cellular organisms → Bacteria | 1375 | Open in IMG/M |
| 3300006796|Ga0066665_11005983 | All Organisms → cellular organisms → Bacteria | 639 | Open in IMG/M |
| 3300006797|Ga0066659_10311264 | All Organisms → cellular organisms → Bacteria | 1206 | Open in IMG/M |
| 3300006797|Ga0066659_10828337 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 768 | Open in IMG/M |
| 3300006797|Ga0066659_10848022 | Not Available | 760 | Open in IMG/M |
| 3300006797|Ga0066659_10963451 | All Organisms → cellular organisms → Bacteria | 713 | Open in IMG/M |
| 3300006806|Ga0079220_10250103 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1060 | Open in IMG/M |
| 3300006806|Ga0079220_10651552 | All Organisms → cellular organisms → Bacteria | 761 | Open in IMG/M |
| 3300006844|Ga0075428_101373370 | All Organisms → cellular organisms → Bacteria | 742 | Open in IMG/M |
| 3300006844|Ga0075428_101437520 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 723 | Open in IMG/M |
| 3300006845|Ga0075421_101503294 | All Organisms → cellular organisms → Bacteria | 736 | Open in IMG/M |
| 3300006845|Ga0075421_101704028 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 682 | Open in IMG/M |
| 3300006845|Ga0075421_102568891 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
| 3300006846|Ga0075430_100739069 | All Organisms → cellular organisms → Bacteria | 811 | Open in IMG/M |
| 3300006847|Ga0075431_100722422 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 973 | Open in IMG/M |
| 3300006847|Ga0075431_100757322 | Not Available | 946 | Open in IMG/M |
| 3300006852|Ga0075433_10552841 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1012 | Open in IMG/M |
| 3300006854|Ga0075425_100363577 | All Organisms → cellular organisms → Bacteria | 1666 | Open in IMG/M |
| 3300006854|Ga0075425_103065112 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
| 3300006880|Ga0075429_100013575 | All Organisms → cellular organisms → Bacteria | 7064 | Open in IMG/M |
| 3300006881|Ga0068865_102021056 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
| 3300006894|Ga0079215_10453279 | All Organisms → cellular organisms → Bacteria | 780 | Open in IMG/M |
| 3300006903|Ga0075426_10618561 | All Organisms → cellular organisms → Bacteria | 809 | Open in IMG/M |
| 3300006903|Ga0075426_10764587 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 726 | Open in IMG/M |
| 3300006903|Ga0075426_10908545 | All Organisms → cellular organisms → Bacteria | 664 | Open in IMG/M |
| 3300006903|Ga0075426_11324319 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 547 | Open in IMG/M |
| 3300006904|Ga0075424_100131244 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2651 | Open in IMG/M |
| 3300006904|Ga0075424_102776967 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_12_FULL_67_14b | 510 | Open in IMG/M |
| 3300006914|Ga0075436_100222026 | All Organisms → cellular organisms → Bacteria | 1341 | Open in IMG/M |
| 3300006918|Ga0079216_11901582 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 514 | Open in IMG/M |
| 3300006954|Ga0079219_10116849 | All Organisms → cellular organisms → Bacteria | 1349 | Open in IMG/M |
| 3300007004|Ga0079218_11399826 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 747 | Open in IMG/M |
| 3300009012|Ga0066710_100194096 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium SCN 70-22 | 2883 | Open in IMG/M |
| 3300009012|Ga0066710_101060840 | All Organisms → cellular organisms → Bacteria | 1252 | Open in IMG/M |
| 3300009012|Ga0066710_101533256 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1026 | Open in IMG/M |
| 3300009012|Ga0066710_102170411 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 812 | Open in IMG/M |
| 3300009012|Ga0066710_102240145 | All Organisms → cellular organisms → Bacteria | 796 | Open in IMG/M |
| 3300009038|Ga0099829_10591801 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 922 | Open in IMG/M |
| 3300009089|Ga0099828_11363055 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 627 | Open in IMG/M |
| 3300009090|Ga0099827_11281595 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 637 | Open in IMG/M |
| 3300009094|Ga0111539_10540891 | All Organisms → cellular organisms → Bacteria | 1357 | Open in IMG/M |
| 3300009094|Ga0111539_10865911 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas sediminicola | 1051 | Open in IMG/M |
| 3300009094|Ga0111539_11758767 | All Organisms → cellular organisms → Bacteria | 719 | Open in IMG/M |
| 3300009100|Ga0075418_11446503 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 746 | Open in IMG/M |
| 3300009100|Ga0075418_11862602 | All Organisms → cellular organisms → Bacteria | 655 | Open in IMG/M |
| 3300009137|Ga0066709_100324168 | All Organisms → cellular organisms → Bacteria | 2104 | Open in IMG/M |
| 3300009137|Ga0066709_100637678 | All Organisms → cellular organisms → Bacteria | 1523 | Open in IMG/M |
| 3300009137|Ga0066709_101800202 | All Organisms → cellular organisms → Bacteria | 860 | Open in IMG/M |
| 3300009137|Ga0066709_104226249 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 523 | Open in IMG/M |
| 3300009147|Ga0114129_11812963 | All Organisms → cellular organisms → Bacteria | 742 | Open in IMG/M |
| 3300009147|Ga0114129_12456580 | All Organisms → cellular organisms → Bacteria | 623 | Open in IMG/M |
| 3300009148|Ga0105243_12095440 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → unclassified Nostocales → Nostocales cyanobacterium HT-58-2 | 601 | Open in IMG/M |
| 3300009156|Ga0111538_10738569 | All Organisms → cellular organisms → Bacteria | 1247 | Open in IMG/M |
| 3300009157|Ga0105092_10842324 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 539 | Open in IMG/M |
| 3300009162|Ga0075423_10281713 | All Organisms → cellular organisms → Bacteria | 1742 | Open in IMG/M |
| 3300009162|Ga0075423_11195731 | All Organisms → cellular organisms → Bacteria | 811 | Open in IMG/M |
| 3300010029|Ga0105074_1009387 | Not Available | 1526 | Open in IMG/M |
| 3300010029|Ga0105074_1082766 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 593 | Open in IMG/M |
| 3300010301|Ga0134070_10130133 | All Organisms → cellular organisms → Bacteria | 893 | Open in IMG/M |
| 3300010301|Ga0134070_10311887 | All Organisms → cellular organisms → Bacteria | 602 | Open in IMG/M |
| 3300010325|Ga0134064_10470928 | Not Available | 516 | Open in IMG/M |
| 3300010333|Ga0134080_10542842 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
| 3300010359|Ga0126376_10286493 | All Organisms → cellular organisms → Bacteria | 1424 | Open in IMG/M |
