| Basic Information | |
|---|---|
| Family ID | F016988 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 243 |
| Average Sequence Length | 44 residues |
| Representative Sequence | MKATLYEALGILPTSSDEDVRAALRRLIRKYYAKTRDGQGNVEEA |
| Number of Associated Samples | 209 |
| Number of Associated Scaffolds | 243 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 36.21 % |
| % of genes near scaffold ends (potentially truncated) | 99.59 % |
| % of genes from short scaffolds (< 2000 bps) | 94.24 % |
| Associated GOLD sequencing projects | 194 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.55 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (62.551 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere (5.350 % of family members) |
| Environment Ontology (ENVO) | Unclassified (44.444 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (46.091 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 35.62% β-sheet: 0.00% Coil/Unstructured: 64.38% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.55 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 243 Family Scaffolds |
|---|---|---|
| PF01245 | Ribosomal_L19 | 79.84 |
| PF01746 | tRNA_m1G_MT | 7.00 |
| PF00226 | DnaJ | 3.70 |
| PF05239 | PRC | 2.06 |
| PF00886 | Ribosomal_S16 | 0.82 |
| PF01556 | DnaJ_C | 0.41 |
| PF01595 | CNNM | 0.41 |
| COG ID | Name | Functional Category | % Frequency in 243 Family Scaffolds |
|---|---|---|---|
| COG0335 | Ribosomal protein L19 | Translation, ribosomal structure and biogenesis [J] | 79.84 |
| COG0228 | Ribosomal protein S16 | Translation, ribosomal structure and biogenesis [J] | 0.82 |
| COG0484 | DnaJ-class molecular chaperone with C-terminal Zn finger domain | Posttranslational modification, protein turnover, chaperones [O] | 0.41 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 62.55 % |
| Unclassified | root | N/A | 37.45 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000956|JGI10216J12902_113171060 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
| 3300001431|F14TB_100495145 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| 3300004012|Ga0055464_10140578 | Not Available | 693 | Open in IMG/M |
| 3300004079|Ga0055514_10208668 | All Organisms → cellular organisms → Bacteria → Thermodesulfobacteria → Thermodesulfobacteria → Thermodesulfobacteriales → Thermodesulfobacteriaceae → Thermodesulfatator → Thermodesulfatator atlanticus | 560 | Open in IMG/M |
| 3300004091|Ga0062387_100358868 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae | 965 | Open in IMG/M |
| 3300004463|Ga0063356_104943022 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
| 3300004643|Ga0062591_100980525 | All Organisms → cellular organisms → Bacteria | 802 | Open in IMG/M |
| 3300005181|Ga0066678_10551811 | All Organisms → cellular organisms → Bacteria | 765 | Open in IMG/M |
| 3300005218|Ga0068996_10138810 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
| 3300005328|Ga0070676_11547533 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
| 3300005333|Ga0070677_10332589 | All Organisms → cellular organisms → Bacteria | 781 | Open in IMG/M |
| 3300005337|Ga0070682_100193965 | All Organisms → cellular organisms → Bacteria | 1428 | Open in IMG/M |
| 3300005339|Ga0070660_100959702 | All Organisms → cellular organisms → Bacteria | 722 | Open in IMG/M |
| 3300005340|Ga0070689_100841535 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 809 | Open in IMG/M |
| 3300005343|Ga0070687_101263095 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
| 3300005347|Ga0070668_101360468 | All Organisms → cellular organisms → Bacteria | 647 | Open in IMG/M |
| 3300005347|Ga0070668_102084806 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
| 3300005353|Ga0070669_100330039 | All Organisms → cellular organisms → Bacteria | 1234 | Open in IMG/M |
| 3300005355|Ga0070671_102081749 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 505 | Open in IMG/M |
| 3300005364|Ga0070673_101477643 | All Organisms → cellular organisms → Bacteria | 641 | Open in IMG/M |
| 3300005365|Ga0070688_100025219 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 3518 | Open in IMG/M |
| 3300005367|Ga0070667_101539235 | All Organisms → cellular organisms → Bacteria | 625 | Open in IMG/M |
| 3300005439|Ga0070711_101908821 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
| 3300005456|Ga0070678_101407575 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
| 3300005458|Ga0070681_11140758 | All Organisms → cellular organisms → Bacteria | 701 | Open in IMG/M |
| 3300005459|Ga0068867_100931068 | All Organisms → cellular organisms → Bacteria | 784 | Open in IMG/M |
| 3300005467|Ga0070706_100493431 | All Organisms → cellular organisms → Bacteria | 1139 | Open in IMG/M |
| 3300005467|Ga0070706_101299557 | All Organisms → cellular organisms → Bacteria | 667 | Open in IMG/M |
| 3300005530|Ga0070679_100212112 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1900 | Open in IMG/M |
| 3300005530|Ga0070679_101734146 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
| 3300005535|Ga0070684_100610956 | All Organisms → cellular organisms → Bacteria | 1014 | Open in IMG/M |
| 3300005539|Ga0068853_100817819 | All Organisms → cellular organisms → Bacteria | 893 | Open in IMG/M |
| 3300005548|Ga0070665_100752270 | All Organisms → cellular organisms → Bacteria | 988 | Open in IMG/M |
| 3300005549|Ga0070704_100489158 | All Organisms → cellular organisms → Bacteria | 1066 | Open in IMG/M |
