| Basic Information | |
|---|---|
| Family ID | F017023 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 243 |
| Average Sequence Length | 48 residues |
| Representative Sequence | MKIYNLTGYLIIFCYMLACMYSAPAHLGPWIGMLIGGAYFIFCWF |
| Number of Associated Samples | 199 |
| Number of Associated Scaffolds | 243 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 88.89 % |
| % of genes near scaffold ends (potentially truncated) | 98.77 % |
| % of genes from short scaffolds (< 2000 bps) | 90.12 % |
| Associated GOLD sequencing projects | 182 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.36 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (91.358 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (15.638 % of family members) |
| Environment Ontology (ENVO) | Unclassified (26.749 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (51.440 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 47.95% β-sheet: 0.00% Coil/Unstructured: 52.05% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.36 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 243 Family Scaffolds |
|---|---|---|
| PF01872 | RibD_C | 3.70 |
| PF14066 | DUF4256 | 2.88 |
| PF00106 | adh_short | 2.47 |
| PF02913 | FAD-oxidase_C | 2.47 |
| PF00266 | Aminotran_5 | 1.65 |
| PF03795 | YCII | 1.23 |
| PF05163 | DinB | 1.23 |
| PF12704 | MacB_PCD | 1.23 |
| PF07993 | NAD_binding_4 | 1.23 |
| PF00903 | Glyoxalase | 1.23 |
| PF13181 | TPR_8 | 0.82 |
| PF13414 | TPR_11 | 0.82 |
| PF13174 | TPR_6 | 0.82 |
| PF05195 | AMP_N | 0.82 |
| PF00749 | tRNA-synt_1c | 0.82 |
| PF07681 | DoxX | 0.82 |
| PF00150 | Cellulase | 0.82 |
| PF14684 | Tricorn_C1 | 0.82 |
| PF00208 | ELFV_dehydrog | 0.82 |
| PF00596 | Aldolase_II | 0.82 |
| PF03486 | HI0933_like | 0.82 |
| PF04072 | LCM | 0.82 |
| PF13442 | Cytochrome_CBB3 | 0.41 |
| PF04073 | tRNA_edit | 0.41 |
| PF08937 | DUF1863 | 0.41 |
| PF00227 | Proteasome | 0.41 |
| PF01022 | HTH_5 | 0.41 |
| PF09720 | Unstab_antitox | 0.41 |
| PF01638 | HxlR | 0.41 |
| PF01565 | FAD_binding_4 | 0.41 |
| PF12146 | Hydrolase_4 | 0.41 |
| PF09900 | DUF2127 | 0.41 |
| PF06123 | CreD | 0.41 |
| PF03459 | TOBE | 0.41 |
| PF00486 | Trans_reg_C | 0.41 |
| PF13590 | DUF4136 | 0.41 |
| PF07992 | Pyr_redox_2 | 0.41 |
| PF04185 | Phosphoesterase | 0.41 |
| PF01928 | CYTH | 0.41 |
| PF13376 | OmdA | 0.41 |
| PF06742 | DUF1214 | 0.41 |
| PF01042 | Ribonuc_L-PSP | 0.41 |
| PF00383 | dCMP_cyt_deam_1 | 0.41 |
| PF13701 | DDE_Tnp_1_4 | 0.41 |
| PF08818 | DUF1801 | 0.41 |
| PF05496 | RuvB_N | 0.41 |
| PF00930 | DPPIV_N | 0.41 |
| PF01904 | DUF72 | 0.41 |
| PF00069 | Pkinase | 0.41 |
| PF00590 | TP_methylase | 0.41 |
| PF03466 | LysR_substrate | 0.41 |
| PF01425 | Amidase | 0.41 |
| PF07603 | DUF1566 | 0.41 |
| PF00994 | MoCF_biosynth | 0.41 |
| PF13578 | Methyltransf_24 | 0.41 |
| PF01494 | FAD_binding_3 | 0.41 |
| PF08327 | AHSA1 | 0.41 |
| PF01740 | STAS | 0.41 |
| PF03190 | Thioredox_DsbH | 0.41 |
| PF02321 | OEP | 0.41 |
| PF12681 | Glyoxalase_2 | 0.41 |
| PF01553 | Acyltransferase | 0.41 |
| PF02518 | HATPase_c | 0.41 |
| PF08241 | Methyltransf_11 | 0.41 |
| PF03841 | SelA | 0.41 |
| PF02894 | GFO_IDH_MocA_C | 0.41 |
| PF05721 | PhyH | 0.41 |
| PF00188 | CAP | 0.41 |
| PF06441 | EHN | 0.41 |
| PF01869 | BcrAD_BadFG | 0.41 |
| PF13426 | PAS_9 | 0.41 |
| PF00194 | Carb_anhydrase | 0.41 |
| PF03544 | TonB_C | 0.41 |
| PF01479 | S4 | 0.41 |
| PF03741 | TerC | 0.41 |
| PF02452 | PemK_toxin | 0.41 |
| PF14534 | DUF4440 | 0.41 |
| PF12697 | Abhydrolase_6 | 0.41 |
| PF00072 | Response_reg | 0.41 |
| PF07228 | SpoIIE | 0.41 |
| COG ID | Name | Functional Category | % Frequency in 243 Family Scaffolds |
|---|---|---|---|
| COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 3.70 |
| COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 3.70 |
| COG0654 | 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases | Energy production and conversion [C] | 2.47 |
| COG0277 | FAD/FMN-containing lactate dehydrogenase/glycolate oxidase | Energy production and conversion [C] | 2.47 |
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 1.65 |
| COG0493 | NADPH-dependent glutamate synthase beta chain or related oxidoreductase | Amino acid transport and metabolism [E] | 1.65 |
| COG2350 | YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHis | Secondary metabolites biosynthesis, transport and catabolism [Q] | 1.23 |
| COG0644 | Dehydrogenase (flavoprotein) | Energy production and conversion [C] | 1.23 |
| COG2318 | Bacillithiol/mycothiol S-transferase BstA/DinB, DinB/YfiT family (unrelated to E. coli DinB) | Secondary metabolites biosynthesis, transport and catabolism [Q] | 1.23 |
| COG2902 | NAD-specific glutamate dehydrogenase | Amino acid transport and metabolism [E] | 0.82 |
| COG2081 | Predicted flavoprotein YhiN | General function prediction only [R] | 0.82 |
| COG2259 | Uncharacterized membrane protein YphA, DoxX/SURF4 family | Function unknown [S] | 0.82 |
| COG2072 | Predicted flavoprotein CzcO associated with the cation diffusion facilitator CzcD | Inorganic ion transport and metabolism [P] | 0.82 |
| COG2730 | Aryl-phospho-beta-D-glucosidase BglC, GH1 family | Carbohydrate transport and metabolism [G] | 0.82 |
| COG3315 | O-Methyltransferase involved in polyketide biosynthesis | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.82 |
| COG2509 | FAD-dependent dehydrogenase | General function prediction only [R] | 0.82 |
| COG0008 | Glutamyl- or glutaminyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.82 |
| COG1538 | Outer membrane protein TolC | Cell wall/membrane/envelope biogenesis [M] | 0.82 |
| COG3634 | Alkyl hydroperoxide reductase subunit AhpF | Defense mechanisms [V] | 0.82 |
| COG1249 | Dihydrolipoamide dehydrogenase (E3) component of pyruvate/2-oxoglutarate dehydrogenase complex or glutathione oxidoreductase | Energy production and conversion [C] | 0.82 |
| COG1053 | Succinate dehydrogenase/fumarate reductase, flavoprotein subunit | Energy production and conversion [C] | 0.82 |
| COG4270 | Uncharacterized membrane protein | Function unknown [S] | 0.82 |
| COG3934 | Endo-1,4-beta-mannosidase | Carbohydrate transport and metabolism [G] | 0.82 |
| COG0029 | Aspartate oxidase | Coenzyme transport and metabolism [H] | 0.82 |
| COG0006 | Xaa-Pro aminopeptidase | Amino acid transport and metabolism [E] | 0.82 |
| COG0334 | Glutamate dehydrogenase/leucine dehydrogenase | Amino acid transport and metabolism [E] | 0.82 |
| COG0446 | NADPH-dependent 2,4-dienoyl-CoA reductase, sulfur reductase, or a related oxidoreductase | Lipid transport and metabolism [I] | 0.82 |
| COG0492 | Thioredoxin reductase | Posttranslational modification, protein turnover, chaperones [O] | 0.82 |
| COG5649 | Uncharacterized conserved protein, DUF1801 domain | Function unknown [S] | 0.41 |
| COG5646 | Iron-binding protein Fra/YdhG, frataxin family (Fe-S cluster biosynthesis) | Posttranslational modification, protein turnover, chaperones [O] | 0.41 |
| COG5405 | ATP-dependent protease HslVU (ClpYQ), peptidase subunit | Posttranslational modification, protein turnover, chaperones [O] | 0.41 |
| COG5402 | Uncharacterized protein, contains DUF1214 domain | Function unknown [S] | 0.41 |
| COG5361 | Uncharacterized conserved protein | Mobilome: prophages, transposons [X] | 0.41 |
| COG3338 | Carbonic anhydrase | Inorganic ion transport and metabolism [P] | 0.41 |
| COG3484 | Predicted proteasome-type protease | Posttranslational modification, protein turnover, chaperones [O] | 0.41 |
| COG5285 | Ectoine hydroxylase-related dioxygenase, phytanoyl-CoA dioxygenase (PhyH) family | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.41 |
| COG3511 | Phospholipase C | Cell wall/membrane/envelope biogenesis [M] | 0.41 |
| COG4452 | Inner membrane protein CreD involved in colicin E2 resistance | Defense mechanisms [V] | 0.41 |
| COG4430 | Uncharacterized conserved protein YdeI, YjbR/CyaY-like superfamily, DUF1801 family | Function unknown [S] | 0.41 |
| COG0823 | Periplasmic component TolB of the Tol biopolymer transport system | Intracellular trafficking, secretion, and vesicular transport [U] | 0.41 |
| COG0154 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase | Translation, ribosomal structure and biogenesis [J] | 0.41 |
| COG0251 | Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 family | Defense mechanisms [V] | 0.41 |
| COG0578 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 0.41 |