| 3300010366|Ga0126379_10173783 | All Organisms → cellular organisms → Bacteria | 2039 | Open in IMG/M |
| 3300010373|Ga0134128_12241882 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 602 | Open in IMG/M |
| 3300010403|Ga0134123_10221472 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea | 1626 | Open in IMG/M |
| 3300010403|Ga0134123_10606305 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1053 | Open in IMG/M |
| 3300011119|Ga0105246_10910919 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 32-64-14 | 789 | Open in IMG/M |
| 3300011270|Ga0137391_10398389 | All Organisms → cellular organisms → Bacteria | 1177 | Open in IMG/M |
| 3300011270|Ga0137391_10786693 | All Organisms → cellular organisms → Bacteria | 785 | Open in IMG/M |
| 3300011405|Ga0137340_1027456 | All Organisms → cellular organisms → Bacteria | 1055 | Open in IMG/M |
| 3300011445|Ga0137427_10247379 | Not Available | 746 | Open in IMG/M |
| 3300012045|Ga0136623_10043717 | All Organisms → cellular organisms → Bacteria | 1950 | Open in IMG/M |
| 3300012198|Ga0137364_10351123 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1100 | Open in IMG/M |
| 3300012198|Ga0137364_10595062 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 833 | Open in IMG/M |
| 3300012199|Ga0137383_10552638 | All Organisms → cellular organisms → Bacteria | 843 | Open in IMG/M |
| 3300012201|Ga0137365_10046981 | All Organisms → cellular organisms → Bacteria | 3277 | Open in IMG/M |
| 3300012201|Ga0137365_10103048 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 2147 | Open in IMG/M |
| 3300012207|Ga0137381_11005092 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 719 | Open in IMG/M |
| 3300012207|Ga0137381_11666475 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 528 | Open in IMG/M |
| 3300012208|Ga0137376_10183080 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1809 | Open in IMG/M |
| 3300012208|Ga0137376_10386708 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1215 | Open in IMG/M |
| 3300012208|Ga0137376_11147992 | All Organisms → cellular organisms → Bacteria | 664 | Open in IMG/M |
| 3300012208|Ga0137376_11330543 | All Organisms → cellular organisms → Bacteria | 609 | Open in IMG/M |
| 3300012208|Ga0137376_11384582 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 594 | Open in IMG/M |
| 3300012210|Ga0137378_10778477 | All Organisms → cellular organisms → Bacteria | 869 | Open in IMG/M |
| 3300012211|Ga0137377_10601770 | All Organisms → cellular organisms → Bacteria | 1036 | Open in IMG/M |
| 3300012211|Ga0137377_11166108 | All Organisms → cellular organisms → Bacteria | 700 | Open in IMG/M |
| 3300012211|Ga0137377_11800777 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| 3300012351|Ga0137386_10723586 | All Organisms → cellular organisms → Bacteria | 715 | Open in IMG/M |
| 3300012357|Ga0137384_10432956 | All Organisms → cellular organisms → Bacteria | 1084 | Open in IMG/M |
| 3300012357|Ga0137384_10545855 | All Organisms → cellular organisms → Bacteria | 949 | Open in IMG/M |
| 3300012357|Ga0137384_10711547 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 815 | Open in IMG/M |
| 3300012357|Ga0137384_11138525 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 623 | Open in IMG/M |
| 3300012358|Ga0137368_10725280 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 622 | Open in IMG/M |
| 3300012358|Ga0137368_10988672 | Not Available | 506 | Open in IMG/M |
| 3300012360|Ga0137375_10456793 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1099 | Open in IMG/M |
| 3300012360|Ga0137375_10820552 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 746 | Open in IMG/M |
| 3300012363|Ga0137390_10694543 | Not Available | 980 | Open in IMG/M |
| 3300012680|Ga0136612_10435606 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 665 | Open in IMG/M |
| 3300012681|Ga0136613_10197252 | Not Available | 1137 | Open in IMG/M |
| 3300012685|Ga0137397_11159716 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 559 | Open in IMG/M |
| 3300012891|Ga0157305_10267140 | Not Available | 522 | Open in IMG/M |
| 3300012904|Ga0157282_10302315 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
| 3300012918|Ga0137396_10588327 | All Organisms → cellular organisms → Bacteria | 823 | Open in IMG/M |
| 3300012918|Ga0137396_10592676 | All Organisms → cellular organisms → Bacteria | 820 | Open in IMG/M |
| 3300012930|Ga0137407_12175893 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 530 | Open in IMG/M |
| 3300012961|Ga0164302_10820186 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 32-64-14 | 704 | Open in IMG/M |
| 3300012972|Ga0134077_10294072 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 681 | Open in IMG/M |
| 3300012986|Ga0164304_10781362 | All Organisms → cellular organisms → Bacteria | 735 | Open in IMG/M |
| 3300014154|Ga0134075_10105040 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1194 | Open in IMG/M |
| 3300014154|Ga0134075_10338863 | All Organisms → cellular organisms → Bacteria | 658 | Open in IMG/M |
| 3300015077|Ga0173483_11005885 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 500 | Open in IMG/M |
| 3300015257|Ga0180067_1013433 | All Organisms → cellular organisms → Bacteria | 1485 | Open in IMG/M |
| 3300015359|Ga0134085_10267816 | All Organisms → cellular organisms → Bacteria | 746 | Open in IMG/M |
| 3300015371|Ga0132258_10338561 | All Organisms → cellular organisms → Bacteria | 3716 | Open in IMG/M |
| 3300015373|Ga0132257_101842817 | Not Available | 778 | Open in IMG/M |
| 3300017659|Ga0134083_10299423 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 682 | Open in IMG/M |
| 3300017936|Ga0187821_10385319 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 571 | Open in IMG/M |
| 3300017974|Ga0187777_10597545 | All Organisms → cellular organisms → Bacteria | 777 | Open in IMG/M |
| 3300018027|Ga0184605_10498175 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 531 | Open in IMG/M |
| 3300018028|Ga0184608_10070077 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1420 | Open in IMG/M |
| 3300018056|Ga0184623_10167099 | All Organisms → cellular organisms → Bacteria | 1016 | Open in IMG/M |
| 3300018059|Ga0184615_10393643 | All Organisms → cellular organisms → Bacteria | 761 | Open in IMG/M |
| 3300018084|Ga0184629_10184635 | All Organisms → cellular organisms → Bacteria | 1072 | Open in IMG/M |
| 3300018084|Ga0184629_10383082 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 740 | Open in IMG/M |