| 3300005553|Ga0066695_10417598 | All Organisms → cellular organisms → Bacteria | 830 | Open in IMG/M |
| 3300005563|Ga0068855_101329643 | All Organisms → cellular organisms → Bacteria | 743 | Open in IMG/M |
| 3300005578|Ga0068854_101148479 | All Organisms → cellular organisms → Bacteria | 694 | Open in IMG/M |
| 3300005586|Ga0066691_10627903 | All Organisms → cellular organisms → Bacteria | 638 | Open in IMG/M |
| 3300005617|Ga0068859_101920386 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 654 | Open in IMG/M |
| 3300005617|Ga0068859_102074602 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 628 | Open in IMG/M |
| 3300005719|Ga0068861_100710231 | All Organisms → cellular organisms → Bacteria | 935 | Open in IMG/M |
| 3300005825|Ga0074476_1276255 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
| 3300005836|Ga0074470_11754897 | All Organisms → cellular organisms → Bacteria | 752 | Open in IMG/M |
| 3300005840|Ga0068870_10981814 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
| 3300005841|Ga0068863_102615764 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300005841|Ga0068863_102749142 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300005843|Ga0068860_101531046 | All Organisms → cellular organisms → Bacteria | 689 | Open in IMG/M |
| 3300005844|Ga0068862_100374501 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1326 | Open in IMG/M |
| 3300006032|Ga0066696_10240431 | All Organisms → cellular organisms → Bacteria | 1167 | Open in IMG/M |
| 3300006057|Ga0075026_100415569 | All Organisms → cellular organisms → Bacteria | 759 | Open in IMG/M |
| 3300006224|Ga0079037_102635981 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300006237|Ga0097621_101311980 | All Organisms → cellular organisms → Bacteria | 684 | Open in IMG/M |
| 3300006354|Ga0075021_10504481 | All Organisms → cellular organisms → Bacteria | 767 | Open in IMG/M |
| 3300006577|Ga0074050_11819699 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
| 3300006604|Ga0074060_11415892 | Not Available | 546 | Open in IMG/M |
| 3300006794|Ga0066658_10464575 | All Organisms → cellular organisms → Bacteria | 689 | Open in IMG/M |
| 3300006844|Ga0075428_100137058 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2661 | Open in IMG/M |
| 3300006844|Ga0075428_100949720 | All Organisms → cellular organisms → Bacteria | 911 | Open in IMG/M |
| 3300006844|Ga0075428_102072956 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
| 3300006854|Ga0075425_101213017 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 857 | Open in IMG/M |
| 3300006871|Ga0075434_101197621 | All Organisms → cellular organisms → Bacteria | 772 | Open in IMG/M |
| 3300006871|Ga0075434_101749903 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae | 629 | Open in IMG/M |
| 3300006881|Ga0068865_100875386 | All Organisms → cellular organisms → Bacteria | 780 | Open in IMG/M |
| 3300006950|Ga0075524_10135042 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1065 | Open in IMG/M |
| 3300006953|Ga0074063_14090914 | All Organisms → cellular organisms → Bacteria | 1281 | Open in IMG/M |
| 3300007004|Ga0079218_12287611 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
| 3300007788|Ga0099795_10439228 | Not Available | 599 | Open in IMG/M |
| 3300007788|Ga0099795_10631475 | Not Available | 511 | Open in IMG/M |
| 3300009075|Ga0105090_10050901 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2588 | Open in IMG/M |
| 3300009075|Ga0105090_10623298 | Not Available | 655 | Open in IMG/M |
| 3300009085|Ga0105103_10002366 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 9849 | Open in IMG/M |
| 3300009091|Ga0102851_10270680 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1642 | Open in IMG/M |
| 3300009143|Ga0099792_10782333 | Not Available | 624 | Open in IMG/M |
| 3300009156|Ga0111538_12425906 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 658 | Open in IMG/M |
| 3300009167|Ga0113563_10933631 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 993 | Open in IMG/M |
| 3300009167|Ga0113563_11480575 | Not Available | 799 | Open in IMG/M |
| 3300009167|Ga0113563_11936110 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 703 | Open in IMG/M |
| 3300009174|Ga0105241_11851442 | Not Available | 590 | Open in IMG/M |
| 3300009179|Ga0115028_11989581 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 512 | Open in IMG/M |
| 3300010043|Ga0126380_10273567 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae | 1184 | Open in IMG/M |
| 3300010043|Ga0126380_10739122 | Not Available | 796 | Open in IMG/M |
| 3300010304|Ga0134088_10182625 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1003 | Open in IMG/M |
| 3300010329|Ga0134111_10393061 | Not Available | 593 | Open in IMG/M |
| 3300010398|Ga0126383_13099130 | Not Available | 543 | Open in IMG/M |
| 3300010399|Ga0134127_10774454 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1006 | Open in IMG/M |
| 3300010399|Ga0134127_12335348 | Not Available | 614 | Open in IMG/M |
| 3300010400|Ga0134122_10072556 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2677 | Open in IMG/M |
| 3300011119|Ga0105246_10148478 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1772 | Open in IMG/M |
| 3300011444|Ga0137463_1247420 | Not Available | 665 | Open in IMG/M |
| 3300012206|Ga0137380_10649986 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae | 919 | Open in IMG/M |
| 3300012209|Ga0137379_10676805 | Not Available | 938 | Open in IMG/M |
| 3300012285|Ga0137370_11021665 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 508 | Open in IMG/M |