| COG0596 | 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase MenH and related esterases, alpha/beta hydrolase fold | Coenzyme transport and metabolism [H] | 0.41 |
| COG0638 | 20S proteasome, alpha and beta subunits | Posttranslational modification, protein turnover, chaperones [O] | 0.41 |
| COG0665 | Glycine/D-amino acid oxidase (deaminating) | Amino acid transport and metabolism [E] | 0.41 |
| COG0673 | Predicted dehydrogenase | General function prediction only [R] | 0.41 |
| COG0810 | Periplasmic protein TonB, links inner and outer membranes | Cell wall/membrane/envelope biogenesis [M] | 0.41 |
| COG2340 | Spore germination protein YkwD and related proteins with CAP (CSP/antigen 5/PR1) domain | Cell cycle control, cell division, chromosome partitioning [D] | 0.41 |
| COG0861 | Tellurite resistance membrane protein TerC | Inorganic ion transport and metabolism [P] | 0.41 |
| COG1331 | Uncharacterized conserved protein YyaL, SSP411 family, contains thoiredoxin and six-hairpin glycosidase-like domains | General function prediction only [R] | 0.41 |
| COG1506 | Dipeptidyl aminopeptidase/acylaminoacyl peptidase | Amino acid transport and metabolism [E] | 0.41 |
| COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 0.41 |
| COG1801 | Sugar isomerase-related protein YecE, UPF0759/DUF72 family | General function prediction only [R] | 0.41 |
| COG1921 | Seryl-tRNA(Sec) selenium transferase | Translation, ribosomal structure and biogenesis [J] | 0.41 |
| COG2255 | Holliday junction resolvasome RuvABC, ATP-dependent DNA helicase subunit RuvB | Replication, recombination and repair [L] | 0.41 |
| COG2337 | mRNA-degrading endonuclease MazF, toxin component of the MazEF toxin-antitoxin module | Defense mechanisms [V] | 0.41 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 91.36 % |
| Unclassified | root | N/A | 8.64 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459012|GOYVCMS02GAXG2 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7 | 500 | Open in IMG/M |
| 2228664022|INPgaii200_c1148746 | All Organisms → cellular organisms → Bacteria | 12427 | Open in IMG/M |
| 3300000955|JGI1027J12803_100150048 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7 | 1340 | Open in IMG/M |
| 3300001305|C688J14111_10152898 | All Organisms → cellular organisms → Bacteria | 709 | Open in IMG/M |
| 3300001867|JGI12627J18819_10417438 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 547 | Open in IMG/M |
| 3300004080|Ga0062385_10599400 | All Organisms → cellular organisms → Bacteria | 696 | Open in IMG/M |
| 3300004091|Ga0062387_100049403 | All Organisms → cellular organisms → Bacteria | 2005 | Open in IMG/M |
| 3300004092|Ga0062389_101715892 | All Organisms → cellular organisms → Bacteria | 809 | Open in IMG/M |
| 3300004092|Ga0062389_102188204 | All Organisms → cellular organisms → Bacteria | 727 | Open in IMG/M |
| 3300004633|Ga0066395_10091957 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7 | 1445 | Open in IMG/M |
| 3300004635|Ga0062388_102433652 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 548 | Open in IMG/M |
| 3300004635|Ga0062388_102659668 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7 | 526 | Open in IMG/M |
| 3300004635|Ga0062388_102687594 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7 | 524 | Open in IMG/M |
| 3300005175|Ga0066673_10152247 | All Organisms → cellular organisms → Bacteria | 1289 | Open in IMG/M |
| 3300005330|Ga0070690_101517984 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7 | 541 | Open in IMG/M |
| 3300005332|Ga0066388_103610055 | Not Available | 790 | Open in IMG/M |
| 3300005334|Ga0068869_100292171 | All Organisms → cellular organisms → Bacteria | 1313 | Open in IMG/M |
| 3300005336|Ga0070680_100184508 | Not Available | 1757 | Open in IMG/M |
| 3300005438|Ga0070701_10732772 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 668 | Open in IMG/M |
| 3300005439|Ga0070711_101104096 | All Organisms → cellular organisms → Bacteria | 683 | Open in IMG/M |
| 3300005441|Ga0070700_101080819 | All Organisms → cellular organisms → Bacteria | 664 | Open in IMG/M |
| 3300005450|Ga0066682_10499515 | All Organisms → cellular organisms → Bacteria | 771 | Open in IMG/M |
| 3300005459|Ga0068867_100040586 | All Organisms → cellular organisms → Bacteria | 3398 | Open in IMG/M |
| 3300005534|Ga0070735_10813642 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
| 3300005536|Ga0070697_100139025 | All Organisms → cellular organisms → Bacteria | 2041 | Open in IMG/M |
| 3300005538|Ga0070731_11133928 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7 | 516 | Open in IMG/M |
| 3300005542|Ga0070732_10021305 | All Organisms → cellular organisms → Bacteria | 3650 | Open in IMG/M |
| 3300005559|Ga0066700_10938035 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
| 3300005560|Ga0066670_10526035 | All Organisms → cellular organisms → Bacteria | 725 | Open in IMG/M |
| 3300005561|Ga0066699_10141752 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1631 | Open in IMG/M |
| 3300005578|Ga0068854_101832592 | Not Available | 557 | Open in IMG/M |
| 3300005591|Ga0070761_10811436 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 589 | Open in IMG/M |
| 3300005598|Ga0066706_10733356 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 784 | Open in IMG/M |
| 3300005602|Ga0070762_10135478 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium | 1461 | Open in IMG/M |
| 3300005764|Ga0066903_102898413 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 930 | Open in IMG/M |
| 3300005842|Ga0068858_101223382 | All Organisms → cellular organisms → Bacteria | 738 | Open in IMG/M |
| 3300006028|Ga0070717_10007949 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 7898 | Open in IMG/M |
| 3300006028|Ga0070717_10577655 | All Organisms → cellular organisms → Bacteria | 1019 | Open in IMG/M |
| 3300006057|Ga0075026_100284617 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7 | 897 | Open in IMG/M |
| 3300006173|Ga0070716_101410018 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7 | 567 | Open in IMG/M |
| 3300006173|Ga0070716_101434013 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300006173|Ga0070716_101635733 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7 | 530 | Open in IMG/M |
| 3300006176|Ga0070765_100167724 | All Organisms → cellular organisms → Bacteria | 1972 | Open in IMG/M |
| 3300006806|Ga0079220_10733199 | All Organisms → cellular organisms → Bacteria | 733 | Open in IMG/M |
| 3300006806|Ga0079220_11314940 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
| 3300006854|Ga0075425_101399549 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 791 | Open in IMG/M |
| 3300006854|Ga0075425_102038568 | All Organisms → cellular organisms → Bacteria | 641 | Open in IMG/M |
| 3300006871|Ga0075434_100798573 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 960 | Open in IMG/M |
| 3300006903|Ga0075426_10746381 | All Organisms → cellular organisms → Bacteria | 735 | Open in IMG/M |
| 3300006903|Ga0075426_11189167 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
| 3300006904|Ga0075424_102557265 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 534 | Open in IMG/M |
| 3300007076|Ga0075435_100916871 | Not Available | 764 | Open in IMG/M |
| 3300009011|Ga0105251_10505609 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
| 3300009088|Ga0099830_11265250 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 613 | Open in IMG/M |
| 3300009137|Ga0066709_101154900 | All Organisms → cellular organisms → Bacteria | 1140 | Open in IMG/M |
| 3300009156|Ga0111538_13123192 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Micropepsales → Micropepsaceae → Rhizomicrobium → Rhizomicrobium electricum | 577 | Open in IMG/M |
| 3300009551|Ga0105238_10625420 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → unclassified Verrucomicrobiales → Verrucomicrobiales bacterium | 1086 | Open in IMG/M |
| 3300009624|Ga0116105_1190323 | Not Available | 562 | Open in IMG/M |
| 3300009638|Ga0116113_1214260 | Not Available | 502 | Open in IMG/M |
| 3300009665|Ga0116135_1010919 | All Organisms → cellular organisms → Bacteria | 3244 | Open in IMG/M |
| 3300010043|Ga0126380_12215846 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7 | 508 | Open in IMG/M |
| 3300010046|Ga0126384_10268108 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7 | 1389 | Open in IMG/M |
| 3300010048|Ga0126373_13275007 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7 | 504 | Open in IMG/M |