| 3300018422|Ga0190265_10070541 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_12_FULL_67_14b | 3151 | Open in IMG/M |
| 3300018433|Ga0066667_10344212 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1182 | Open in IMG/M |
| 3300018433|Ga0066667_10500564 | All Organisms → cellular organisms → Bacteria | 1001 | Open in IMG/M |
| 3300018466|Ga0190268_11346018 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
| 3300018468|Ga0066662_10606667 | All Organisms → cellular organisms → Bacteria | 1025 | Open in IMG/M |
| 3300018468|Ga0066662_11125527 | All Organisms → cellular organisms → Bacteria | 787 | Open in IMG/M |
| 3300018469|Ga0190270_10265875 | All Organisms → cellular organisms → Bacteria | 1503 | Open in IMG/M |
| 3300025324|Ga0209640_10761322 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 766 | Open in IMG/M |
| 3300025911|Ga0207654_11290414 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 532 | Open in IMG/M |
| 3300025913|Ga0207695_11159399 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → unclassified Nostocales → Nostocales cyanobacterium HT-58-2 | 653 | Open in IMG/M |
| 3300025919|Ga0207657_10539818 | All Organisms → cellular organisms → Bacteria | 912 | Open in IMG/M |
| 3300025922|Ga0207646_10472325 | All Organisms → cellular organisms → Bacteria | 1131 | Open in IMG/M |
| 3300025922|Ga0207646_10676868 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 923 | Open in IMG/M |
| 3300025923|Ga0207681_11352270 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 598 | Open in IMG/M |
| 3300025923|Ga0207681_11450063 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
| 3300025926|Ga0207659_11050679 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Gemmatales → Gemmataceae → Zavarzinella | 701 | Open in IMG/M |
| 3300025930|Ga0207701_10256373 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 32-64-14 | 1526 | Open in IMG/M |
| 3300025934|Ga0207686_10694844 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 808 | Open in IMG/M |
| 3300025937|Ga0207669_10046641 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2562 | Open in IMG/M |
| 3300026023|Ga0207677_11329326 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 661 | Open in IMG/M |
| 3300026095|Ga0207676_11495214 | All Organisms → cellular organisms → Bacteria | 672 | Open in IMG/M |
| 3300026095|Ga0207676_12392533 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300026307|Ga0209469_1016696 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 2635 | Open in IMG/M |
| 3300026316|Ga0209155_1125573 | All Organisms → cellular organisms → Bacteria | 887 | Open in IMG/M |
| 3300026324|Ga0209470_1379419 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300026324|Ga0209470_1385338 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300026332|Ga0209803_1236041 | All Organisms → cellular organisms → Bacteria | 637 | Open in IMG/M |
| 3300026538|Ga0209056_10468288 | Not Available | 690 | Open in IMG/M |
| 3300027071|Ga0209214_1046444 | Not Available | 586 | Open in IMG/M |
| 3300027633|Ga0208988_1157870 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 543 | Open in IMG/M |
| 3300027765|Ga0209073_10004495 | All Organisms → cellular organisms → Bacteria | 3354 | Open in IMG/M |
| 3300027775|Ga0209177_10082535 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Dadabacteria → Candidatus Dadabacteria bacterium | 985 | Open in IMG/M |
| 3300027775|Ga0209177_10250574 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 654 | Open in IMG/M |
| 3300027886|Ga0209486_10013799 | All Organisms → cellular organisms → Bacteria | 3675 | Open in IMG/M |
| 3300027886|Ga0209486_10799824 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 617 | Open in IMG/M |
| 3300027886|Ga0209486_11067532 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 546 | Open in IMG/M |
| 3300027909|Ga0209382_10194278 | All Organisms → cellular organisms → Bacteria | 2329 | Open in IMG/M |
| 3300027909|Ga0209382_12150282 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300028379|Ga0268266_11475769 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_2_65_9 | 656 | Open in IMG/M |
| 3300028381|Ga0268264_10454762 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1241 | Open in IMG/M |
| 3300028536|Ga0137415_10201109 | All Organisms → cellular organisms → Bacteria | 1812 | Open in IMG/M |
| 3300028590|Ga0247823_10906489 | Not Available | 661 | Open in IMG/M |
| 3300028592|Ga0247822_10377860 | All Organisms → cellular organisms → Bacteria | 1100 | Open in IMG/M |
| 3300028592|Ga0247822_11742188 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 531 | Open in IMG/M |
| 3300031547|Ga0310887_10991460 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 536 | Open in IMG/M |
| 3300031640|Ga0318555_10786426 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Nannocystineae → Kofleriaceae → unclassified Kofleriaceae → Kofleriaceae bacterium | 514 | Open in IMG/M |
| 3300031908|Ga0310900_11555110 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
| 3300032002|Ga0307416_101739985 | Not Available | 728 | Open in IMG/M |
| 3300032002|Ga0307416_102452750 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 621 | Open in IMG/M |
| 3300032122|Ga0310895_10222592 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division NC10 | 859 | Open in IMG/M |
| 3300032179|Ga0310889_10332948 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 740 | Open in IMG/M |
| 3300032180|Ga0307471_100041952 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3677 | Open in IMG/M |
| 3300032180|Ga0307471_102655670 | Not Available | 635 | Open in IMG/M |
| 3300032205|Ga0307472_102348964 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
| 3300032261|Ga0306920_104288075 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 513 | Open in IMG/M |
| 3300033513|Ga0316628_102763004 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 646 | Open in IMG/M |
| 3300033550|Ga0247829_11745971 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300034147|Ga0364925_0133010 | Not Available | 897 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 14.81% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 12.76% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 11.52% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 5.35% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 5.35% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.53% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 3.70% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.29% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 3.29% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 3.29% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.88% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.88% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.47% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.06% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.65% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.65% |
| Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 1.23% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 1.23% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.23% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.23% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.23% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.23% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.41% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.41% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.41% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.41% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.41% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.41% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.41% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.41% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.41% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.41% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.41% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.41% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.41% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.82% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.82% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.82% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.82% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.82% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.82% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.82% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000550 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemly | Environmental | Open in IMG/M |
| 3300000787 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
| 3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
| 3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
| 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300006894 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control | Environmental | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300006918 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 | Environmental | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009157 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300010029 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_10_20 | Environmental | Open in IMG/M |
| 3300010301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
| 3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011405 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT400_2 | Environmental | Open in IMG/M |
| 3300011445 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT700_2 | Environmental | Open in IMG/M |
| 3300012045 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ449 (21.06) | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012358 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012680 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ224A (23.06) | Environmental | Open in IMG/M |
| 3300012681 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ272 (21.06) | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012891 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S148-409B-2 | Environmental | Open in IMG/M |
| 3300012904 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S029-104C-1 | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
| 3300015077 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2) | Environmental | Open in IMG/M |
| 3300015257 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT231_16_10D | Environmental | Open in IMG/M |
| 3300015359 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015 | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300017936 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1 | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
| 3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
| 3300018056 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1 | Environmental | Open in IMG/M |
| 3300018059 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_coex | Environmental | Open in IMG/M |
| 3300018084 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1 | Environmental | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300025324 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026307 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 (SPAdes) | Environmental | Open in IMG/M |
| 3300026316 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 (SPAdes) | Environmental | Open in IMG/M |
| 3300026324 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes) | Environmental | Open in IMG/M |
| 3300026332 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes) | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300027071 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027633 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027765 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes) | Environmental | Open in IMG/M |
| 3300027775 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes) | Environmental | Open in IMG/M |
| 3300027886 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes) | Environmental | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028590 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_PalmiticAcid_Day30 | Environmental | Open in IMG/M |
| 3300028592 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30 | Environmental | Open in IMG/M |
| 3300031547 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4 | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031908 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1 | Environmental | Open in IMG/M |
| 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
| 3300032122 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D4 | Environmental | Open in IMG/M |
| 3300032179 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D2 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300033513 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_C | Environmental | Open in IMG/M |
| 3300033550 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4 | Environmental | Open in IMG/M |