| 3300012357|Ga0137384_11370845 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
| 3300012361|Ga0137360_11096623 | Not Available | 688 | Open in IMG/M |
| 3300012469|Ga0150984_119092271 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1453 | Open in IMG/M |
| 3300012519|Ga0157352_1082893 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 540 | Open in IMG/M |
| 3300012530|Ga0136635_10278749 | Not Available | 591 | Open in IMG/M |
| 3300012958|Ga0164299_10361702 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 917 | Open in IMG/M |
| 3300012961|Ga0164302_11119341 | Not Available | 623 | Open in IMG/M |
| 3300012971|Ga0126369_11914566 | Not Available | 681 | Open in IMG/M |
| 3300012971|Ga0126369_13307679 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
| 3300012987|Ga0164307_10760423 | Not Available | 766 | Open in IMG/M |
| 3300013100|Ga0157373_11041245 | Not Available | 612 | Open in IMG/M |
| 3300013100|Ga0157373_11480561 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 518 | Open in IMG/M |
| 3300013104|Ga0157370_10030616 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 5272 | Open in IMG/M |
| 3300013297|Ga0157378_10903481 | Not Available | 914 | Open in IMG/M |
| 3300013306|Ga0163162_11376597 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 802 | Open in IMG/M |
| 3300013308|Ga0157375_11975983 | Not Available | 693 | Open in IMG/M |
| 3300013308|Ga0157375_13275484 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 540 | Open in IMG/M |
| 3300014166|Ga0134079_10260871 | Not Available | 754 | Open in IMG/M |
| 3300014317|Ga0075343_1171660 | Not Available | 549 | Open in IMG/M |
| 3300014326|Ga0157380_13355084 | Not Available | 512 | Open in IMG/M |
| 3300014968|Ga0157379_12015081 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 571 | Open in IMG/M |
| 3300014968|Ga0157379_12345754 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 532 | Open in IMG/M |
| 3300014969|Ga0157376_10732020 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 997 | Open in IMG/M |
| 3300014969|Ga0157376_11516874 | Not Available | 703 | Open in IMG/M |
| 3300014969|Ga0157376_12386990 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
| 3300015080|Ga0167639_1007985 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1544 | Open in IMG/M |
| 3300015357|Ga0134072_10428969 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 528 | Open in IMG/M |
| 3300015359|Ga0134085_10349578 | Not Available | 657 | Open in IMG/M |
| 3300016371|Ga0182034_11385756 | Not Available | 614 | Open in IMG/M |
| 3300017966|Ga0187776_11446639 | Not Available | 525 | Open in IMG/M |
| 3300017974|Ga0187777_10475782 | Not Available | 871 | Open in IMG/M |
| 3300018032|Ga0187788_10319281 | Not Available | 634 | Open in IMG/M |
| 3300018053|Ga0184626_10422954 | Not Available | 528 | Open in IMG/M |
| 3300018060|Ga0187765_10680124 | Not Available | 673 | Open in IMG/M |
| 3300018072|Ga0184635_10171227 | Not Available | 867 | Open in IMG/M |
| 3300018078|Ga0184612_10031577 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae | 2740 | Open in IMG/M |
| 3300018083|Ga0184628_10226064 | Not Available | 981 | Open in IMG/M |
| 3300018433|Ga0066667_11955253 | Not Available | 537 | Open in IMG/M |
| 3300018469|Ga0190270_12117804 | Not Available | 622 | Open in IMG/M |
| 3300018469|Ga0190270_12759853 | Not Available | 554 | Open in IMG/M |
| 3300018481|Ga0190271_10562839 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1256 | Open in IMG/M |
| 3300018482|Ga0066669_12299946 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 514 | Open in IMG/M |
| 3300019888|Ga0193751_1215627 | Not Available | 628 | Open in IMG/M |
| 3300020022|Ga0193733_1045914 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales | 1233 | Open in IMG/M |
| 3300020082|Ga0206353_11784705 | Not Available | 688 | Open in IMG/M |
| 3300020150|Ga0187768_1045759 | Not Available | 969 | Open in IMG/M |
| 3300021073|Ga0210378_10212449 | Not Available | 737 | Open in IMG/M |
| 3300021080|Ga0210382_10541478 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 516 | Open in IMG/M |
| 3300021445|Ga0182009_10503805 | Not Available | 638 | Open in IMG/M |
| 3300021445|Ga0182009_10610413 | Not Available | 584 | Open in IMG/M |
| 3300022171|Ga0213857_1033112 | Not Available | 609 | Open in IMG/M |
| 3300022898|Ga0247745_1058172 | All Organisms → cellular organisms → Bacteria | 621 | Open in IMG/M |
| 3300025573|Ga0210133_1115946 | Not Available | 594 | Open in IMG/M |
| 3300025893|Ga0207682_10471309 | Not Available | 595 | Open in IMG/M |
| 3300025903|Ga0207680_10491900 | Not Available | 873 | Open in IMG/M |
| 3300025906|Ga0207699_10369328 | Not Available | 1016 | Open in IMG/M |
| 3300025907|Ga0207645_10693024 | Not Available | 692 | Open in IMG/M |
| 3300025915|Ga0207693_10078745 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2579 | Open in IMG/M |
| 3300025917|Ga0207660_11219833 | Not Available | 612 | Open in IMG/M |
| 3300025919|Ga0207657_10510546 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 941 | Open in IMG/M |
| 3300025919|Ga0207657_10748293 | Not Available | 757 | Open in IMG/M |
| 3300025919|Ga0207657_10894237 | Not Available | 684 | Open in IMG/M |
| 3300025924|Ga0207694_11113855 | Not Available | 668 | Open in IMG/M |
| 3300025928|Ga0207700_10010339 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 5882 | Open in IMG/M |