| 3300010341|Ga0074045_10560593 | All Organisms → cellular organisms → Bacteria | 731 | Open in IMG/M |
| 3300010358|Ga0126370_10008250 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5420 | Open in IMG/M |
| 3300010358|Ga0126370_10265231 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1341 | Open in IMG/M |
| 3300010360|Ga0126372_11589797 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7 | 692 | Open in IMG/M |
| 3300010362|Ga0126377_10006806 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 8621 | Open in IMG/M |
| 3300010373|Ga0134128_12498712 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7 | 569 | Open in IMG/M |
| 3300010373|Ga0134128_13220915 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300010375|Ga0105239_13270050 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
| 3300010376|Ga0126381_101059641 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7 | 1171 | Open in IMG/M |
| 3300010397|Ga0134124_12552889 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7 | 553 | Open in IMG/M |
| 3300010398|Ga0126383_11463317 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 773 | Open in IMG/M |
| 3300010398|Ga0126383_11799021 | All Organisms → cellular organisms → Bacteria | 701 | Open in IMG/M |
| 3300010401|Ga0134121_10819823 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7 | 896 | Open in IMG/M |
| 3300010401|Ga0134121_11247018 | Not Available | 746 | Open in IMG/M |
| 3300011270|Ga0137391_10763569 | Not Available | 799 | Open in IMG/M |
| 3300012189|Ga0137388_10578049 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1044 | Open in IMG/M |
| 3300012199|Ga0137383_11107473 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 573 | Open in IMG/M |
| 3300012200|Ga0137382_10177509 | All Organisms → cellular organisms → Bacteria | 1456 | Open in IMG/M |
| 3300012200|Ga0137382_11140296 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
| 3300012202|Ga0137363_10134437 | All Organisms → cellular organisms → Bacteria | 1925 | Open in IMG/M |
| 3300012202|Ga0137363_10739456 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Occallatibacter → Occallatibacter riparius | 833 | Open in IMG/M |
| 3300012205|Ga0137362_10575565 | All Organisms → cellular organisms → Bacteria | 972 | Open in IMG/M |
| 3300012285|Ga0137370_10853201 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
| 3300012357|Ga0137384_11217098 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7 | 598 | Open in IMG/M |
| 3300012361|Ga0137360_11135320 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7 | 675 | Open in IMG/M |
| 3300012363|Ga0137390_11596607 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7 | 590 | Open in IMG/M |
| 3300012509|Ga0157334_1079388 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300012685|Ga0137397_10553488 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7 | 856 | Open in IMG/M |
| 3300012685|Ga0137397_10706107 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 749 | Open in IMG/M |
| 3300012917|Ga0137395_10560307 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7 | 825 | Open in IMG/M |
| 3300012918|Ga0137396_10758429 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7 | 714 | Open in IMG/M |
| 3300012918|Ga0137396_10875373 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7 | 659 | Open in IMG/M |
| 3300012923|Ga0137359_10862365 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 782 | Open in IMG/M |
| 3300012923|Ga0137359_11160046 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 660 | Open in IMG/M |
| 3300012924|Ga0137413_10321131 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1088 | Open in IMG/M |
| 3300012924|Ga0137413_11432734 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7 | 559 | Open in IMG/M |
| 3300012925|Ga0137419_11468483 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 577 | Open in IMG/M |
| 3300012927|Ga0137416_11241664 | All Organisms → cellular organisms → Bacteria | 672 | Open in IMG/M |
| 3300012929|Ga0137404_10271298 | Not Available | 1463 | Open in IMG/M |
| 3300012930|Ga0137407_11833528 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7 | 578 | Open in IMG/M |
| 3300012948|Ga0126375_11694111 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7 | 548 | Open in IMG/M |
| 3300012955|Ga0164298_11660166 | Not Available | 506 | Open in IMG/M |
| 3300012958|Ga0164299_11311130 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 554 | Open in IMG/M |
| 3300012986|Ga0164304_10819776 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 720 | Open in IMG/M |
| 3300012988|Ga0164306_10447097 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 982 | Open in IMG/M |
| 3300013296|Ga0157374_10199012 | All Organisms → cellular organisms → Bacteria | 1961 | Open in IMG/M |
| 3300013297|Ga0157378_10000402 | All Organisms → cellular organisms → Bacteria | 42627 | Open in IMG/M |
| 3300013308|Ga0157375_12036290 | Not Available | 683 | Open in IMG/M |
| 3300013308|Ga0157375_13457317 | Not Available | 526 | Open in IMG/M |
| 3300014969|Ga0157376_12656609 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Terriglobus → unclassified Terriglobus → Terriglobus sp. TAA 43 | 541 | Open in IMG/M |
| 3300015054|Ga0137420_1140687 | All Organisms → cellular organisms → Bacteria | 2198 | Open in IMG/M |
| 3300015242|Ga0137412_11058629 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7 | 577 | Open in IMG/M |
| 3300015245|Ga0137409_10143873 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2186 | Open in IMG/M |
| 3300015264|Ga0137403_11572681 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7 | 510 | Open in IMG/M |
| 3300015357|Ga0134072_10421682 | Not Available | 531 | Open in IMG/M |
| 3300015373|Ga0132257_100234342 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2187 | Open in IMG/M |
| 3300015374|Ga0132255_102137291 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7 | 853 | Open in IMG/M |
| 3300015374|Ga0132255_105496298 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 536 | Open in IMG/M |
| 3300016270|Ga0182036_11441392 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7 | 577 | Open in IMG/M |
| 3300016294|Ga0182041_10453341 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1103 | Open in IMG/M |
| 3300017974|Ga0187777_10181028 | All Organisms → cellular organisms → Bacteria | 1415 | Open in IMG/M |
| 3300017994|Ga0187822_10371435 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300018433|Ga0066667_11435387 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 607 | Open in IMG/M |
| 3300018468|Ga0066662_12558691 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 539 | Open in IMG/M |
| 3300018482|Ga0066669_12232523 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 520 | Open in IMG/M |
| 3300019877|Ga0193722_1097521 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 706 | Open in IMG/M |
| 3300020140|Ga0179590_1043726 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7 | 1139 | Open in IMG/M |
| 3300020170|Ga0179594_10411751 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7 | 513 | Open in IMG/M |
| 3300020199|Ga0179592_10085289 | All Organisms → cellular organisms → Bacteria | 1449 | Open in IMG/M |
| 3300020579|Ga0210407_10047641 | All Organisms → cellular organisms → Bacteria | 3194 | Open in IMG/M |
| 3300020579|Ga0210407_10907707 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 675 | Open in IMG/M |
| 3300020580|Ga0210403_10201462 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1633 | Open in IMG/M |
| 3300020580|Ga0210403_10906779 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 695 | Open in IMG/M |
| 3300020580|Ga0210403_10930341 | All Organisms → cellular organisms → Bacteria | 684 | Open in IMG/M |
| 3300020581|Ga0210399_10191454 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 1700 | Open in IMG/M |
| 3300020581|Ga0210399_10472118 | All Organisms → cellular organisms → Bacteria | 1044 | Open in IMG/M |
| 3300020581|Ga0210399_11166512 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7 | 613 | Open in IMG/M |
| 3300021088|Ga0210404_10760106 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7 | 553 | Open in IMG/M |
| 3300021170|Ga0210400_10543573 | All Organisms → cellular organisms → Bacteria | 958 | Open in IMG/M |
| 3300021171|Ga0210405_10004655 | All Organisms → cellular organisms → Bacteria | 12803 | Open in IMG/M |
| 3300021171|Ga0210405_10889649 | All Organisms → cellular organisms → Bacteria | 677 | Open in IMG/M |