| 3300034147 | Sediment microbial communities from East River floodplain, Colorado, United States - 44_j17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| F24TB_121457351 | 3300000550 | Soil | EGKPEFRLGPGSYFFQPGGSYRHTTTCDKASDCVFFVESMAPFDLKPVGAGTGSTK* |
| JGI11643J11755_113512901 | 3300000787 | Soil | EFRLGPGSYFLQPGGNYRHTTTCDKASDCVFLVESKGAFDLKPVDAGKGPTK* |
| JGI10216J12902_1010856051 | 3300000956 | Soil | YFMQPGGDYRHTTTCDKASDCVFLVETTGPFDLRPVAAGAAPAR* |
| JGI10216J12902_1078619123 | 3300000956 | Soil | PEVRLGPGSYMMQPGGNYRHTTSCDKASECVFFVESTGKFDLKVVEAGKAPVKK* |
| JGI10216J12902_1124460301 | 3300000956 | Soil | DYRHTTSCDPASECVFFVESDGAFDLKPVDVGKPAAEE* |
| JGI10216J12902_1174456922 | 3300000956 | Soil | PEVRLGPGSYMMQPGGDYRHITSCDKASDCVFFVESSGAFDLKVVEAAKQ* |
| JGI10216J12902_1252287511 | 3300000956 | Soil | QAPEGKPEFRLGPGSYFLQPGGNYKHVTSCDKTADCVFFLESNGKFDLKPVNVAKPPAAEPSKDQPGAKPR* |
| JGI12635J15846_103946634 | 3300001593 | Forest Soil | PGGDYRHTTSCDKASECLFFAESNGKFDLKPVDAGKAPAKK* |
| JGI12627J18819_104399421 | 3300001867 | Forest Soil | GPEGKAEFALGPGSALKQPGGNYKHTTRCDKSSDCVFFVESSGPFDLLPVESAKKQ* |
| Ga0062590_1018222681 | 3300004157 | Soil | LGPGSYMMQPGGNYRHTTSCDKASDCLFFVESSGAFDLKPVAAAIF* |
| Ga0062590_1022712561 | 3300004157 | Soil | GSYMMQPGGNYRHTTSCDKSADCVFFVESNGAFDLRPVEAGKAPEKK* |
| Ga0063356_1022620322 | 3300004463 | Arabidopsis Thaliana Rhizosphere | IQAPEGKAEVRLGPGSYMMQPGGNYRHTTSCDKASECVLFVNGSGPFDLKVVEAAPAKK* |
| Ga0062595_1018046991 | 3300004479 | Soil | KPEFRLGPGSYFMQPGGSYRHTTTCDKASDCVFLVESRGAFDLKPVAAPAPAK* |
| Ga0062592_1007056722 | 3300004480 | Soil | VQAPEGKAEVRLGPGSYMMQPGGNYRHTTSCDKSADCVFFVESGGAFDLKPVEAGKAPAKQ* |
| Ga0062592_1021467882 | 3300004480 | Soil | KPEFRLGPGSYFMQPGGKYRHTTTCDKASDCVFLVESNGPFDFKPVDAGKGTRK* |
| Ga0062591_1019451371 | 3300004643 | Soil | FRLGPGSYFMQPGGNYRHTTSCDAAADCVFFVESKGKFDLKVVGAPPAGAKK* |
| Ga0062594_1004076402 | 3300005093 | Soil | SYMMQPGGNYRHTTSCDKASECVFFVESNGRFDLKLVEPGKAPAKK* |
| Ga0062594_1028108422 | 3300005093 | Soil | PEGKPEFRLGPGSYFMQPGGDYRHITTCDKASDCVFLVESGGPFDLKPVATGSVPAK* |
| Ga0066678_106803761 | 3300005181 | Soil | PGSYFLQPGGNYRHTTSCDPSSECVFFVESKGPFDLKVIQAATAAKK* |
| Ga0065714_101646781 | 3300005288 | Miscanthus Rhizosphere | PGGNYRHTTSCDKASECVFFVESNGRFDLKLVEPGKAPAKK* |
| Ga0068869_1001166711 | 3300005334 | Miscanthus Rhizosphere | YFLQPGGNYRHITTCDQASDCVFFVESKGPFDLKPVDAGGGSAK* |
| Ga0070666_111897052 | 3300005335 | Switchgrass Rhizosphere | LGPGSYLLQPGGSYQHTTSCDQAAPCIFFVESDGAFDLKPAPEK* |
| Ga0070661_1009786752 | 3300005344 | Corn Rhizosphere | GPGSYMMQPGGNYRHTTSCDKASECLFFVESNGKFDLKPVEGGSTPKK* |
| Ga0070668_1003225241 | 3300005347 | Switchgrass Rhizosphere | QAPKGQPEFRLGPGSYLLQPGGSYQHTTSCDQAAPCIFFVESDGAFDLKPAPEK* |
| Ga0070668_1017489612 | 3300005347 | Switchgrass Rhizosphere | PGSYFLQPGGSYRDTTTCDKAADCVFFVESKGPFDLKPVGAGQAR* |
| Ga0070671_1001282863 | 3300005355 | Switchgrass Rhizosphere | FRLGPGSYLFQPGGDYKHTTSCDKASECLIFAEGIGAFDLKPVEAAK* |
| Ga0070674_1021640851 | 3300005356 | Miscanthus Rhizosphere | VRLGPGSYMMQPGGNYRHTTSCDKASECLFFVESNGPFDLKVVEAAKAPAKK* |
| Ga0070694_1013891143 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | SGTYIQRPERKPEFRIGPGSYFMQPGGNYRHTTSCDTASDCVLFAESNGKFDLKLVDAGKAPAKK* |
| Ga0070708_1005305071 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | PEFRLGPGSYFMQPGGDYRHTTTCDQASDCVFFVESKGTFDLKPVDAGKATPR* |
| Ga0070708_1017215201 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | QAPEGKPEFRLGPGSYFLQPGGNYRHTTSCDPAAECVFFVEGKGKFDLKLVQPPATAPAKK* |
| Ga0066686_102867801 | 3300005446 | Soil | LQPGGNYRHTTSCDKASDCVFFAESNGKFDLKLVDAGKAPAKK* |
| Ga0066689_107156031 | 3300005447 | Soil | GGNYRHTTSCDMASDCVFFAESNGKFDLKLVDTGKAPAK* |
| Ga0066681_105730562 | 3300005451 | Soil | NYRHTTSCDPAAECLFFVEGKGKFDLKLVQPPATAPAKQ* |
| Ga0070663_1020853041 | 3300005455 | Corn Rhizosphere | PGSYMAQPGGTYRHTTSCDKASDCVFFVESSGPFDLKPVAAANAPAKK* |
| Ga0068867_1000652731 | 3300005459 | Miscanthus Rhizosphere | GSYMMQPGGNYRHTTSCDKASECLFFVESNGKFDLKPVEGGSTPKK* |
| Ga0068867_1010244261 | 3300005459 | Miscanthus Rhizosphere | YMMQPGGNYRHTTSCDKASECLFFVESNGPFDLKVVEAAKAPAKK* |
| Ga0070707_1000932481 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | YFMQPGGDYRHTTTCDQASDCVFFVESKGKFDLKPVDPGKATPR* |
| Ga0070707_1005406101 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | LYLPSTYRHTTACDKASECVFFIEGNRKFDVKPVEPAKAPAKK* |
| Ga0070698_1009702061 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | PEFRLGPGSYLMQPGGNYRHTTSCDKASECLFFAESNGKFDLKPVEVGKAPAKK* |
| Ga0070672_1000776761 | 3300005543 | Miscanthus Rhizosphere | PEGKAEFRLGPGSYLFQPGGDYKHTTACDKGSECVIFAESIGAFDLKPVEAAKK* |
| Ga0070686_1015520811 | 3300005544 | Switchgrass Rhizosphere | SYFLQPGGNYRHTTACDKASECVLFVESKGAFDLKMVEAGKAPAK* |
| Ga0070695_1013225931 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | PGSYFLQPGGNYRHTTACDPASDCVFFAESNGKFDLHVVDAGKAPAKN* |
| Ga0070696_1013712071 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | PGGNYRHTTSCDKASECLLFVEGSGKFDLKLVAAAQAPAKK* |
| Ga0066692_105678282 | 3300005555 | Soil | EGKPEFRLGAGSYFMQPGGNYRHTTSCDKASDCVLFAESHGKFDLKLVDAGKAPAKK* |
| Ga0066707_105773651 | 3300005556 | Soil | KPEFRLGPGSYFLQPGGNYRHTTSCDPAAECVFFVEGKGTFDLKLVQPPATAPAKK* |
| Ga0066707_106378331 | 3300005556 | Soil | KPEFRLGPGSYFLQPGGNYRHTTSCDPAAECVFFVEGKGKFDLKLVQPPAAAPAKQ* |
| Ga0066704_103080912 | 3300005557 | Soil | GSYFMQPGGNYRHTTSCDKASDCVLFAESHGKFDLKLVDAGKAPAKK* |
| Ga0066698_107320672 | 3300005558 | Soil | YFLQPGGNYRHTTSCDPAAECVFFVEGKGKFDLKLVQPPATAPAKK* |
| Ga0068854_1003520082 | 3300005578 | Corn Rhizosphere | GGNYRHTTACDAASECLFFAESSGKFDLHVVGGKAPAKN* |
| Ga0068861_1022511392 | 3300005719 | Switchgrass Rhizosphere | NYRHTTSCDTASECVFLAQSNGKFDLKLVQAPKAPAAN* |
| Ga0066903_1051358462 | 3300005764 | Tropical Forest Soil | QPGGSYKHTTSCDKASDCVFFTQASGKFDLIPVEAAAK* |
| Ga0066903_1062240262 | 3300005764 | Tropical Forest Soil | PEGKPEFRVGSGGYIMQPGGNYKHTTACDKASECLFFVQSTGKFDLKPVEAAKK* |
| Ga0068860_1011120662 | 3300005843 | Switchgrass Rhizosphere | PEGKAEFRLGPGSYLFQPGGDYKHTTGCDKGSECVIFAEGIGAFDLKPVEAAK* |
| Ga0068862_1009012503 | 3300005844 | Switchgrass Rhizosphere | QPGGNYRHTTSCDKASDCVFFVESSGAFDLKVVEAPKSAAKN* |
| Ga0068862_1021345881 | 3300005844 | Switchgrass Rhizosphere | QPGGNYRHTTSCDTASECVFLAQSNGKFDLKLVQAPKAPAAN* |
| Ga0066652_1004643296 | 3300006046 | Soil | GSYLFQPGGNYRHTPSCDKAADCVFFVEGDGAFDLKPVQTPTAAARP* |
| Ga0066652_1011862071 | 3300006046 | Soil | EVRLGPGSYMMQPGGNYRHTTSCDKASDCVFFVESNGKFDLKPVTAAGTAPAKK* |
| Ga0070715_108741011 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | LQPGGNYKHVTSCDKGSDCVFFVESNGKFDLKVVPPPAAKK* |