| 3300025930|Ga0207701_10907288 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 738 | Open in IMG/M |
| 3300025932|Ga0207690_11063732 | Not Available | 674 | Open in IMG/M |
| 3300025936|Ga0207670_10374568 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1133 | Open in IMG/M |
| 3300025937|Ga0207669_11337020 | Not Available | 609 | Open in IMG/M |
| 3300025941|Ga0207711_10918794 | Not Available | 813 | Open in IMG/M |
| 3300025941|Ga0207711_12157650 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 500 | Open in IMG/M |
| 3300025945|Ga0207679_10642478 | Not Available | 959 | Open in IMG/M |
| 3300025949|Ga0207667_10824727 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 923 | Open in IMG/M |
| 3300025960|Ga0207651_10709223 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 887 | Open in IMG/M |
| 3300025960|Ga0207651_11417745 | Not Available | 625 | Open in IMG/M |
| 3300025960|Ga0207651_11584825 | Not Available | 590 | Open in IMG/M |
| 3300025961|Ga0207712_10988569 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 746 | Open in IMG/M |
| 3300025972|Ga0207668_11736694 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
| 3300026015|Ga0208286_1016425 | Not Available | 585 | Open in IMG/M |
| 3300026041|Ga0207639_10666436 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 963 | Open in IMG/M |
| 3300026067|Ga0207678_10308958 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1359 | Open in IMG/M |
| 3300026067|Ga0207678_10932834 | Not Available | 768 | Open in IMG/M |
| 3300026067|Ga0207678_11033027 | Not Available | 728 | Open in IMG/M |
| 3300026067|Ga0207678_11738423 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 547 | Open in IMG/M |
| 3300026088|Ga0207641_12416117 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
| 3300026095|Ga0207676_11876333 | Not Available | 598 | Open in IMG/M |
| 3300026118|Ga0207675_100156132 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2174 | Open in IMG/M |
| 3300026121|Ga0207683_11497277 | All Organisms → cellular organisms → Bacteria | 623 | Open in IMG/M |
| 3300026142|Ga0207698_11747817 | Not Available | 637 | Open in IMG/M |
| 3300026322|Ga0209687_1167887 | Not Available | 696 | Open in IMG/M |
| 3300027795|Ga0209139_10247011 | Not Available | 630 | Open in IMG/M |
| 3300027885|Ga0209450_10482060 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 908 | Open in IMG/M |
| 3300027897|Ga0209254_10270086 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1317 | Open in IMG/M |
| 3300027897|Ga0209254_10839418 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 618 | Open in IMG/M |
| 3300027899|Ga0209668_10802024 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 634 | Open in IMG/M |
| 3300027975|Ga0209391_10157721 | Not Available | 966 | Open in IMG/M |
| 3300028379|Ga0268266_10982918 | Not Available | 817 | Open in IMG/M |
| 3300028380|Ga0268265_12230659 | Not Available | 554 | Open in IMG/M |
| 3300028592|Ga0247822_11578746 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 556 | Open in IMG/M |
| 3300028665|Ga0302160_10080019 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 698 | Open in IMG/M |
| 3300028739|Ga0302205_10029990 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1449 | Open in IMG/M |
| 3300028870|Ga0302254_10252112 | Not Available | 650 | Open in IMG/M |
| 3300029984|Ga0311332_10384590 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1087 | Open in IMG/M |
| 3300030010|Ga0302299_10256018 | Not Available | 921 | Open in IMG/M |
| 3300030050|Ga0302255_1120045 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 537 | Open in IMG/M |
| 3300030491|Ga0302211_10087987 | Not Available | 896 | Open in IMG/M |
| 3300031226|Ga0307497_10592091 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 560 | Open in IMG/M |
| 3300031474|Ga0170818_110402131 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 668 | Open in IMG/M |
| 3300031682|Ga0318560_10418112 | Not Available | 726 | Open in IMG/M |
| 3300031716|Ga0310813_11238964 | Not Available | 688 | Open in IMG/M |
| 3300031720|Ga0307469_11267717 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 699 | Open in IMG/M |
| 3300031722|Ga0311351_10677818 | Not Available | 785 | Open in IMG/M |
| 3300031792|Ga0318529_10327377 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 713 | Open in IMG/M |
| 3300031795|Ga0318557_10495803 | Not Available | 561 | Open in IMG/M |
| 3300031820|Ga0307473_10926854 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
| 3300031824|Ga0307413_11362853 | Not Available | 623 | Open in IMG/M |
| 3300031834|Ga0315290_11283955 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
| 3300031902|Ga0302322_100618985 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1276 | Open in IMG/M |
| 3300031902|Ga0302322_101476847 | Not Available | 829 | Open in IMG/M |
| 3300031903|Ga0307407_10091769 | Not Available | 1863 | Open in IMG/M |
| 3300031903|Ga0307407_11581806 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 520 | Open in IMG/M |
| 3300031911|Ga0307412_10381658 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1141 | Open in IMG/M |
| 3300031918|Ga0311367_10220144 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1984 | Open in IMG/M |
| 3300031940|Ga0310901_10375506 | Not Available | 614 | Open in IMG/M |
| 3300031954|Ga0306926_10482606 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1525 | Open in IMG/M |
| 3300031997|Ga0315278_12077100 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 529 | Open in IMG/M |