| 3300021178|Ga0210408_10687796 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7 | 806 | Open in IMG/M |
| 3300021181|Ga0210388_10139334 | All Organisms → cellular organisms → Bacteria | 2101 | Open in IMG/M |
| 3300021374|Ga0213881_10552054 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7 | 524 | Open in IMG/M |
| 3300021401|Ga0210393_10499114 | All Organisms → cellular organisms → Bacteria | 994 | Open in IMG/M |
| 3300021402|Ga0210385_11524463 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 510 | Open in IMG/M |
| 3300021404|Ga0210389_10649194 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → unclassified Burkholderiaceae → Burkholderiaceae bacterium | 828 | Open in IMG/M |
| 3300021406|Ga0210386_10795903 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 813 | Open in IMG/M |
| 3300021420|Ga0210394_10611702 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 957 | Open in IMG/M |
| 3300021420|Ga0210394_11498081 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 571 | Open in IMG/M |
| 3300021433|Ga0210391_10051571 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3273 | Open in IMG/M |
| 3300021433|Ga0210391_10822019 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 726 | Open in IMG/M |
| 3300021433|Ga0210391_11589638 | Not Available | 500 | Open in IMG/M |
| 3300021477|Ga0210398_10023693 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5206 | Open in IMG/M |
| 3300021477|Ga0210398_10804344 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → unclassified Burkholderiaceae → Burkholderiaceae bacterium | 757 | Open in IMG/M |
| 3300021478|Ga0210402_10296410 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1496 | Open in IMG/M |
| 3300021478|Ga0210402_12033961 | Not Available | 500 | Open in IMG/M |
| 3300021479|Ga0210410_10004797 | All Organisms → cellular organisms → Bacteria | 11836 | Open in IMG/M |
| 3300021479|Ga0210410_11581403 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 549 | Open in IMG/M |
| 3300021559|Ga0210409_11075705 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7 | 679 | Open in IMG/M |
| 3300021560|Ga0126371_10353262 | All Organisms → cellular organisms → Bacteria | 1606 | Open in IMG/M |
| 3300021560|Ga0126371_10877345 | All Organisms → cellular organisms → Bacteria | 1042 | Open in IMG/M |
| 3300022532|Ga0242655_10084470 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 847 | Open in IMG/M |
| 3300022557|Ga0212123_10440882 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7 | 861 | Open in IMG/M |
| 3300023250|Ga0224544_1035496 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 704 | Open in IMG/M |
| 3300023259|Ga0224551_1084295 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7 | 560 | Open in IMG/M |
| 3300024182|Ga0247669_1055937 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 656 | Open in IMG/M |
| 3300025905|Ga0207685_10169166 | Not Available | 1004 | Open in IMG/M |
| 3300025905|Ga0207685_10220318 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7 | 902 | Open in IMG/M |
| 3300025906|Ga0207699_10639921 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 776 | Open in IMG/M |
| 3300025912|Ga0207707_10378283 | All Organisms → cellular organisms → Bacteria | 1218 | Open in IMG/M |
| 3300025915|Ga0207693_10036898 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3854 | Open in IMG/M |
| 3300025915|Ga0207693_10204041 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1554 | Open in IMG/M |
| 3300025915|Ga0207693_10580237 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 873 | Open in IMG/M |
| 3300025917|Ga0207660_10146038 | Not Available | 1813 | Open in IMG/M |
| 3300025928|Ga0207700_10608790 | All Organisms → cellular organisms → Bacteria | 972 | Open in IMG/M |
| 3300025931|Ga0207644_11650017 | Not Available | 537 | Open in IMG/M |
| 3300025936|Ga0207670_11681326 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 540 | Open in IMG/M |
| 3300025937|Ga0207669_10784625 | Not Available | 789 | Open in IMG/M |
| 3300025938|Ga0207704_10991276 | All Organisms → cellular organisms → Bacteria | 710 | Open in IMG/M |
| 3300025939|Ga0207665_10538044 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidipila → unclassified Acidipila → Acidipila sp. | 906 | Open in IMG/M |
| 3300025949|Ga0207667_10661808 | All Organisms → cellular organisms → Bacteria | 1049 | Open in IMG/M |
| 3300025972|Ga0207668_11852164 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 544 | Open in IMG/M |
| 3300026041|Ga0207639_11174646 | All Organisms → cellular organisms → Bacteria | 720 | Open in IMG/M |
| 3300026075|Ga0207708_10163511 | All Organisms → cellular organisms → Bacteria | 1759 | Open in IMG/M |
| 3300026078|Ga0207702_10384767 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1350 | Open in IMG/M |
| 3300026301|Ga0209238_1016618 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2840 | Open in IMG/M |
| 3300026301|Ga0209238_1053151 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1451 | Open in IMG/M |
| 3300026320|Ga0209131_1327729 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7 | 569 | Open in IMG/M |
| 3300026469|Ga0257169_1001260 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2102 | Open in IMG/M |
| 3300026475|Ga0257147_1037826 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7 | 705 | Open in IMG/M |
| 3300026550|Ga0209474_10455784 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 650 | Open in IMG/M |
| 3300026551|Ga0209648_10753248 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| 3300026557|Ga0179587_10292412 | All Organisms → cellular organisms → Bacteria | 1048 | Open in IMG/M |
| 3300027172|Ga0208098_1017965 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7 | 690 | Open in IMG/M |
| 3300027545|Ga0209008_1146521 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7 | 519 | Open in IMG/M |
| 3300027591|Ga0209733_1154876 | Not Available | 555 | Open in IMG/M |
| 3300027645|Ga0209117_1107767 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 755 | Open in IMG/M |
| 3300027645|Ga0209117_1137453 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 645 | Open in IMG/M |
| 3300027667|Ga0209009_1116225 | All Organisms → cellular organisms → Bacteria | 679 | Open in IMG/M |
| 3300027737|Ga0209038_10154631 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7 | 695 | Open in IMG/M |
| 3300027765|Ga0209073_10258591 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 679 | Open in IMG/M |
| 3300027768|Ga0209772_10116200 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 829 | Open in IMG/M |
| 3300027783|Ga0209448_10032934 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1734 | Open in IMG/M |
| 3300027812|Ga0209656_10482074 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7 | 544 | Open in IMG/M |
| 3300027842|Ga0209580_10250204 | All Organisms → cellular organisms → Bacteria | 881 | Open in IMG/M |
| 3300027853|Ga0209274_10155433 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 1153 | Open in IMG/M |
| 3300027853|Ga0209274_10536573 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 606 | Open in IMG/M |
| 3300027879|Ga0209169_10087894 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1606 | Open in IMG/M |
| 3300027879|Ga0209169_10632471 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 558 | Open in IMG/M |
| 3300027884|Ga0209275_10237245 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 996 | Open in IMG/M |
| 3300027889|Ga0209380_10240548 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1063 | Open in IMG/M |
| 3300027889|Ga0209380_10719282 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7 | 572 | Open in IMG/M |
| 3300027898|Ga0209067_10650641 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 608 | Open in IMG/M |
| 3300027903|Ga0209488_10869861 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 634 | Open in IMG/M |
| 3300028016|Ga0265354_1020055 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 635 | Open in IMG/M |
| 3300028536|Ga0137415_10779824 | All Organisms → cellular organisms → Bacteria | 766 | Open in IMG/M |
| 3300029636|Ga0222749_10467214 | All Organisms → cellular organisms → Bacteria | 678 | Open in IMG/M |
| 3300029882|Ga0311368_10470747 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 910 | Open in IMG/M |
| 3300029939|Ga0311328_10222574 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1444 | Open in IMG/M |
| 3300030041|Ga0302274_10147799 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1210 | Open in IMG/M |