| Ga0079222_119308291 | 3300006755 | Agricultural Soil | GNYRHTTSCDAAADCVFFVESKGAFDLKPVDAGKRPAK* |
| Ga0066665_102613391 | 3300006796 | Soil | PEGKPEFRLGPGSYFLQPGGNYRHTTSCDPAAECVFFVEGKGKFDLKLVQPPATAPAKN* |
| Ga0066665_110059832 | 3300006796 | Soil | LQPGGNYRHTTSCDPAAECVFFVEGKGKFDLKLVQPPATAPAKK* |
| Ga0066659_103112641 | 3300006797 | Soil | MQPGGNYKHTTSCDMASDCVFFLQSNGKFDLKPADGGKAPAKK* |
| Ga0066659_108283373 | 3300006797 | Soil | GDYRHTTSCDQASECVFFVEGKGQFDLKPVDARKAPPS* |
| Ga0066659_108480222 | 3300006797 | Soil | GKPEFRLGPGSYFLQPGGNYRHTTSCDPAAECVFFVEGKGKFDLKLVQPPAAAPAKQ* |
| Ga0066659_109634511 | 3300006797 | Soil | GKPEFRLGPGSYFLQPGGNYRHTTSCDPAAECVFFVEGKGTFDLKLVQPPATAPAKK* |
| Ga0079220_102501032 | 3300006806 | Agricultural Soil | GPGSYMMQPGGTYRHTTSCDKSADCLFFVESNGPFDLKLVETPKGQP* |
| Ga0079220_106515522 | 3300006806 | Agricultural Soil | SYFMQPGGDYRHTTSCDQASDCVFFVESKGPFDLKLVDAGKAPPR* |
| Ga0075428_1013733701 | 3300006844 | Populus Rhizosphere | LAPGSYFMQPGGSYRHTTTCDKASDCVFFVESVGPFDLKPVDAGTAPTK* |
| Ga0075428_1014375202 | 3300006844 | Populus Rhizosphere | VRLGPGSYMMQPGGNYRHTTSCDKTSDCLFFVESNGAFDLKPVEATKAPGKE* |
| Ga0075421_1015032943 | 3300006845 | Populus Rhizosphere | GNYRHTTSCDKTSDCVFFVESNGAFDLKVVETAKPVKNP* |
| Ga0075421_1017040282 | 3300006845 | Populus Rhizosphere | EVRLGPGGYMMQPGGNYRHTTACDKASECVFFVEGSGAFDLKIVEAGKTPPKK* |
| Ga0075421_1025688912 | 3300006845 | Populus Rhizosphere | GGNYRHTTSCDKGSECLFFVESNGAFDLKLVEAGHAPAKK* |
| Ga0075430_1007390692 | 3300006846 | Populus Rhizosphere | EFRIGPGSYFMQPGGDYRHTTTCDKAADCVFFVESSGAFDLKPVAATTAPAQ* |
| Ga0075431_1007224222 | 3300006847 | Populus Rhizosphere | MLQPGGNYRHTTSCDKASECVLFVDGTGKFDLKMAETAKPPAKK* |
| Ga0075431_1007573222 | 3300006847 | Populus Rhizosphere | GNYRHTTACGKDAECVLFVESNGAFDLKLVEAGKAPAKK* |
| Ga0075433_105528412 | 3300006852 | Populus Rhizosphere | APEFHLGPGSYLMQPGGNYRHTTRCDTSSECVFFAESDGPFDLKVAR* |
| Ga0075425_1003635771 | 3300006854 | Populus Rhizosphere | QAPEGKADVRLGPGSYMMQPGGNYRHTTSCDKSADCVFFVESSGAFDLKPVEAGKAPAKQ |
| Ga0075425_1030651121 | 3300006854 | Populus Rhizosphere | GKPEFRLGPGSYLMQPGGHYWHTTSCDKASECLFFVESKGKFDLMVKDAGKAAAKK* |
| Ga0075429_1000135758 | 3300006880 | Populus Rhizosphere | MMQPGGNYRHTTSCDKASECLFFVESNGPFDLRVAETPKPVAKNP* |
| Ga0068865_1020210561 | 3300006881 | Miscanthus Rhizosphere | GPGSYFLQPGGSYRHTTTCDKAADCVFFVESKGPFDLKPVGAGQAR* |
| Ga0079215_104532792 | 3300006894 | Agricultural Soil | GGNYRHTTSCGKTSDCVFFVESDGPFDLKVVQDKGRARY* |
| Ga0075426_106185613 | 3300006903 | Populus Rhizosphere | VRLPSGSYLKQPGDRYCHTTECDKGSDCVVFAESGGAFDLKPVENGKAPEKK* |
| Ga0075426_107645871 | 3300006903 | Populus Rhizosphere | GKPEVRLGPGSYLNQPGDGYRHTTSCDQASECLFFAQSNGKFDLKPVAGKAPAKK* |
| Ga0075426_109085452 | 3300006903 | Populus Rhizosphere | PGSYMMQPGGNYRHTTSCDKSADCVFFVESSGAFDLKPVEAGKAPAKQ* |
| Ga0075426_113243192 | 3300006903 | Populus Rhizosphere | GSYMLQPGGNYRHTTSCDKAADCVFFVASNGAFDLKPVQTGTAATK* |
| Ga0075424_1001312444 | 3300006904 | Populus Rhizosphere | GPGSYMMQPGGNYRHTTSCDKASECLFFVESNGKFDLKPVEGGSTPKKQL* |
| Ga0075424_1027769671 | 3300006904 | Populus Rhizosphere | YKHVTKCDKASECLIFSESTGAFDLIPVEGAGAPKK* |
| Ga0075436_1002220263 | 3300006914 | Populus Rhizosphere | MGPGSYVKQPGGNYRHISACDKASECVLFIESAGKFDLKVVDLGKKAPAK* |
| Ga0079216_119015822 | 3300006918 | Agricultural Soil | VRLGPGSYMLQPGGNYWHTTSCDKASECLFFVEGNGKFDLKVVEAAPVA |
| Ga0079219_101168491 | 3300006954 | Agricultural Soil | EFRLGPGSYFMQPGGDYRHTTSCDQASDCVFFVESKGPFDLKLVDAGKAPPR* |
| Ga0079218_113998261 | 3300007004 | Agricultural Soil | VRLGPGSYMMQPGGNYRHVTSCDKASDCVLFVVGAGKFDLKVVDAPKGPAKLIE* |
| Ga0066710_1001940961 | 3300009012 | Grasslands Soil | KPEFRLGPGSYFRQPGGNYRHTTSCDMASDCVFFAESNGKFDLKLVDTGKAPAK |
| Ga0066710_1010608404 | 3300009012 | Grasslands Soil | MMQPGGNYKHTTSCDKASDCVFFTQANGKFDLKPVAAPKAPAKK |
| Ga0066710_1015332563 | 3300009012 | Grasslands Soil | MDSASSLGPGSYFMQPGGNYRHTTSCDKASDCVFFAESNGKFDLKLVDAGKAPAKK |
| Ga0066710_1021704113 | 3300009012 | Grasslands Soil | QAPEGKPEFRLGPGSYFLQPGGDYRHTTTCDKASDCVFFVEGKGAFDLKPVDAGTTPAK |
| Ga0066710_1022401452 | 3300009012 | Grasslands Soil | GNYRHTTSCDKASDCVFFVESNGKFDLKPAQAGSAPAKK |
| Ga0099829_105918012 | 3300009038 | Vadose Zone Soil | MQPGGNYRHTTRCDKASDCVFFAESNGKFDLKPVDAGKAPAKK* |
| Ga0099828_113630552 | 3300009089 | Vadose Zone Soil | GGNYRHTTSCDKVSDCVFFAESNGKFDLKVVNEGKAPAKK* |
| Ga0099827_112815951 | 3300009090 | Vadose Zone Soil | GNYKHTTSCDKASECVFLVQSNGKFDLKPVEAGKAPEKKK* |
| Ga0111539_105408913 | 3300009094 | Populus Rhizosphere | PGSYFMQPGGDYRHTTTCDKAADCVFFVESSGAFDLKPVAVTTAPAR* |
| Ga0111539_108659112 | 3300009094 | Populus Rhizosphere | YFLQPGGSYRHTTTCDKAADCVFFVESKGPFDLKLVGAGQAP* |
| Ga0111539_117587672 | 3300009094 | Populus Rhizosphere | PGSYFMQPGGDYRHTTTCDKAADCVFFVESSGAFDLKPVAATTAPAQ* |
| Ga0075418_114465031 | 3300009100 | Populus Rhizosphere | PGGNYRHTTSCDKTSDCLFFVESNGAFDLKPVEATKAPGKE* |
| Ga0075418_118626021 | 3300009100 | Populus Rhizosphere | GGSYRHTTTCDKASDCVFFVESVGPFDLKPVDAGTAPTK* |
| Ga0066709_1003241681 | 3300009137 | Grasslands Soil | PGSYFLQPGGNYRHTTSCDPAAECVFFVEGKGKFDLKLVQPPATAPAKP* |
| Ga0066709_1006376782 | 3300009137 | Grasslands Soil | PEGKPEFRLGPGSYFLQPGGNYRHTTSCDPAAECVFFVEGKGKFDLKLVQPPATAPAKK* |
| Ga0066709_1018002021 | 3300009137 | Grasslands Soil | PGSYFLQPGGNYRHTTSCDPAAECVFFVEGKGKFDLKLVQPPATAPAKK* |
| Ga0066709_1042262492 | 3300009137 | Grasslands Soil | GPGSYLNQPGDGYRHTTSCDSASECVFFAQSTGKFDLKVVGAAKAPAKK* |
| Ga0114129_118129632 | 3300009147 | Populus Rhizosphere | LMQPGGHYWHSTSCDKASECLFFVESKGNFDLMLKDAGKAAAKKM* |
| Ga0114129_124565802 | 3300009147 | Populus Rhizosphere | GSYLMQPGGDYRHTTRCDTRSECVFFVESDGPFDLRVPR* |
| Ga0105243_120954402 | 3300009148 | Miscanthus Rhizosphere | GKPEFRIGPGSYFLQPGGNYRHTTACDAASECLFFAESSGKFDLHVVGGKAPAKN* |
| Ga0111538_107385692 | 3300009156 | Populus Rhizosphere | MMQPGGNYRHTTSCDKTSECVFFVESSGKFDLRPVEPVKK* |
| Ga0105092_108423242 | 3300009157 | Freshwater Sediment | YFMQPGGDYRHTTACDKASECLFYAESSGAFDLKVVDAGRAPAGK* |
| Ga0075423_102817131 | 3300009162 | Populus Rhizosphere | EGKPEFRIGPGSYFLQPGGNYRHTTACDAASECLFFAESSGKFDLHVVGGKAPAKN* |
| Ga0075423_111957312 | 3300009162 | Populus Rhizosphere | MQPGGNYRHTTSCDKASDCVFFTQANGKFDLKPVGVPAKKM* |
| Ga0105074_10093872 | 3300010029 | Groundwater Sand | AEGKPEVRLGPGSYLKQPGGNYRHTTACDKAAECVIFAESNGKFDIKLVEAGKAPEKK* |
| Ga0105074_10827662 | 3300010029 | Groundwater Sand | LGPGSYMLQPGEGYRHTTTCDKASECLVHVESKGKFDLMPVAEGTAPAKK* |
| Ga0134070_101301331 | 3300010301 | Grasslands Soil | GGNYRHTTSCDPAAECVFFVEGKGKFDLKLVQPPATAPAKQ* |