| 3300032012|Ga0310902_11291594 | Not Available | 516 | Open in IMG/M |
| 3300032039|Ga0318559_10024700 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2339 | Open in IMG/M |
| 3300032164|Ga0315283_11394301 | Not Available | 722 | Open in IMG/M |
| 3300032177|Ga0315276_10411354 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1449 | Open in IMG/M |
| 3300032180|Ga0307471_103723463 | Not Available | 539 | Open in IMG/M |
| 3300032205|Ga0307472_100220934 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1460 | Open in IMG/M |
| 3300032256|Ga0315271_11379053 | Not Available | 608 | Open in IMG/M |
| 3300032401|Ga0315275_11550531 | Not Available | 710 | Open in IMG/M |
| 3300032782|Ga0335082_11011407 | Not Available | 696 | Open in IMG/M |
| 3300032829|Ga0335070_11805306 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 553 | Open in IMG/M |
| 3300032954|Ga0335083_11368629 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
| 3300033290|Ga0318519_10014349 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 3374 | Open in IMG/M |
| 3300033408|Ga0316605_10971610 | Not Available | 814 | Open in IMG/M |
| 3300033412|Ga0310810_10751815 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 893 | Open in IMG/M |
| 3300033413|Ga0316603_11911428 | Not Available | 561 | Open in IMG/M |
| 3300033414|Ga0316619_11610307 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 585 | Open in IMG/M |
| 3300033416|Ga0316622_101897762 | Not Available | 693 | Open in IMG/M |
| 3300033418|Ga0316625_100967843 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 753 | Open in IMG/M |
| 3300033418|Ga0316625_101514581 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 635 | Open in IMG/M |
| 3300033433|Ga0326726_11862290 | Not Available | 586 | Open in IMG/M |
| 3300033480|Ga0316620_12613695 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 502 | Open in IMG/M |
| 3300033482|Ga0316627_102390897 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 555 | Open in IMG/M |
| 3300033521|Ga0316616_100166623 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2123 | Open in IMG/M |
| 3300033550|Ga0247829_10441442 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1073 | Open in IMG/M |
| 3300033557|Ga0316617_102639220 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 522 | Open in IMG/M |
| 3300034126|Ga0370486_007111 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2434 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 5.35% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 5.35% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.53% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 4.53% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 4.53% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 4.12% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 3.29% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.88% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.88% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.88% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 2.47% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 2.47% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.47% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.47% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 2.06% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.06% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.06% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.06% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.06% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.06% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 2.06% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 1.65% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 1.65% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 1.65% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.65% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.65% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.65% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.65% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.65% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.23% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.23% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.23% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.23% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.23% |
| Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 0.41% |
| Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 0.41% |
| Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 0.41% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.41% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.41% |
| Unplanted Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil | 0.41% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.41% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.41% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.41% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.41% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.41% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.41% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.41% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.41% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.41% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.41% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.41% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.41% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.41% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.41% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.41% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.41% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.41% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.82% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.82% |
| Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 0.82% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.82% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.82% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.82% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.82% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.82% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001431 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemly | Environmental | Open in IMG/M |
| 3300004012 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_ThreeSqC_D2 | Environmental | Open in IMG/M |
| 3300004079 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_TuleC_D2 | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005218 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqC_D2 | Environmental | Open in IMG/M |
| 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
| 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
| 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Environmental | Open in IMG/M |
| 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Environmental | Open in IMG/M |
| 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
| 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
| 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
| 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005825 | Microbial communities from Baker Bay sediment, Columbia River estuary, Washington - S.184_BBB | Environmental | Open in IMG/M |
| 3300005836 | Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBB | Environmental | Open in IMG/M |
| 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006057 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012 | Environmental | Open in IMG/M |
| 3300006224 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 4 metaG | Environmental | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
| 3300006577 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHPA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006604 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300006950 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost154B-one | Environmental | Open in IMG/M |
| 3300006953 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009075 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm March2015 | Environmental | Open in IMG/M |
| 3300009085 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
| 3300009091 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009167 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG - Illumina Assembly (version 2) | Environmental | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009179 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_0915_D1 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300011444 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT800_2 | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012519 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.7.yng.070610 | Environmental | Open in IMG/M |
| 3300012530 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ85 (21.06) | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Host-Associated | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
| 3300014317 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqB_D1 | Environmental | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015080 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G6C, Proglacial plain, adjacent to northern proglacial tributary) | Environmental | Open in IMG/M |
| 3300015357 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300015359 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300018032 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP10_20_MG | Environmental | Open in IMG/M |
| 3300018053 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1 | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018072 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2 | Environmental | Open in IMG/M |
| 3300018078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coex | Environmental | Open in IMG/M |
| 3300018083 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019888 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2 | Environmental | Open in IMG/M |
| 3300020022 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1s2 | Environmental | Open in IMG/M |
| 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020150 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_20_MG | Environmental | Open in IMG/M |
| 3300021073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redo | Environmental | Open in IMG/M |
| 3300021080 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redo | Environmental | Open in IMG/M |
| 3300021445 | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG | Environmental | Open in IMG/M |
| 3300022171 | Metatranscriptome of freshwater sediment microbial communities from pre-fracked creek in Pennsylvania, United States - G-2016_45 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022898 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S109-311C-5 | Environmental | Open in IMG/M |