| 3300031231|Ga0170824_119276445 | All Organisms → cellular organisms → Bacteria | 793 | Open in IMG/M |
| 3300031261|Ga0302140_11069973 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → unclassified Burkholderiaceae → Burkholderiaceae bacterium | 549 | Open in IMG/M |
| 3300031446|Ga0170820_10052623 | All Organisms → cellular organisms → Bacteria | 854 | Open in IMG/M |
| 3300031474|Ga0170818_114214300 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 708 | Open in IMG/M |
| 3300031525|Ga0302326_10755979 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1409 | Open in IMG/M |
| 3300031708|Ga0310686_103117097 | All Organisms → cellular organisms → Bacteria | 762 | Open in IMG/M |
| 3300031720|Ga0307469_11043298 | All Organisms → cellular organisms → Bacteria | 765 | Open in IMG/M |
| 3300031753|Ga0307477_10247695 | All Organisms → cellular organisms → Bacteria | 1235 | Open in IMG/M |
| 3300031753|Ga0307477_10306924 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1095 | Open in IMG/M |
| 3300031754|Ga0307475_10502503 | All Organisms → cellular organisms → Bacteria | 974 | Open in IMG/M |
| 3300031823|Ga0307478_10041986 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3357 | Open in IMG/M |
| 3300031897|Ga0318520_11036114 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7 | 519 | Open in IMG/M |
| 3300031938|Ga0308175_102010258 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 648 | Open in IMG/M |
| 3300031946|Ga0310910_11414238 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7 | 535 | Open in IMG/M |
| 3300031962|Ga0307479_10040607 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 4465 | Open in IMG/M |
| 3300031962|Ga0307479_10492090 | All Organisms → cellular organisms → Bacteria | 1210 | Open in IMG/M |
| 3300032041|Ga0318549_10151854 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7 | 1031 | Open in IMG/M |
| 3300032828|Ga0335080_10593094 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7 | 1166 | Open in IMG/M |
| 3300033513|Ga0316628_103904355 | Not Available | 534 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 15.64% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 14.81% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 7.41% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.35% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 4.53% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 4.12% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.29% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.29% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.29% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.88% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.88% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.88% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.06% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.06% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.65% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.65% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 1.23% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.23% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.23% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.23% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.23% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 1.23% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.23% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.23% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.41% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.41% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.41% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.41% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.41% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.41% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.41% |
| Exposed Rock | Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock | 0.41% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.41% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.41% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.41% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.41% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.82% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.82% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.82% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.82% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.82% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.82% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.82% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.82% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.82% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459012 | Grass soil microbial communities from Rothamsted Park, UK - July 2010 direct MP BIO1O1 lysis Rhizosphere grass | Environmental | Open in IMG/M |
| 2228664022 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001305 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
| 3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
| 3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
| 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
| 3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
| 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
| 3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006057 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009624 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10 | Environmental | Open in IMG/M |
| 3300009638 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_10 | Environmental | Open in IMG/M |
| 3300009665 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012509 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.8.old.080610_6 | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015357 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300017994 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019877 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m1 | Environmental | Open in IMG/M |
| 3300020140 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021374 | Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R08 | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022532 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300023250 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P1 10-14 | Environmental | Open in IMG/M |
| 3300023259 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P3 20-24 | Environmental | Open in IMG/M |
| 3300024182 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK10 | Environmental | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026469 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-17-B | Environmental | Open in IMG/M |
| 3300026475 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-12-A | Environmental | Open in IMG/M |
| 3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027172 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF038 (SPAdes) | Environmental | Open in IMG/M |
| 3300027545 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027591 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027645 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027667 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027737 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027765 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes) | Environmental | Open in IMG/M |
| 3300027768 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027783 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027898 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028016 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 | Host-Associated | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300029882 | III_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300029939 | I_Bog_E3 coassembly | Environmental | Open in IMG/M |
| 3300030041 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N2_1 | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031261 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E1_1 | Environmental | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032041 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300033513 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_C | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| N56_07974910 | 2170459012 | Grass Soil | VKIYIVTGYLIILLYIMACMYSAPTQLGPWRGMLIGGVYFIFCWFLAGLYLADVLHL |
| INPgaii200_114874614 | 2228664022 | Soil | MKMYNVAGYLIILLYLLACLYSAPAQLAPWRALLIGGLYFVFCWF |