| Ga0134070_103118872 | 3300010301 | Grasslands Soil | GGNYRHTTSCDPAAECVFFVEGKGKFDLKLVQPPATAPAKR* |
| Ga0134064_104709282 | 3300010325 | Grasslands Soil | EGKPEFRLGPGSYFLQPGGNYRHTTSCDPAAECVFFVEGKGKFDLKLVQPPATAPAKP* |
| Ga0134080_105428421 | 3300010333 | Grasslands Soil | TSCDPAAECVFFVEGKGKFDLKLVQPPATAPAKK* |
| Ga0126376_102864932 | 3300010359 | Tropical Forest Soil | MMQPGGNYRHVTSCDKSADCVLFVESSGPFDLKPVQK* |
| Ga0126379_101737833 | 3300010366 | Tropical Forest Soil | LGPGSYLMQPGGNYKHTTACDKASDCVFFAQSTGNFDLKPVEAPKAAEPAKK* |
| Ga0134128_122418821 | 3300010373 | Terrestrial Soil | QPGGNYRHTTSCDTASDCVLFAESNGKFDLKLVDAGKTPAKK* |
| Ga0134123_102214721 | 3300010403 | Terrestrial Soil | PGGNYRHTTSCDKSADCVFFVESGGAFDLKPVEAGKAPAKQ* |
| Ga0134123_106063051 | 3300010403 | Terrestrial Soil | MQPGGDYRHITTCDKASDCVFLVESGGPFDLKPVATGSVPAK* |
| Ga0105246_109109192 | 3300011119 | Miscanthus Rhizosphere | EVRLGPGSYMMQPGGNYRHTTSCDKASECLFFVESNGKFDLKPVEGGSTPKK* |
| Ga0137391_103983893 | 3300011270 | Vadose Zone Soil | LGPGSYLMQPGGNYRHTTACDKASECLFFAESNGKFDLKPADQGKAPAKK* |
| Ga0137391_107866931 | 3300011270 | Vadose Zone Soil | EFRLGPGSYFLQPGGNYRHTTTCDPAAECVFFVEGKGKFDLKLVQPPATAPTKK* |
| Ga0137340_10274562 | 3300011405 | Soil | FMQPGGKYRHTTTCDKASDCVFLVESNGPFDLKVVDVAKGTKK* |
| Ga0137427_102473793 | 3300011445 | Soil | PGGYMLQPGGNYRHVTSCDKASDCVLFVESDGPFDLKVVETAKPPA* |
| Ga0136623_100437171 | 3300012045 | Polar Desert Sand | PGGNYRHTTLCDNASECVFFVQSKGKFDLLPVGGEKAPAPAKE* |
| Ga0137364_103511232 | 3300012198 | Vadose Zone Soil | SYFLQPGGNYRHTTSCDPAAECVFFVEGKGKFDLKLVQPPATAPAK* |
| Ga0137364_105950621 | 3300012198 | Vadose Zone Soil | GKPEVRLGPGSYLNQPGDGYRHTTSCDSASECVFFAQSTGKFDLKVVGAAKAPAKK* |
| Ga0137383_105526383 | 3300012199 | Vadose Zone Soil | DYRHTTSCDQASDCVFFVEGKGKFDLKPVDAGKAPHR* |
| Ga0137365_100469811 | 3300012201 | Vadose Zone Soil | KPEFRLGPGSYFLQPGGNYRHTTSCDPAAECVFFGEGKGKFDLKLVQPPATAPAKK* |
| Ga0137365_101030485 | 3300012201 | Vadose Zone Soil | SYFMQPGGDYRHTTSCDQASDCVFFVESKGKFDLKPVDAGKTPPR* |
| Ga0137381_110050922 | 3300012207 | Vadose Zone Soil | MQPGGNYRHSTACDKASECVFFIQSTGKFDLIPVEAGKAPAKK* |
| Ga0137381_116664752 | 3300012207 | Vadose Zone Soil | SYFMQPGGNYRHTTTCDQASDCVFFVESGGKFDLKPVDAGKAPAKK* |
| Ga0137376_101830801 | 3300012208 | Vadose Zone Soil | LGPGSYFMQPGGAYRHTTSCDQASDCVFFVEGKGKFDLKPVDAGKAPHR* |
| Ga0137376_103867081 | 3300012208 | Vadose Zone Soil | LQPGGNYRHTTSCDPAAECVFFVEGKGKFDLKLVQPPATAPAKQ* |
| Ga0137376_111479921 | 3300012208 | Vadose Zone Soil | SYFLQPGGNYRHTTSCDPAAECVFFVEGKGKFDLKLVQPPAAAPAKQ* |
| Ga0137376_113305431 | 3300012208 | Vadose Zone Soil | GNYRHTTSCDPAAECVFFVEGKGKFDLKLVQPPAAAPAK* |
| Ga0137376_113845822 | 3300012208 | Vadose Zone Soil | GGNYRHTTACDKASECLFFAQSNGKFDLKPADGGKAPAKK* |
| Ga0137378_107784774 | 3300012210 | Vadose Zone Soil | HTTSCDPAAECVFFVEGKGKFDLKLVQPPATAPAKK* |
| Ga0137377_106017703 | 3300012211 | Vadose Zone Soil | TPEGKPEFRLGPGSYFLQPGGNYRHTTSCDPAADCVFFVEGKGKFDLKLVQPPATAPAKQ |
| Ga0137377_111661083 | 3300012211 | Vadose Zone Soil | YRHTTSCDPAAECVFFVEGKGKFDLKLVQPPATAPAKK* |
| Ga0137377_118007771 | 3300012211 | Vadose Zone Soil | KPEFRLGPGSYFLQPGGNYRHTTSCDPAAECVFFVEGKGQFDLKLVQPPAAAPAKQ* |
| Ga0137386_107235862 | 3300012351 | Vadose Zone Soil | PGGNYRHTPSCDPATECVFFVEGKGKFDLKLVQPPATAPAKQ* |
| Ga0137384_104329561 | 3300012357 | Vadose Zone Soil | KPEFRLGPGSYFMQPGGNYRHTTTCDKASDCVFLVESSGPFDLKPADAAKGPTK* |
| Ga0137384_105458551 | 3300012357 | Vadose Zone Soil | TSCDPAAECVFFVEGKGKFDLKLVQRPATAPAKK* |
| Ga0137384_107115471 | 3300012357 | Vadose Zone Soil | GPGSYLNQPGDGYRHTTSCDAASECVFFAQSNGKFDLKPVPAGKAPAKK* |
| Ga0137384_111385252 | 3300012357 | Vadose Zone Soil | LYLPSTYRHTTACDKASECVFFIEGDRKFDVKPVEPAKAPVKK* |
| Ga0137368_107252802 | 3300012358 | Vadose Zone Soil | GPGSYLMQPGGNYRHTTSCDKASECVFFAESNGKFDLKPVEAGKAPAKM* |
| Ga0137368_109886722 | 3300012358 | Vadose Zone Soil | PEGKAEVRLGPGSYMMQPGGNYRHTTSCDKASECLFFVESNGGFDLKPVEAGKAPAKK* |
| Ga0137375_104567934 | 3300012360 | Vadose Zone Soil | SYLAQPGGNYRHTTSCDSASECVFFAQSNGKFDLKPAAAGKTGAKK* |
| Ga0137375_108205523 | 3300012360 | Vadose Zone Soil | SYLAQPGGNYRHTTSCDSASECVFFAQSNGKFDLKPAAAGKAGAKK* |
| Ga0137390_106945431 | 3300012363 | Vadose Zone Soil | RHTTSCDPAAECVFFVEGKGRFDLKLVQPPATAPAKK* |
| Ga0136612_104356061 | 3300012680 | Polar Desert Sand | ARLGPGSYFLQPGGNYRHTTTCHPASDCVFFVESQGTFDLKPVDAGKGPSK* |
| Ga0136613_101972521 | 3300012681 | Polar Desert Sand | RLAPGSYMMQPGGNYRHITSCDKASECLFFAESSGKFDLKVIEAPKGPAKR* |
| Ga0137397_111597162 | 3300012685 | Vadose Zone Soil | GGNYRHTTSCDKASDCVFFAESNGKFDLKLVDAGKAPAKK* |
| Ga0157305_102671402 | 3300012891 | Soil | PGGNYRHVTSCDKASDCVFFVESDGPFDLKVVETAKPPA* |
| Ga0157282_103023152 | 3300012904 | Soil | PEFRLGPGSYFMQPGGNYRHTTTCDKASDCVFFVESKGPFDLKVVDAGKGTSK* |
| Ga0137396_105883271 | 3300012918 | Vadose Zone Soil | NYRHTTSCDPAAECVFFVEGKGKFDLKLVQPPATAPAKK* |
| Ga0137396_105926761 | 3300012918 | Vadose Zone Soil | IQAPEGKPEFRLGAGSYFLQPGGNYRHTTSCDPAAECVFFVEGKGQFDLKLVQPPATAPAKK* |
| Ga0137407_121758931 | 3300012930 | Vadose Zone Soil | YFLQPGGNYRHTTSCDPSSECVFFVEGKGKFDLKLVQAATAAKK* |
| Ga0164302_108201862 | 3300012961 | Soil | MMQPGGNYRHTTSCDKASECLFFVESNGKFDLKPVEGGSTPKK* |
| Ga0134077_102940722 | 3300012972 | Grasslands Soil | MQPGGNYRHTTSCDTASDCVFFAESNGKFDLKLVDTGKAPAK* |
| Ga0164304_107813622 | 3300012986 | Soil | RLGPGSYFLQPGGNYRHTTTCDTASDCVFLVESKGPFDLKLVDAGNGPTK* |
| Ga0134075_101050401 | 3300014154 | Grasslands Soil | QTPEGKPEFRLGPGSYFLQPGGNYRHTTSCDPAAECVFFVEGKGKFDLKLVQPPATAPAKK* |
| Ga0134075_103388632 | 3300014154 | Grasslands Soil | RLGPGSYFLQPGGNYRHTTSCDPAAECLFFVEGKGKFDLKLVQPPATAPAKK* |
| Ga0173483_110058852 | 3300015077 | Soil | EVRLGPGSYMMQPGGNYRHTTSCDKASDCVFFVESGGAFDLKPVEAGKAPAKQ* |
| Ga0180067_10134331 | 3300015257 | Soil | KPEFRLGPGSYFMQPGGKYRHTTSCDKASDCVFLVESNGPFDLKAVDVAKGTKK* |
| Ga0134085_102678161 | 3300015359 | Grasslands Soil | GSYFLQPGGNYRHTTSCDPAAECVFFVEGKGKFDLKLVQPPATAPAKQ* |
| Ga0132258_103385611 | 3300015371 | Arabidopsis Rhizosphere | KAEFRLGPGSYLFQPGGDYKHTTACDKGSECVIFAESIGAFDLKPVEAAKK* |
| Ga0132257_1018428171 | 3300015373 | Arabidopsis Rhizosphere | PEGKTPIRLGPGSYLMQAGGGYRHTTKCDKASDCVMFADGRGKFDIHMVDGKK* |
| Ga0134083_102994232 | 3300017659 | Grasslands Soil | MQPGGNYRHTTSCDKASDCVFFAESNGKFDLKLVDAGKAPAKK |
| Ga0187821_103853191 | 3300017936 | Freshwater Sediment | YRHTTSCDTASDCVFFLQSPGKFDLKVVDTAKAADPEKK |
| Ga0187777_105975452 | 3300017974 | Tropical Peatland | YVFQPAGNYKHTTACDKASDCLIFVESSGRFDLKPVAAK |
| Ga0184605_104981751 | 3300018027 | Groundwater Sediment | RLGPGSYMMQPGGNYRHTTSCDKASVCLFFVEGNGKFDLKPVDAGKAPAKK |