| 3300025573 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_ThreeSqC_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
| 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026015 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_80N_401 (SPAdes) | Environmental | Open in IMG/M |
| 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 (SPAdes) | Environmental | Open in IMG/M |
| 3300027795 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027885 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - LWP11 LW (SPAdes) | Environmental | Open in IMG/M |
| 3300027897 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - DIP11 DI (SPAdes) | Environmental | Open in IMG/M |
| 3300027899 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL (SPAdes) | Environmental | Open in IMG/M |
| 3300027975 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm March2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028592 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30 | Environmental | Open in IMG/M |
| 3300028665 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E1_3 | Environmental | Open in IMG/M |
| 3300028739 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_E1_3 | Environmental | Open in IMG/M |
| 3300028870 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E1_4 | Environmental | Open in IMG/M |
| 3300029984 | I_Fen_E1 coassembly | Environmental | Open in IMG/M |
| 3300030010 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_N3_4 | Environmental | Open in IMG/M |
| 3300030050 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E2_4 | Environmental | Open in IMG/M |
| 3300030491 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_E3_3 | Environmental | Open in IMG/M |
| 3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031722 | II_Fen_N3 coassembly | Environmental | Open in IMG/M |
| 3300031792 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23 | Environmental | Open in IMG/M |
| 3300031795 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Host-Associated | Open in IMG/M |
| 3300031834 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_0 | Environmental | Open in IMG/M |
| 3300031902 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_2 | Environmental | Open in IMG/M |
| 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Host-Associated | Open in IMG/M |
| 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Host-Associated | Open in IMG/M |
| 3300031918 | III_Fen_N3 coassembly | Environmental | Open in IMG/M |
| 3300031940 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D2 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031997 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0 | Environmental | Open in IMG/M |
| 3300032012 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3 | Environmental | Open in IMG/M |
| 3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
| 3300032164 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_0 | Environmental | Open in IMG/M |
| 3300032177 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_0 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032256 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_top | Environmental | Open in IMG/M |
| 3300032401 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G03_0 | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| 3300033408 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day20_noCT | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| 3300033413 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day10_noCT | Environmental | Open in IMG/M |
| 3300033414 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D4_B | Environmental | Open in IMG/M |
| 3300033416 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_OW2_C1_D5_C | Environmental | Open in IMG/M |
| 3300033418 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D1_A | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| 3300033480 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D5_B | Environmental | Open in IMG/M |
| 3300033482 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D1_C | Environmental | Open in IMG/M |
| 3300033521 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D1_B | Environmental | Open in IMG/M |
| 3300033550 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4 | Environmental | Open in IMG/M |
| 3300033557 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D2_B | Environmental | Open in IMG/M |
| 3300034126 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_02D_16 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI10216J12902_1131710602 | 3300000956 | Soil | MKATLYEALGITPTSADEDVRAALRRLIRKYYAKTRDGQGNVEEALRF |
| F14TB_1004951452 | 3300001431 | Soil | MKATLYEALGITPTSADEDVRAALRRLIRKYYAKTRDGQGNVEEA |
| Ga0055464_101405782 | 3300004012 | Natural And Restored Wetlands | MRATLYQALGIPNDASHDEVRAALRGQIRKYYAKTRDGQGNVEE |
| Ga0055514_102086681 | 3300004079 | Natural And Restored Wetlands | MKATLYEALGILPTSSDEDVRAALRRLIRKYYAKTRDGQGNVEEALRFIN |
| Ga0062387_1003588683 | 3300004091 | Bog Forest Soil | LCFAAIAAMKATLYEALGIPQAASDEEVRAALRRLIRKYYAKT |
| Ga0063356_1049430221 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MRASLYEALGIPPTASDEEVRAALRRLIRKYYAKTRDGQGNVE |
| Ga0062591_1009805252 | 3300004643 | Soil | MKATLYQALGLSQDASEQEVRAALRWQIRKYYAKTRDGYGNVEEALRFINHASR |
| Ga0066678_105518111 | 3300005181 | Soil | MKATLYEALGVPQGAADEEVRAALRRLIRKYYAKTRDGQGNVEEALRFI |
| Ga0068996_101388101 | 3300005218 | Natural And Restored Wetlands | MNASLYEALGISPNASDEEVRASLRRLIRKYYAKTRDGQGNVEEALRFIN |