| JGI1027J12803_1001500482 | 3300000955 | Soil | MKMYNVAGYLIILLYLLACLYSAPAQLAPWRALLIGGLYFVFCWFLGGLYLADV |
| C688J14111_101528983 | 3300001305 | Soil | MKIYNLAGYLIIVSYLLACMYSAPAQLGPWIGILMGGAYLVFCWFMGGLYLAD |
| JGI12627J18819_104174382 | 3300001867 | Forest Soil | VKIYNVYGYLTILAYALACMYFAPAHLGPWRGLAVGAIYFIACWFMAGLYLADVLHM |
| Ga0062385_105994002 | 3300004080 | Bog Forest Soil | MKTYNVIGYSIILLYLLASVYSAPTHLGPWNALLISGVYFI |
| Ga0062387_1000494031 | 3300004091 | Bog Forest Soil | VKIYNLTGYLIILSYVLACMYFAPAHLGPWIGILIGGVYFIFCWF |
| Ga0062389_1017158922 | 3300004092 | Bog Forest Soil | VKIYNLVGYSIIFCYMLACMYFAPAHLGPWIGLLIGGVYFILCWFFGGLYLADI |
| Ga0062389_1021882041 | 3300004092 | Bog Forest Soil | VMKSYNLYGYLIILAYMLACMYLAPAHLGPWMGMLIGGAYFIFCWFMGG |
| Ga0066395_100919573 | 3300004633 | Tropical Forest Soil | LKIYNFWGYLIILAYALACMYSAPAQLGPWKGLLIGAAYFLFCWFLAGLY |
| Ga0062388_1024336521 | 3300004635 | Bog Forest Soil | MKIYNLVGYLIIVSYVVACVYSAPAHLGVWKTLFIGVSYFIFCWFMGGL |
| Ga0062388_1026596682 | 3300004635 | Bog Forest Soil | MKIYNLTGYLIIFCYMLACIYFAPAHLGPWMGLLIGGVYFIFCWFMGGLYLAD |
| Ga0062388_1026875942 | 3300004635 | Bog Forest Soil | MKIYNFYGYLIILAYMLACVYFAPAHLGPWMGMLIGGAYFIFCWFMGGLYLADVLHLG |
| Ga0066673_101522471 | 3300005175 | Soil | VKIYNVIGYLIIVCYLLACMFSAPAQWGPWKGLLIGAAYF |
| Ga0070690_1015179841 | 3300005330 | Switchgrass Rhizosphere | VKIYNITGYLIILLYMLACMYSAPTRLGPWAGLLIGGIYFIFCWFLAGLYLADVLH |
| Ga0066388_1036100551 | 3300005332 | Tropical Forest Soil | VKIYSVSGYLIIFSYLLACMYFAPTLWTGILVGGAYLIFCWFLGGL |
| Ga0068869_1002921714 | 3300005334 | Miscanthus Rhizosphere | MKIYNLTGYLIMLAYMLVCIYFAPPNLGPWTGALIAAAYFIFCWFL |
| Ga0070680_1001845082 | 3300005336 | Corn Rhizosphere | MKIYNLTGSLIILFYLLACMYSAPTQIGPWMGLLIGGVYFIFCWF |
| Ga0070701_107327721 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | VKIYNITGYLIILLYMLACMYSAPTRLGPWAGLLIGGIYFIFCWFL |
| Ga0070711_1011040962 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | VKHYNGIGGLIILVYLLACMYSAPSHLGPWIGLSIGGVYFV |
| Ga0070700_1010808193 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | MKIYNLTGYLIMLAYMLVCIYFAPPNLGPWTGALIAAAYFIFCWFLGGL |
| Ga0066682_104995151 | 3300005450 | Soil | MTRHGGGSIVKIYNLTGYLIIVLYMLACVYFAPAHLGPWAGLLIGGVYFIFCWFSGGL |
| Ga0068867_1000405861 | 3300005459 | Miscanthus Rhizosphere | MKIYNLTGSLIILFYLLACMYSAPTQIGPWMGLLIGGVYFIFCWFVAGL |
| Ga0070735_108136421 | 3300005534 | Surface Soil | MRTVKTYNFIGYSVILVYMAACMVSAPTHLGPWKGLLIGAIYFVFCWFLCGLYLA |
| Ga0070697_1001390253 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | VKIYNTTGYAIIFAYMLACMYFAPAHLRPWTGMLIGGVYFIFCWFLGGLYLAD |
| Ga0070731_111339281 | 3300005538 | Surface Soil | MKTYNIVGYLIIVSYVLACMYAAPTHLGPWTGALIGG |
| Ga0070732_100213053 | 3300005542 | Surface Soil | VKIYNVTGYLIIFAYLLACMYSAPTQWTGILIGGAYL |
| Ga0066700_109380352 | 3300005559 | Soil | VKIYNVTGYLIIFAYMLACLYSAPNHLGPWVGMLVGGIYFIFCWFFGGLYLADV |
| Ga0066670_105260351 | 3300005560 | Soil | MKIYSLTGYLVIFSYLVACMYSAPAQLGPWTGIVMGGAYLIFCWFMGGLYLADVLHL |
| Ga0066699_101417521 | 3300005561 | Soil | VKIYNVTGYLIIFAYMLACMYSAPTHLGPWIGMLVGGVYFIFCWFF |
| Ga0068854_1018325922 | 3300005578 | Corn Rhizosphere | MARRGAIMKIYNLTGYLIILSYMLGCVYFAPAHLGPWTGLLI |
| Ga0070761_108114362 | 3300005591 | Soil | MKIYSLTGYLIIILSMLACVYSAPAHLGPWKGLLIGAVYFTFCWFMGGLYLA |
| Ga0066706_107333561 | 3300005598 | Soil | MKIYSLTGYLVIFFYLLACMYSAPTQLRPWTGILMGGAYLIFCWFM |
| Ga0070762_101354781 | 3300005602 | Soil | VKIYNLTGYLIIVLYMLASMYFAPAHLGPWTGLLIGGVYFIFCWFS |
| Ga0066903_1028984131 | 3300005764 | Tropical Forest Soil | MKIYSAIGYLTILVYMLACAYSAPTPLTGVLDGGAYLVFCWFMGGLYLA |
| Ga0068858_1012233821 | 3300005842 | Switchgrass Rhizosphere | MKIYNLTGYLIMLAYMLVCIYFAPPNLGPWTGALIAAAYFIFCWFLGGLY |
| Ga0070717_100079491 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MPRGGALRIYNVTGYLTIFVYILACMYTAPAHLGPWKGL |
| Ga0070717_105776551 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MKIYNVIGYLIILLYLLACTYAAPARLGPWAGVSIAA |
| Ga0075026_1002846171 | 3300006057 | Watersheds | MKIYNLTGYSILFFYMLACMYSAPAHLGPWIGLLIGGVYFVFAW |
| Ga0070716_1014100181 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MKTYNLAGYLIILVYILACMFFAPAHLGPWTGLLIGGAYFIFCWFMGGLYLADVLHLGIVHGALNYKV |
| Ga0070716_1014340132 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MKIYNLAGYVIIFLYLLACIYFAPAHFGPWLGLLIGATYFVFCWFLG |
| Ga0070716_1016357331 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MKIYNVVGYLIILLYLLTCMYSAPVPWGPWKGIFIGGAYFIFCWF |
| Ga0070765_1001677241 | 3300006176 | Soil | MKIYNLVGYLIVFSYMLACMYFAPAHLGLWKGFLIGEAYFIFVWFLGGLY |
| Ga0079220_107331992 | 3300006806 | Agricultural Soil | MKIYSLTGYLVIFSYLLACMYSAPTQLGPWTGLLMGGAYLIFCWFMGGL |
| Ga0079220_113149401 | 3300006806 | Agricultural Soil | MKIYSLAGYSIIVFYLLGCAYFAPAYWGPWAGTLIGGAYLIFCWFLGGL |
| Ga0075425_1013995492 | 3300006854 | Populus Rhizosphere | MKSYNLVGYLIILLYLLACMYFAPAHLGPWTGVLIGAAYFIF |
| Ga0075425_1020385682 | 3300006854 | Populus Rhizosphere | MKIYNITGYLIIVAYMLACMYFAPTHLGPWIGMLIGGVYFIFCWFLGGLYLADVLHLGI |
| Ga0075434_1007985731 | 3300006871 | Populus Rhizosphere | MKSYNLVGYLIILLYLLACMYFAPAHLGPWTGVLIGAAYFIFCWFLG |
| Ga0075426_107463812 | 3300006903 | Populus Rhizosphere | VKIYNLYGYLIILAYMLACVYSAPPHLGPWIGMLIGGAYFIFCWFFGGLYLADVLHLG |
| Ga0075426_111891672 | 3300006903 | Populus Rhizosphere | VKSYNAIGYLIILLYLVACMYSAPTQRGPLIGLLIGAAYFVFCWFVAG |
| Ga0075424_1025572652 | 3300006904 | Populus Rhizosphere | MKIYNAVGYLIILAYLLACVFSAPAQLGPWKGLLIGAAYFIFIWFFGGLYLAD |
| Ga0075435_1009168711 | 3300007076 | Populus Rhizosphere | MKIYNLTGSLIILFYLLACMYSAPTQIGPWMGLLIGGVYFIF |
| Ga0105251_105056091 | 3300009011 | Switchgrass Rhizosphere | MKIYNLTGYLIIFSYALTCIYFAPAHLRPLTAILIAGVYFIFCWFLGGLYLA |
| Ga0099830_112652501 | 3300009088 | Vadose Zone Soil | MMKIYNITGYLIIFSYMLACMYSAPAHLGPCAGMLIGGVYFIFCWFFGG |
| Ga0066709_1011549001 | 3300009137 | Grasslands Soil | MKIYNITGFLIILAYMLACMYSAPTQLGPWAGLLIGGVYFIFCWF |
| Ga0111538_131231921 | 3300009156 | Populus Rhizosphere | MKIYNLTGYLIMLAYMLVCIYFAPPNLGPWTGALIAAAYFIFCWFLGGLYLADLLHLG |
| Ga0105238_106254202 | 3300009551 | Corn Rhizosphere | MKIYNLTGSLIILFYLLACMYSAPTQIGPWMGLLIGGVYF |
| Ga0116105_11903232 | 3300009624 | Peatland | MKTYNIIGYLIILCYTLACVYFTPRHLGPWTGLLISGAY |
| Ga0116113_12142602 | 3300009638 | Peatland | MKTYNIIGYLIILCYTLACVYFTPRHLGPWTGLLIS |
| Ga0116135_10109191 | 3300009665 | Peatland | MKIYNLAGYLIIVLYMLACTYFAPAHLGPWKGLAIGGVYFLFCWFMGGLYLADVL |
| Ga0126380_122158461 | 3300010043 | Tropical Forest Soil | LKIYNFWGYVIILAYALACMYSAPAQLGPWKGLLIGAAYFIFCWFL |
| Ga0126384_102681082 | 3300010046 | Tropical Forest Soil | VKIYNFWGYLIILAYALACMYSAPAQLGPWKGLLIGAAYFIFCWFLAGLYLADVLHMG |
| Ga0126373_132750072 | 3300010048 | Tropical Forest Soil | VKIYNVIGYLIILLYMLASIYSAPAQLGPGKGLLIGAGYFIFCWFLGGLYLADVLHL |
| Ga0074045_105605932 | 3300010341 | Bog Forest Soil | MKLYNVTGYLIILCYLLACMYSAPAHLGPWIGLLIGGA |
| Ga0126370_100082501 | 3300010358 | Tropical Forest Soil | VKIYNLWGYLIILAYALACMYSAPAQLGPWKGLLIGGAYFIFCWF |
| Ga0126370_102652311 | 3300010358 | Tropical Forest Soil | MKIYNVYGYLIIFLYLLACLYFAPTLWAGILVGGAYLIFCWF |
| Ga0126372_115897971 | 3300010360 | Tropical Forest Soil | MKIYNLIGYSIIFVYLLSCMYLAPAHLGAWTGMLIGGVYLVFCWFLGGLYLADVLH |
| Ga0126377_100068061 | 3300010362 | Tropical Forest Soil | MKIYNVYGYLIILAYALACMFSPPIQLGPWKGLLI |
| Ga0134128_124987121 | 3300010373 | Terrestrial Soil | MKIYSLTGYLVIFSYLLACMYSAPTQLGPWTGLLMGGAYLIFCWFMGGLYLADVL |
| Ga0134128_132209152 | 3300010373 | Terrestrial Soil | LPPGATMKIYNLAGYLIIVSYLLACMYSAPAQLGPWIGILMGGAYLIFCWFMGGL* |
| Ga0105239_132700502 | 3300010375 | Corn Rhizosphere | MKLYNVTGYLIILAYLLACMYSAPAHLGPWIGLLIGGIYFVFCWFLAGLYLADVLHLGI |
| Ga0126381_1010596411 | 3300010376 | Tropical Forest Soil | MKIYSAIGYLTILVYMLACAYSASTPLTGVLMGGAYLVFCWFMGGLYLADVLHLGIVHGALNYKVWFMKSVTIVNN |
| Ga0134124_125528891 | 3300010397 | Terrestrial Soil | MKIYSLTGYLVIFSYLLACMYSAPTQLGPWTGLLMGGAYLIFCWFMGGLYLADVLHLGI |
| Ga0126383_114633171 | 3300010398 | Tropical Forest Soil | VKIYNLVGYSIIVLYWLACMYSAPAQLGLGKATLISAVYF |
| Ga0126383_117990212 | 3300010398 | Tropical Forest Soil | VKTYNLIGYSVILVYMAACMVSAPAHLGPWKGLLIGAI |
| Ga0134121_108198231 | 3300010401 | Terrestrial Soil | MKIYSLAGYSIIVFYLLGCAYFAPAYWGPWAGTLIGGAYLIFCWFLGGLYLADVLHLG |
| Ga0134121_112470181 | 3300010401 | Terrestrial Soil | MKIYNLTGSLIILFYLLACMYSAPTQIGPWMGLLIGGVYFI |
| Ga0137391_107635691 | 3300011270 | Vadose Zone Soil | MKIYNVTGYLLILVYMLACAYFAPAQLGPWAGLLIGG |
| Ga0137388_105780491 | 3300012189 | Vadose Zone Soil | MKIYNITGYLIIFSYMLACMYSAPAHLGPWTGMLIGGVYFIFCWFLGGLY |