| Ga0184608_100700773 | 3300018028 | Groundwater Sediment | GGNYRHTTSCDKASDCLFFVEGNGAFDLKPAEAGKAPAKK |
| Ga0184623_101670991 | 3300018056 | Groundwater Sediment | KAEVRLGPGSYMMQPGGNYRHTTSCDKASECLFFVESTGKFDLKLVGAGKAPAKK |
| Ga0184615_103936432 | 3300018059 | Groundwater Sediment | FLSGTYLQAPEGKPEVRLGTGSYMVQPGGNYRHTTGCDKGSECLFFVESDGPFDLHVVPEATAPAKK |
| Ga0184629_101846353 | 3300018084 | Groundwater Sediment | YLMQPGGNYRHTTSCDQASECVFFVESNGPFDLLPVVTAKPAAPK |
| Ga0184629_103830821 | 3300018084 | Groundwater Sediment | HTTSCDKASECLFFVESNGAFDLKPVEVGKAPAKK |
| Ga0190265_100705413 | 3300018422 | Soil | GGNYRHTTACDKASECVFFVESTGKFDLKPVEAGKAPAKP |
| Ga0066667_103442121 | 3300018433 | Grasslands Soil | EGKPEFRLGPGSYLLQPGGNYRHTTSCDPNSECVFFVESKGRFDLKPVQAATAAKK |
| Ga0066667_105005643 | 3300018433 | Grasslands Soil | GPGSYFLQPGGNYRHTTSCDPAAECVFFVEGKGTFDLKLVQPPATAPAKK |
| Ga0190268_113460182 | 3300018466 | Soil | MQPGGNYRHTTVCDKTADCVFLVESKGAFDFKPVDVGKRAVK |
| Ga0066662_106066672 | 3300018468 | Grasslands Soil | YRHTTSCDKASDCLFFVESNGAFDLKPVEAGKAPAKK |
| Ga0066662_111255272 | 3300018468 | Grasslands Soil | FLQPGGNYRHTTSCDPAAECVFFVDGKGKFDLKLVQPPATAPAKK |
| Ga0190270_102658751 | 3300018469 | Soil | KAEVRMSPGSYMMQPGGNYRHTTSCGKASECVFFLESEGAFDLVPVAAGTAPAKK |
| Ga0209640_107613222 | 3300025324 | Soil | YRHTTSCDKTSDCVFYAESSGGFDLMLVDEGKTPAKK |
| Ga0207654_112904142 | 3300025911 | Corn Rhizosphere | NYRHITSCDKAAECVLFVESGGKFDLKPVDTGKATAKK |
| Ga0207695_111593992 | 3300025913 | Corn Rhizosphere | GGNYRHTTACDAASECLFFAESSGKFDLHVVEGGKAPAKN |
| Ga0207657_105398182 | 3300025919 | Corn Rhizosphere | QPGGNYRHTTACDAASECLFFAESSGKFDLHVVEGGKAPAKN |
| Ga0207646_104723252 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | YLYLPSTYRHTTACDKASECVFFIEGNRKFDVKPVEPAKAPAKK |
| Ga0207646_106768683 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | PGGDYRHTTTCDQASDCVFFVESKGKFDLKPVDAGKAPPR |
| Ga0207681_113522701 | 3300025923 | Switchgrass Rhizosphere | EGKPEFRLGPGSYFMQPGGDYRHITRCDQASDCVFFVESLGAFDLKLAEAGKKP |
| Ga0207681_114500632 | 3300025923 | Switchgrass Rhizosphere | PEFRLGPGSYFMQPGGNYRHTTTCDAASECVFLVETKGPFDLKVVETAKAPAKQ |
| Ga0207659_110506792 | 3300025926 | Miscanthus Rhizosphere | QPGGSYRHTTTCDKAAECVFFVESKGPFDLKPVAATTAPAQ |
| Ga0207701_102563733 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | MQPGGNYRHTTSCDKASECLFFVESNGKFDLKPVEGGSTPKK |
| Ga0207686_106948442 | 3300025934 | Miscanthus Rhizosphere | GSYFLQPGGNYRHITTCDQASDCVFFVESKGPFDLKPVDAGGSAK |
| Ga0207669_100466411 | 3300025937 | Miscanthus Rhizosphere | FRLGPGSYLLQPGGSYQHTTSCDQAAPCIFFVESDGAFDLKPAPEK |
| Ga0207677_113293262 | 3300026023 | Miscanthus Rhizosphere | PGGNYRHITTCDQASDCVFFVESKGPFDLKPVDPGGSAK |
| Ga0207676_114952142 | 3300026095 | Switchgrass Rhizosphere | PGSYLFQPGGDYKHTTGCDKGSECVIFAEGIGAFDLKPVEAAK |
| Ga0207676_123925332 | 3300026095 | Switchgrass Rhizosphere | KPEFRLGPGSYLFQPGGEYKHTTACDKASECLIFAEGIGAFDLKPVETKK |
| Ga0209469_10166966 | 3300026307 | Soil | QPGGDYRHTTSCDQASDCVFFVESKGKFDLKLVDAGKTPPR |
| Ga0209155_11255732 | 3300026316 | Soil | YFVQPGGDYRHTTSCDQASDCVFFVEGKGKFDLKPVDAGKAAPR |
| Ga0209470_13794191 | 3300026324 | Soil | GSYFLQPGGDYRHTTSCDPTSDCVFFVEGKGKFDLKPVDAGKAAPR |
| Ga0209470_13853382 | 3300026324 | Soil | FRLGPGSYFMQPGGDYRHTTSCDQASDCVFFVESKGKFDLKLVDAGKTPPR |
| Ga0209803_12360412 | 3300026332 | Soil | PEGKPEFRLGPGSYFLQPGGNYRHTTSCDPAAECLFFVEGKGKFDLKLVQPPATAPAKK |
| Ga0209056_104682881 | 3300026538 | Soil | LGPGSYFLQPGGNYRHTTSCDPAAECVFFVEGKGKFDLKLVQPPAAAPAKQ |
| Ga0209214_10464441 | 3300027071 | Forest Soil | PEGKAEFALGPGSALKQPGGNYKHTTRCDKSSDCVFFVESSGPFDLLPVESAKKQ |
| Ga0208988_11578701 | 3300027633 | Forest Soil | FRLGPGSYLMQPGENYRHTTSCDKASECVFFAQSNGKFDLKVVDAAKAPAKK |
| Ga0209073_100044958 | 3300027765 | Agricultural Soil | FMQPGGDYRHTTSCDQASDCVFFVESKGPFDLKLVDAGKAPPR |
| Ga0209177_100825351 | 3300027775 | Agricultural Soil | YFMQPGGDYRHTTSCDQASDCVFFVESKGPFDLKLVDAGKAPPR |
| Ga0209177_102505742 | 3300027775 | Agricultural Soil | SYMFQPGGNYRHVTACDKAADCVFFVESDGPFDLKPVDAKGGAAK |
| Ga0209486_100137991 | 3300027886 | Agricultural Soil | AEFRLGPGSYLMQPGGDYRHTTGCDQSSDCVFFDESEGAFDLHAVTGTAPPSN |
| Ga0209486_107998241 | 3300027886 | Agricultural Soil | GPGSYMMQPGGNYRHVTSCDKASDCVLFVVGAGKFDLKVVDAPKGPAKLIE |
| Ga0209486_110675321 | 3300027886 | Agricultural Soil | PEVRLGPGSYMMQPGGNYKHTTSCDKASECLFFVLGSGKFDLKVVEPPKAPAKK |
| Ga0209382_101942783 | 3300027909 | Populus Rhizosphere | MQPGGNYRHTTSCDKTSDCVFFVESNGPFDLKVVETAKPVKNS |
| Ga0209382_121502821 | 3300027909 | Populus Rhizosphere | RHSTSCDKASECLFFVESSGAFDLKVIETPKPIAKNP |
| Ga0268266_114757691 | 3300028379 | Switchgrass Rhizosphere | GSYMMQPGGNYRHITSCDKAAECVLFVESGGKFDLKPVDTGKATAKK |
| Ga0268264_104547622 | 3300028381 | Switchgrass Rhizosphere | FLQPGGNYRHTTACDAASECLFFAESSGKFDLHVVEGGKAPAKN |
| Ga0137415_102011091 | 3300028536 | Vadose Zone Soil | LGPGSYFLQPGGNYRHTTSCDPAAECVFFVEGKGKFDLKLVQPPATAPAKK |
| Ga0247823_109064893 | 3300028590 | Soil | LTPGSYLMQPGGNYRHVTACDKASDCVFFFESDGPFDLKMVQQ |
| Ga0247822_103778603 | 3300028592 | Soil | PEGKAEVRLGPGSYMMQPGGNYRHTTSCDKASDCLFFVESNGAFDLKPVEAAKAPAKK |
| Ga0247822_117421881 | 3300028592 | Soil | IQAPEGKPEVRLGAGSYMMQPGGNYRHTTSCDKTSDCVFFVESNGAFDLKVVETAKPVKN |
| Ga0310887_109914601 | 3300031547 | Soil | MQPGGNYRHTTSCDKSADCVFFVESAGAFDLKPVVKPPTAK |
| Ga0318555_107864261 | 3300031640 | Soil | PEGKPEIRLGPGSYLGQPGGNYKHTTSCDKASDCVFFTQANGKFDLLPVEAAAK |
| Ga0310900_115551102 | 3300031908 | Soil | PGSYMMQPGGNYRHTTSCDKTSECVFFVESSGKFDLRPVEPVKK |
| Ga0307416_1017399851 | 3300032002 | Rhizosphere | MQPGGNYRHITSCDKAADCVFFVESGGAFDLKPVTTGKPPAQN |
| Ga0307416_1024527502 | 3300032002 | Rhizosphere | LQAPEGKAEVRLGPGSYMMQPGGNYRHTTSCDKASECLFFVESTGKFDLKPVEQAKAPAK |
| Ga0310895_102225923 | 3300032122 | Soil | QPGGNYRHTTTCDQAAECVFLVESKGPFDLKLVAAGKTAK |
| Ga0310889_103329483 | 3300032179 | Soil | VRLGPGGYMLQPGGNYRHVTSCDKASDCVFFVESDGPFDLKVVETAKPAA |
| Ga0307471_1000419526 | 3300032180 | Hardwood Forest Soil | PEGAPVFRLGPGSYLMQPGGNYRHTTSCDAASDCVFFVEGNGAFDLHVVAANAPAPK |
| Ga0307471_1026556701 | 3300032180 | Hardwood Forest Soil | KQPGGNYRHTTTCDKASECVFLVVSKGPFDLMPVDNGKGVAKD |
| Ga0307472_1023489641 | 3300032205 | Hardwood Forest Soil | GNYRHTTSCDKASECLFFIESTGKFDLIPAEAAKSPAKM |
| Ga0306920_1042880752 | 3300032261 | Soil | PGSYLMQPGGNYKHTTACDKASDCVFFTQSAGKFDLKPVEAPKAAEPAKK |
| Ga0316628_1027630041 | 3300033513 | Soil | PGADYRHTTSCDKASDCVFYAESDGAFDLHVVDQGKAPAKK |
| Ga0247829_117459711 | 3300033550 | Soil | TPGSYLMQPGGNYRHVTACDKASDCVFFFESDGPFDLKMVQQ |
| Ga0364925_0133010_42_170 | 3300034147 | Sediment | MLQPGGSYRHVTSCDKASDCVFFVESDGPFDLKVVETAKPPA |
| ⦗Top⦘ |