| Ga0137383_111074731 | 3300012199 | Vadose Zone Soil | VKIYNTTGYLIILSYMLACMYAAPAHWGPWTGVLIGGVYFIF |
| Ga0137382_101775091 | 3300012200 | Vadose Zone Soil | MKIYNITGYLIIFSYMLACMYSAPAHLGPWTGMLIGGVYFIFCW |
| Ga0137382_111402961 | 3300012200 | Vadose Zone Soil | MTRHGGGSIVKIYNLTGYLIIVLYMLACVYFAPAHLGPWAGLLIG |
| Ga0137363_101344372 | 3300012202 | Vadose Zone Soil | MQIYSITGYLIIFSQMLACMYSPPTHLGPWTGMLISGVYFIFCWFLGGLYLADVLVAGGR |
| Ga0137363_107394562 | 3300012202 | Vadose Zone Soil | MMKIYNVTGYLIIFAYMLACMYSAPTHLGPWIGMLIGGAYFIFCWFFG |
| Ga0137362_105755651 | 3300012205 | Vadose Zone Soil | MKIYNITGYLIIFCYMLACMYSAPAHLGPWTGMLIGGVYFIFCWFFGGLYLADVLHLGTARVNDFETGTHGI* |
| Ga0137370_108532011 | 3300012285 | Vadose Zone Soil | MTRHGGGSIVKIYNLTGYLIIVLYMLACVYFAPAHLGPWAGLLIGGVYFIFCWF |
| Ga0137384_112170981 | 3300012357 | Vadose Zone Soil | MKIYDVTGYLIIFFYMLACMYSAPTQLRPWTGILMG |
| Ga0137360_111353201 | 3300012361 | Vadose Zone Soil | MKIYNLTGYLIILSYILACMFSAPPHLGPWIGMLIGGVYFVFCWFFGGLYLADV |
| Ga0137390_115966071 | 3300012363 | Vadose Zone Soil | VKIYDITGYLIVFSYMLACMYSAPTHLGPWTGMLIGGVYFIFCWFLGGLYLADVLH |
| Ga0157334_10793881 | 3300012509 | Soil | MKIYNLAGYLVILTYMLVCTYFAPPQLGPWNGALIAAAYFIFCWFLGGLY |
| Ga0137397_105534881 | 3300012685 | Vadose Zone Soil | VKIYNVTGYLIILSYMLACLYFAPTHLGPWIGMLIGGAYFIFC |
| Ga0137397_107061071 | 3300012685 | Vadose Zone Soil | MKIYNLTVYLIIFSYMLACMYFAPAHLGPWTGMLIGGVYFIF |
| Ga0137395_105603071 | 3300012917 | Vadose Zone Soil | VKIYNITGYSIIFAYMLACMYFAPTHLGPWTGMLIGGVYFIFCWFLGGLYLADVLH |
| Ga0137396_107584292 | 3300012918 | Vadose Zone Soil | MKIYDITGYLIIFSYMLACMYSAPTHLGPWTGMLIGGVYFIFCWFLGGLYLADVLHLGI |
| Ga0137396_108753731 | 3300012918 | Vadose Zone Soil | MRIYNVTGYLIILCYMLACVYTAPTHLGPWIGMLIGGV |
| Ga0137359_108623651 | 3300012923 | Vadose Zone Soil | VKIYNITGYLIIFCYMLACMYSAPAHLGPWTGMLIGGVYFIF |
| Ga0137359_111600461 | 3300012923 | Vadose Zone Soil | MKIYNITGYLIIFSYMLACMYSAPAHLGPWAGMLIGGVYFIFCWFFGGLYLADV |
| Ga0137413_103211311 | 3300012924 | Vadose Zone Soil | VKIYNVYGYLFILAYLLACMYFAPPQLGPWAGMFIGAAYFIF |
| Ga0137413_114327342 | 3300012924 | Vadose Zone Soil | MKIYNLTGYLIIFSYMLACMYFAPAHLGPWTGILIA |
| Ga0137419_114684832 | 3300012925 | Vadose Zone Soil | MRIYNVTGYLIILCYMLACMYSAPTHLGPWIGMLIGAVYFIFCWFLG |
| Ga0137416_112416641 | 3300012927 | Vadose Zone Soil | MKIYNLTGYLIIFSYMLACMYSAPAHLGPWTGMLIGGVYFI |
| Ga0137404_102712982 | 3300012929 | Vadose Zone Soil | MKIYNITGYSVIFAYMLASMYFAPTHLRPWTGMLIGAVYFI |
| Ga0137407_118335281 | 3300012930 | Vadose Zone Soil | VKIYNVIGYLIILLYMLACMVSAPAHLGPWMGLLIGGVYFIF |
| Ga0126375_116941111 | 3300012948 | Tropical Forest Soil | VIVKSYNAIGYLIILLYLLACMYSAPAHLGPWAGLLVGAINFIFCWF |
| Ga0164298_116601662 | 3300012955 | Soil | MKIYNLTGYLIILSYMLGCVYFAPAHLGPWTGLLIGGIYFVFCWFLG |
| Ga0164299_113111301 | 3300012958 | Soil | VKIYNITGYLIILLYMLACMYSAPTRLGPWAGLLIGGIYFIFCWFLAGLYLAD |
| Ga0164304_108197761 | 3300012986 | Soil | MKIYSLMGYLVIAFYLLACIYSAPVQLGPWIGFLMGGAYLIFCWFMGGLYLADVLHLG |
| Ga0164306_104470971 | 3300012988 | Soil | VKIYNITGYLIILLYMLACMYSAPTRLGPWAGLLIGGVYFIFCWFLAGLYLADVLH |
| Ga0157374_101990124 | 3300013296 | Miscanthus Rhizosphere | MARRGAIMKIYNLTGYLIILSYMLGCVYFAPAHLGPWTGLLIGGIYFVFCWFLGGLYLAD |
| Ga0157378_100004021 | 3300013297 | Miscanthus Rhizosphere | VRIYNITGYLIIFAYMLACMYSAPTHLGPWIGMSIGGIYFV |
| Ga0157375_120362902 | 3300013308 | Miscanthus Rhizosphere | MKIYNVYGYLIILAYLLACMLSAPAQWGPWRGLLIGVTYFIF |
| Ga0157375_134573171 | 3300013308 | Miscanthus Rhizosphere | MKIYNFTGYLIIFSYMLGCVYFAPAHLGPWAGLLIGGIYFVFCWFLGGLYL |
| Ga0157376_126566091 | 3300014969 | Miscanthus Rhizosphere | MIVKGYNFIGYLIILLYALACMYSAPISLGPWEGLLIGATYFIFCWFFAGLY |
| Ga0137420_11406871 | 3300015054 | Vadose Zone Soil | VKIYNITGYLIIFCYMLACMYSAPAHLGPWTGMLIGGVYFIFCWFL |
| Ga0137412_110586292 | 3300015242 | Vadose Zone Soil | MKIYNLTGYLIIFSYMLACMYFAPAHLGPWTGILIAGVYFIF |
| Ga0137409_101438734 | 3300015245 | Vadose Zone Soil | VKIYNVAGYLIILAYMLACAYFAPTHLGPWMGILIGGAYFIFCWFFGGLYLADVLHLG |
| Ga0137403_115726812 | 3300015264 | Vadose Zone Soil | VKRYNVIGYLIILAYMLACMYSAPAHLGPWTGLLIGAVY |
| Ga0134072_104216821 | 3300015357 | Grasslands Soil | MKIYSLIGYLVIFLYLLACMYSAPTQLGPWTGILMGGAYLMFC |
| Ga0132257_1002343425 | 3300015373 | Arabidopsis Rhizosphere | MKIYNTTGYLIIVAYMLACMYFAPTHLGPWIGMLIGG |
| Ga0132255_1021372911 | 3300015374 | Arabidopsis Rhizosphere | MKTYNVIGYSIILCYMLACMYFAPAHLGPWTGMLIGGVYFVFCWFLGGLYLADV |
| Ga0132255_1054962981 | 3300015374 | Arabidopsis Rhizosphere | VKIYNITGYLIILLYMLACMYSAPTRLGPWAGLLIGGIY |
| Ga0182036_114413922 | 3300016270 | Soil | MSRTGDTMKTYNAIGYGIIAAYLVACAYSAPAHLGPWRGLLIGGIYFIFCWFLAGLYLADVLH |
| Ga0182041_104533412 | 3300016294 | Soil | VKTYNVTGYLIILLYLLACMFSAPTQMGPWKGLLIGNA |
| Ga0187777_101810281 | 3300017974 | Tropical Peatland | VKIYNVIGYSIILCYLLACVYAAPPRLGPWAGLLIG |
| Ga0187822_103714351 | 3300017994 | Freshwater Sediment | MKSYNLIGYLIILSYFLACAYFAPAHLGLRSALLIGAGYF |
| Ga0066667_114353871 | 3300018433 | Grasslands Soil | MKIYSLTGYLVIFFYLLACMYSAPAQLGPWTGILTSGAYLIFCWFMGGLYLADVLHL |
| Ga0066662_125586912 | 3300018468 | Grasslands Soil | MKMYNVIGYLIILCYMLGCIYFGPAQLGPWIAMLIGGAYFVFC |
| Ga0066669_122325231 | 3300018482 | Grasslands Soil | MKIYNVAGYLIILAYLLACMFSAPPQSGPWEGLFIGGAYFIFIWFLG |
| Ga0193722_10975212 | 3300019877 | Soil | VKTYNITGYSIIFAYLLACMYFAPTHLGPWTGMLIGAVYFIFCWFLGGLYLADVLHL |
| Ga0179590_10437261 | 3300020140 | Vadose Zone Soil | MKIYNITGYSIIFAYMLACMYFAPTHLGPWTAMLIG |
| Ga0179594_104117511 | 3300020170 | Vadose Zone Soil | MKIYNITGYLIIFCYMLACMYSAPAHLGPWTGMLIG |
| Ga0179592_100852893 | 3300020199 | Vadose Zone Soil | VKIYNVIGYLIILLYMLACMVSAPAHLGPWMGLLIGGV |
| Ga0210407_100476411 | 3300020579 | Soil | MKIYNLTGYLIIFCYVLACMYSAPAHLGPWMGMLIGGVYFIFC |
| Ga0210407_109077072 | 3300020579 | Soil | MKIYNLTGYLIILAYMLGCMYFAPAHLGPWAGILIGGVYFIFCWFLGGLYLAD |
| Ga0210403_102014621 | 3300020580 | Soil | MKIYNLTGYLIILSYMLACMYSAPAHLGPWMGMLIGGAYFIFCWFFG |
| Ga0210403_109067792 | 3300020580 | Soil | MKIYNLTGYLIIFCYMLACMYSAPAHLGPWIGMLIGGAYFIFCWF |
| Ga0210403_109303411 | 3300020580 | Soil | LKIYNVYGYLIILFYLLACMFSAPTHLGPWAGLFIGAAYFIFC |
| Ga0210399_101914543 | 3300020581 | Soil | MKTYNIWGYLIILLYALACMYSAPAHLGPWMGLLIGGVYFVFCWFLG |
| Ga0210399_104721184 | 3300020581 | Soil | MKMYNIAGYLIIFSYMLACMYFAPTHLGPWIGMLIGGV |
| Ga0210399_111665122 | 3300020581 | Soil | VKIYNVTGYLIILAYMLACMYSAPTHLGPWIGMLIGGAYFIFCWFMGGLY |
| Ga0210404_107601061 | 3300021088 | Soil | MKIYNLAGYLIVGSYVLACVYTAPAHLGPGKGLLIGAVYFVFCWFLGGLYLADVLHLG |
| Ga0210400_105435732 | 3300021170 | Soil | MKIYNLTGYLIIFAYMLACIYSAPAHLGPWMGMFIGGA |
| Ga0210405_100046551 | 3300021171 | Soil | VKIYNVTGYLIILAYMLACMYSAPTHLGPWIGMLIGGAY |
| Ga0210405_108896491 | 3300021171 | Soil | VKIYNLTGYLIIVLYLLACMYFAPAHMGPWTGLLIGGVYFIFCWFSGG |
| Ga0210408_106877961 | 3300021178 | Soil | MKIYNLIGYLIILLYVLACAYFAPAHLGPWVGILIGGSYF |
| Ga0210388_101393341 | 3300021181 | Soil | VKIYNVTGYLIIFLYMLACMVSAPAHMGPWIGLLIGGGYFIFCW |
| Ga0213881_105520542 | 3300021374 | Exposed Rock | VKIYNVTGYLIILLYMLACMYSAPARLGPWTGLLIGGSYFVICWFVGGLYLADI |
| Ga0210393_104991142 | 3300021401 | Soil | MKIYNFTGYSIILCYLLACMYFAPSHLGPWKGMLIGGIYFVACWFLAGLYLADVLH |
| Ga0210385_115244632 | 3300021402 | Soil | VKIYNFYGYLIILAYALACMFFAPAHLGPWLGLLIGAAYFIGCWFF |
| Ga0210389_106491941 | 3300021404 | Soil | MKIYNLVGYLIVFAYTLACMYFAPAHLGPWKGLAIG |
| Ga0210386_107959032 | 3300021406 | Soil | MKIYNITGYLIISSYMLACMYFAPAHLGPWIGILIGGVYFIFCWFLGG |
| Ga0210394_106117022 | 3300021420 | Soil | MKIYNLTGYLIIFSYMLACMYSAPAHLGPWTGMVIGGV |
| Ga0210394_114980811 | 3300021420 | Soil | MKTYNLWGYLIILLYALACMYSAPAHLGPWMGLLIGGVYFVFCWFLGGLYLADLLHLG |
| Ga0210391_100515711 | 3300021433 | Soil | MKIYNLAGYLIVGSYVLACVYTAPAHLGPGKGLLIGAVYFIFCWFLGGLYLADV |
| Ga0210391_108220192 | 3300021433 | Soil | VKIYNVTGYLIIFLYMLACMVSAPAHLGPWIGLLIGGGYFIFCWFMGGLYLAD |
| Ga0210391_115896382 | 3300021433 | Soil | MKIYNLTGYLIILCYMLACMYFAPAHLGPWTGMLIAAVYFIFAG |
| Ga0210398_100236935 | 3300021477 | Soil | MKIYNLTGYLIIALYAVACVYSAPAHLAPWKGLLIGLAYFI |
| Ga0210398_108043441 | 3300021477 | Soil | MKIYNLVGYLIVFAYTLACMYFAPAHLGPWKGLAI |
| Ga0210402_102964103 | 3300021478 | Soil | VKIYNVTGYLIILLYMLACMVSAPAHLGPWIGMLIAGAYFIFCWFMGGLYLADVLHLGIEHRS |
| Ga0210402_120339612 | 3300021478 | Soil | MKIYNIYGYLIIVLYLLACAFSAPAHLGPWLGLLI |
| Ga0210410_100047971 | 3300021479 | Soil | VKIYNVTGYLIILAYMLACMYFAPTHLGPWIGMLIGGAYFIFCWFMGGLYLA |
| Ga0210410_115814032 | 3300021479 | Soil | MTPWGVLMKIYNVIGYSIIFAYLLACMYFAPGHLGPWMGMLIGGVYFIFCW |
| Ga0210409_110757051 | 3300021559 | Soil | MKIYNLTGYSIIFCYMLACMYSAPAHLGPWIGMLIGGVYFIFCWFLGGL |
| Ga0126371_103532621 | 3300021560 | Tropical Forest Soil | MKIYNFYGYLIIAAYVLACAYFSPADLGPGKGILIGAGYFIFGWF |
| Ga0126371_108773451 | 3300021560 | Tropical Forest Soil | VKIYNVIGYLIILLYTLACMYSAPTPLGPWKGLLLGAAYFIFCWFLGALYLADVL |
| Ga0242655_100844701 | 3300022532 | Soil | MKIYNLAGYLIILAYTVACMYFVPAHLGLWTGMLIATAYFIFCWFMGGLYLADVLHL |
| Ga0212123_104408821 | 3300022557 | Iron-Sulfur Acid Spring | MKTYNIIGYLIILCYTLACVYFTPRHLGPWTGLLISGAYFIFCWFLGGLYL |
| Ga0224544_10354961 | 3300023250 | Soil | MKIYNITGYLIIASYMLACMYSAPAHLGPWIGMLIG |
| Ga0224551_10842952 | 3300023259 | Soil | MKKYNITGYLIIFSYMLACMYSAPARLGPWTGLLIGEVYFIFCWFMGGLYLADVLHLSIA |
| Ga0247669_10559372 | 3300024182 | Soil | VKIYNLYGCLIILAYMLACVYSAPAHLGPWIGMLIGGAYFIFCWFMGGLYLAD |
| Ga0207685_101691661 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | VKIYNVTGYLIILSYVLACIYSAPTHLGPWMGMLIGGAYFIFCWFMGGLYLADVL |
| Ga0207685_102203182 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | VKVYNVTGYLIILVYMLACMYSAPGNLGPWTGLLIGAVYFV |
| Ga0207699_106399211 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | VKIYNVYGYLTILAYALACMYFAPAHLGPWFGLAIGAIYFIGCWFMA |
| Ga0207707_103782832 | 3300025912 | Corn Rhizosphere | MKIYNLAGYSIILSYIAASVYFAPARLGPWMGLLIGGVYFVF |
| Ga0207693_100368984 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MKTYNLAGYLIILVYILACMFFAPAHLGPWTGLLIGGAYFIFCWFMGGLYLADVLHLGIVHGAL |
| Ga0207693_102040411 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MKIYNLTGYSIIFAYMLACVYSAPAHLRPWTGMLIGGVYF |
| Ga0207693_105802373 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | LKIYNVYGYLIILCYVLACAYFAPPRLGPWIGMLIGAIYFVFCWFL |
| Ga0207660_101460381 | 3300025917 | Corn Rhizosphere | MKIYNLTGSLIILFYLLACMYSAPTQIGPWMGLLIGGVYFIFCWFVAGLYLA |
| Ga0207700_106087901 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MKSYNLAGYLIILLYVLASMFFAPAHLGPWIGVLIGGAYFIFCWFMGGLYLADVLHLGIVHGALNYKTWF |
| Ga0207644_116500171 | 3300025931 | Switchgrass Rhizosphere | MKIYNLTGYLIILSYMLGCVYFAPAHLGPWTGLLIGGIYFVFCWF |
| Ga0207670_116813261 | 3300025936 | Switchgrass Rhizosphere | MKIYSLAGYSIIVFYLLGCAYFAPAYWGPWAGTLIGG |
| Ga0207669_107846251 | 3300025937 | Miscanthus Rhizosphere | MKIYNLTGSLIILFYLLACMYSAPTQIGPWMGLLIGGVYFIFCWFVAGLYLADLL |
| Ga0207704_109912763 | 3300025938 | Miscanthus Rhizosphere | MKIYNLTGYLIMLAYMLVCIYFAPPNLGPWTGALIAAAYFIFCWFLGGLYLADLL |
| Ga0207665_105380442 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MKIYNVIGYSIILCYMLACMHFAPARLGPWTGMLIGGVYF |
| Ga0207667_106618083 | 3300025949 | Corn Rhizosphere | MKIYNLTGYLIMLVYMLVCIYFAPPNLGPWTGALIAAAYFIFCWFLGGLYLADLL |
| Ga0207668_118521642 | 3300025972 | Switchgrass Rhizosphere | MKLYNVTGYLIILAYLLACMYSAPAHLGPWIGLLI |
| Ga0207639_111746461 | 3300026041 | Corn Rhizosphere | MKIYNLTGYLIMLAYMLVCIYFAPPNLGPWTGALIAAAYFIFCWFLGGLYLADL |
| Ga0207708_101635114 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | MKIYNLTGYLIMLAYMLVCIYFAPPNLGPWTGALIAAAYFIFCWFLGGLYLA |
| Ga0207702_103847671 | 3300026078 | Corn Rhizosphere | MKIYSLTGYLVIFSYLLACMYSAPTQLGPWTGLLMGGAYL |
| Ga0209238_10166182 | 3300026301 | Grasslands Soil | VKIYNVTGYLIIFAYMLACMYSAPTHLGPWIGMLVGGIYFIFCWFFG |
| Ga0209238_10531512 | 3300026301 | Grasslands Soil | VKIYNITGYLIIFAYLLACMYSAPAHLGPWTGMLIGGAYFIFC |
| Ga0209131_13277291 | 3300026320 | Grasslands Soil | VKIYNVVGYSIIVAYMLACMYSAPTHLGPWIGMLIGGAYFIFCWFLGGLYLADVLHMGIA |
| Ga0257169_10012604 | 3300026469 | Soil | MKIYNIAGYSIIFAYMLACMYFAPTHLGPWTGMLIGAVYFIF |
| Ga0257147_10378262 | 3300026475 | Soil | MKTYNLIGYSIIVFYLLASMWLAPAYLGPWIGLLIGGAYFIFCWFFGGLYLADLLHLG |
| Ga0209474_104557842 | 3300026550 | Soil | MKIYSLTGYLIIFFYLLACMYSAPTQSGPWISVLVGGAYLVFCWFM |
| Ga0209648_107532481 | 3300026551 | Grasslands Soil | MKIYNLTGYLIILSYMLACTFFAPAHLGPWAGILIAGVYFIFCWFM |
| Ga0179587_102924121 | 3300026557 | Vadose Zone Soil | MKIYNLTGYVIIFFYMLACMYSAPAHLGPWTGMLIGGVYFIFCWFLGG |
| Ga0208098_10179651 | 3300027172 | Forest Soil | MKIYNITGYLIISSYMLACMYFAPAHLGPWIGILVGGVYFIFCWFLGGLYLADVLHLGI |
| Ga0209008_11465212 | 3300027545 | Forest Soil | MKIYNLTGYLIILAYLLACMYSAPAHLGPWIGMLIGGVYFVFCWFLGGLYLADVLH |
| Ga0209733_11548762 | 3300027591 | Forest Soil | VKIYNLIGYLIIFLYMLASAYFAPAHLGPWTGMLIG |
| Ga0209117_11077672 | 3300027645 | Forest Soil | VKIYNLTGYLIIVCYLLACMYSAPAHLGPWMGMLIGGVYFIFCWFFAGLYLADLLHLGI |
| Ga0209117_11374532 | 3300027645 | Forest Soil | MTPRGVIVKIYNITGYSIILAYMLACMYFAPAHWGPWTGMLIGAVYFIFCWFLGGLYLAD |
| Ga0209009_11162251 | 3300027667 | Forest Soil | MKIYNFTGYSIILCYLLACMYFAPSHLGPWKGMLIGG |
| Ga0209038_101546311 | 3300027737 | Bog Forest Soil | MKIYNFVGYLIIFFYMLACMYSAPAHLGPWKGLLIGTGYFIFCWFLGGLYLADVLHLG |
| Ga0209073_102585912 | 3300027765 | Agricultural Soil | VKIYNLTGYLIILLYMLACMFSAPAHLGPWTGILIGGVYFIF |
| Ga0209772_101162002 | 3300027768 | Bog Forest Soil | VKIYNVIGYLIILLYVLACMYFAPTYLGPWTGVLIGAVYFIFCWFMGGLYLADVLHLGI |
| Ga0209448_100329341 | 3300027783 | Bog Forest Soil | MSPQGVTMKIYNISGYLIIFAYMLACMYSAPTHLGPWIGMLIGGAYFI |
| Ga0209656_104820741 | 3300027812 | Bog Forest Soil | MKIYNATGYLIIFSYMLACMYSAPAQLGPWAGVLIGGAYFIFCWFLAGLYLADVLH |
| Ga0209580_102502042 | 3300027842 | Surface Soil | VKIYNVTGYLIIFAYLLACMYSAPTQWTGILIGGAYLIFCW |
| Ga0209274_101554332 | 3300027853 | Soil | MKIYNLVGYLIIVSYALACMYFAPAHLRPWSGLFIGAIYFIFCWFMGGLYLADVLH |
| Ga0209274_105365732 | 3300027853 | Soil | MKIYSLTGYLIIILSMLACVYSAPAHLGPWKGLLIGAVYFTFCWFMGGLYLADVLHLG |
| Ga0209169_100878943 | 3300027879 | Soil | VKIYNFYGYLTILAYALACMYFAPAHLGPWLGLLIGAIYFIA |
| Ga0209169_106324712 | 3300027879 | Soil | MKIYNLTGYLIIFSYMLGCLYFAPAHLGLWKGLLVGEAYFLSCWFLGGLYLADV |
| Ga0209275_102372451 | 3300027884 | Soil | VKIYNFYGYLIILAYAAACMYFAPARFGPWLGLLIGAIYFIGCWFM |
| Ga0209380_102405482 | 3300027889 | Soil | VKIYNFYGYLIILAYALACMYFAPAHLGPWRALWIGAIYFIACWFMAGLYLADVLH |
| Ga0209380_107192821 | 3300027889 | Soil | MKIYDVAGYLIILAYMLACMYSAPAHLGPWIGMLIGGVYFIFCWFLAGL |
| Ga0209067_106506412 | 3300027898 | Watersheds | VKSYNLVGYSIICLYALACMYFAPPHFGPWIGLLIGGVYFLTFW |
| Ga0209488_108698612 | 3300027903 | Vadose Zone Soil | MKIYNITGYLIIFSYMLACMYSAPAHLGPWAGMLIGGVYFI |
| Ga0265354_10200551 | 3300028016 | Rhizosphere | MKTYNLIGYLIILSYALACVFFAPAHLGPWTALLIGGVYFI |
| Ga0137415_107798241 | 3300028536 | Vadose Zone Soil | MKIYNITGYLIIFCYMLACMYSAPAHLGPWTGMLIGGVYFIFCWV |
| Ga0222749_104672142 | 3300029636 | Soil | LLVERGVIMKLYNITGYLIILFYMLACMYSAPTHLGPWTGMLIG |
| Ga0311368_104707472 | 3300029882 | Palsa | MKIYSLTGYLIVILSMLACVYSAPAHLGPWKGLLIGAVYFIF |
| Ga0311328_102225742 | 3300029939 | Bog | MKSYNLAGYGIIFLYMLTCTYFVPAHLGPWKGMLIAGAYFIFCWFMGGLYL |
| Ga0302274_101477992 | 3300030041 | Bog | MKSYNLAGYGIIFLYMLTCTYFVPAHLGPWKGMLIAGAYFIFC |
| Ga0170824_1192764451 | 3300031231 | Forest Soil | VKIYNVTGYLIILLYMLACVYSAPAYLGPWIGLLIGGGYFIFC |
| Ga0302140_110699732 | 3300031261 | Bog | MILRRCIVKIYNVTGWLIILAYMLACMFFAPSQLGPWAGLLIGGVYFIFCWFLAGLYLADVLH |
| Ga0170820_100526231 | 3300031446 | Forest Soil | MKIYNLYGYLISFAYLLACSYSAPTHLGPWIGMLIG |
| Ga0170818_1142143001 | 3300031474 | Forest Soil | VKIYNVTGYLIILLYMLACMYSAPTHLGTWTGLLIGGIYFI |
| Ga0302326_107559793 | 3300031525 | Palsa | MKIYSLTGYLIIILSMLACVYSAPAHLGPWKGLLIGAVYFIFCWFMGGLYLADVLHMGIA |
| Ga0310686_1031170971 | 3300031708 | Soil | MKIYNLAGYLIVFGYMLACMYTAPAHLGLWKGLLIGAGYFIFCWFI |
| Ga0307469_110432982 | 3300031720 | Hardwood Forest Soil | MYNVTGYLIILSYVLACMYSAPTHLGPWMGMLIGGAYFIFCWFMGGLYL |
| Ga0307477_102476951 | 3300031753 | Hardwood Forest Soil | VKIYNLTGYLIIVLYMLASMYFAPAHLGPWTGLLIGGVYFIFCWF |
| Ga0307477_103069241 | 3300031753 | Hardwood Forest Soil | VKIYNVIGYLIILLYMLACMYSVPAHLGPWNELLIGAVYFFF |
| Ga0307475_105025031 | 3300031754 | Hardwood Forest Soil | VKIYNITGYSIIFAYMLACMYFAPTHFGPWLGMLAGGVYFIFCWFLGGL |
| Ga0307478_100419868 | 3300031823 | Hardwood Forest Soil | VKIYNLTGYLIIVLYLLASMYFAPAHLGPWTGLLIGG |
| Ga0318520_110361141 | 3300031897 | Soil | VKIYNFWGYLIILAYALACMYSAPAQLGPWKGLLIGAAYFVFCWFLAGLYLADVLHMGLAHR |
| Ga0308175_1020102581 | 3300031938 | Soil | MKIYNLAGYSIILSYIAASVYFAPAHLGPWMGLLIGGVYFVFCWFVA |
| Ga0310910_114142381 | 3300031946 | Soil | VKIYNFWGYLIILAYALACMYSAPAQLGPWKGLLIGAAYFVFC |
| Ga0307479_100406079 | 3300031962 | Hardwood Forest Soil | VKIYNLTGYLIIVLYMLASMYFAPAHLGPWTGLLIGGVYFIFC |
| Ga0307479_104920901 | 3300031962 | Hardwood Forest Soil | VKIYNAIGYLIILLYMLACFYFAPTHLGPWAGLLIGGVYFIFC |
| Ga0318549_101518542 | 3300032041 | Soil | VKIYNFWGYLIILAYALACMYSAPAQLGPWKGLLIGAAYF |
| Ga0335080_105930941 | 3300032828 | Soil | MKKYNLAGYLIIVYYLLACAYAAPARLGPWTGMLIGAGYLVFCWFLAGLYLADVLHMG |
| Ga0316628_1039043552 | 3300033513 | Soil | MKTYNLIGYLIIVFYILACVFFAPAHLGPWIALSIGGAYFIF |
| ⦗Top⦘ |