| Ga0070676_115475331 | 3300005328 | Miscanthus Rhizosphere | MKATLYDALGISPTSSDEDVRAALRGLIRKYYAKTRDGQGNV |
| Ga0070677_103325891 | 3300005333 | Miscanthus Rhizosphere | MKATLYEALGILPTSSDEEVRAALRRVIRKYYAKTRDGQGNVEEALRFINHASRI |
| Ga0070682_1001939653 | 3300005337 | Corn Rhizosphere | MKATLYEALGILPTSSDEEVRAALRRIIRKYYAKTRDGQGNV |
| Ga0070660_1009597022 | 3300005339 | Corn Rhizosphere | MKATLYEALGIQPTSSDEEVRAALRRVIRKYYAKTRDGQGNVEEALRFINHAS |
| Ga0070689_1008415351 | 3300005340 | Switchgrass Rhizosphere | LRAHWQMPATLYDALGVPPSASDSDVRAALRRQIRKYYATTRNGHGGVEEALRFINHASR |
| Ga0070687_1012630951 | 3300005343 | Switchgrass Rhizosphere | MRASLYEALGIPPTASDEEVRAALRRLIRKYYAKTRDGQG |
| Ga0070668_1013604682 | 3300005347 | Switchgrass Rhizosphere | MKATLYEALGILPTSSDEEVRAALRRIIRKYYAKTRDGQGNVEEALRFINHASRI |
| Ga0070668_1020848062 | 3300005347 | Switchgrass Rhizosphere | MKATLYDALGISPTSSDEDVRAALRGLIRKYYAKTRDGQG |
| Ga0070669_1003300391 | 3300005353 | Switchgrass Rhizosphere | MKATLYEALGILPTSSDEEVRAALRRIIRKYYAKTRDGQGNVEEALRFINH |
| Ga0070671_1020817491 | 3300005355 | Switchgrass Rhizosphere | MKATLYDALGISPTSSDEDVRAALRGLIRKYYAKTRDGQGNVEEA |
| Ga0070673_1014776431 | 3300005364 | Switchgrass Rhizosphere | MKATLYEALGILPTSSEEDVRAALRRLIRKYYAGTRDGQGNVEEALRFI |
| Ga0070688_1000252197 | 3300005365 | Switchgrass Rhizosphere | MKATLYDALGISPTSSDEDVRAALRGLIRKYYAKTRDGQGNVEEAL |
| Ga0070667_1015392352 | 3300005367 | Switchgrass Rhizosphere | MKATLYEALGILPTSSDEEVRAALRRVIRKYYAKTRDGQGNVE |
| Ga0070711_1019088211 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MKATLYDALGILPTSSDEEVRAALRGLIRKYYAKTRDGQGNVEEAL |
| Ga0070678_1014075751 | 3300005456 | Miscanthus Rhizosphere | MRATLYEALGISQNASHDEVRSALRGQIRKYYGKTRDGQGNVEEALRFINHASR |
| Ga0070681_111407582 | 3300005458 | Corn Rhizosphere | MKATLYDALGISPTSSDEEVRAALRGLIRKYYAKTRDGQGNVEEALRFIN |
| Ga0068867_1009310681 | 3300005459 | Miscanthus Rhizosphere | MKATLYEALGILPTSSDEEVRAALRRVIRKYYAKTRDGQGNVEEA |
| Ga0070706_1004934313 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MKATLYEALGIPQAASDEEVRAALRRLIRKYYAKTRDGQGNVEE |
| Ga0070706_1012995571 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MRATLYEALGIPQAASDEEVRAALRRLIRKYYAKTRDGQGNVEEALRFI |
| Ga0070679_1002121121 | 3300005530 | Corn Rhizosphere | MKSTLYDALGIVPTSSDEEVRAALRALIRKYYTKTRDGQGN |
| Ga0070679_1017341462 | 3300005530 | Corn Rhizosphere | MKATLYEALGILPTSSDEEVRAALRRIIRKYYAKTRDGQGNVEEALR |
| Ga0070684_1006109561 | 3300005535 | Corn Rhizosphere | MKATLYDALGILPTSTDEEVRAALRGLIRKYYAKTRDGQGN |
| Ga0068853_1008178192 | 3300005539 | Corn Rhizosphere | MKATLYEALGILPTSSDEEVRAALRRIIRKYYAKTRDGQGNVEEALRFI |
| Ga0070665_1007522702 | 3300005548 | Switchgrass Rhizosphere | MRASLYEALGIAPSASEEEVQAALRRLIRKYYAKTRD |
| Ga0070704_1004891581 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | MKATLYEALGIPQAASDEEVRAALRRLIRKYYAKTRDGQGNVEEA |
| Ga0066695_104175982 | 3300005553 | Soil | MRATLYEALGIPQAASDEEVRASLRRVIRKYYAKTRDGQG |
| Ga0068855_1013296431 | 3300005563 | Corn Rhizosphere | MKATLYDALGILPTSSEEEVRAALRGLIRKYYAKTRD |
| Ga0068854_1011484791 | 3300005578 | Corn Rhizosphere | MKATLYEALGITPTSADEDVRAALRRLIRKYYAKT |
| Ga0066691_106279031 | 3300005586 | Soil | MKATLYEALGIPQAASDEEVRAALRRLIRKYYAKTR |
| Ga0068859_1019203861 | 3300005617 | Switchgrass Rhizosphere | MKATLYDALGVQAAASDEEVRAALRRLIRKYYAKTRDGQGNVEEALRFIN |
| Ga0068859_1020746021 | 3300005617 | Switchgrass Rhizosphere | MKATLYDALGISPTSSDEEVRAALRGLIRKYYAKTRDGQGNVEEALRFI |
| Ga0068861_1007102313 | 3300005719 | Switchgrass Rhizosphere | MKATLYEALGISPTSSDEDVRAALRRLIRKYYAKTRDGQGNVEEA |
| Ga0074476_12762552 | 3300005825 | Sediment (Intertidal) | MKASLYEALGIPPTASDEDVRAALRRLIRKYYAKTRDGQGNV |
| Ga0074470_117548971 | 3300005836 | Sediment (Intertidal) | MRASLYEALGIAPTSSDEEVRAALRRLIRKYYAKTRDGQ |
| Ga0068870_109818141 | 3300005840 | Miscanthus Rhizosphere | MKATLYEALGIQPGSSDEHVRTALRRLIRKYYTKTRDGHGNVEEALRFIN |
| Ga0068863_1026157641 | 3300005841 | Switchgrass Rhizosphere | MKATLYEALGIQPTSSDEEVRAALRRVIRKYYAKTRDGQGNVEEA |
| Ga0068863_1027491422 | 3300005841 | Switchgrass Rhizosphere | MKATLYDALGISPTSSDEDVRAALRGLIRKYYAKTRDGQGN |
| Ga0068860_1015310461 | 3300005843 | Switchgrass Rhizosphere | MKATLYEALGILPTSSDEDVRAALRRLIRKYYAKTRDGQGNVEEA |
| Ga0068862_1003745013 | 3300005844 | Switchgrass Rhizosphere | MKATLYDALGISPTSSDEDVRAALRGLIRKYYAKTRDGQGNVE |
| Ga0066696_102404311 | 3300006032 | Soil | MKSTLYEALGVQASSSDEEVRAALRRLIRKYYAKTRDGQGNVEEALRFINHA |
| Ga0075026_1004155692 | 3300006057 | Watersheds | MKASLYEAVGISPTASDEEVRASLRRLIRKYYAKTRDGQGNVEEALRFINHASRI |
| Ga0079037_1026359811 | 3300006224 | Freshwater Wetlands | MRATLYEALGLPKEASEAEVRAALRGQIRKYYAKTRDGQGNVEEALRFINH |
| Ga0097621_1013119802 | 3300006237 | Miscanthus Rhizosphere | MRASLYEALGIPPTASDEEVRAALRRLIRKYYAKTRDGQGNVEEALRFI |
| Ga0075021_105044812 | 3300006354 | Watersheds | MKATLYEALGVPPVASDEEVRAALRRLIRKYYAKTRDGQGNVEEALRFINH |
| Ga0074050_118196991 | 3300006577 | Soil | MRASLYEALGIPPTASDEEVRAALRRLIRKYYAKTRDGQGNVEEALRFIN |
| Ga0074060_114158922 | 3300006604 | Soil | MKATLYEALGILPTSSDEDVRASLRRLIRKYYAKTRDGQGNVEEALRFI |
| Ga0066658_104645751 | 3300006794 | Soil | MKATLYEALGIPQLVSDEDVRAALRRLIRKYYAKTRDGQ |
| Ga0075428_1001370585 | 3300006844 | Populus Rhizosphere | MRASLYEALGIPPTASDEDVRAALRRLIRKYYAKTRDGQGN |
| Ga0075428_1009497202 | 3300006844 | Populus Rhizosphere | MKATLYEALGITPTSADEDVRAALRRLIRKYYAKTRDGQGNVEEAL |
| Ga0075428_1020729562 | 3300006844 | Populus Rhizosphere | MKATLYEALGIQPGSSDEEVRAALRRLIRKYYAKTRDGQG |
| Ga0075425_1012130171 | 3300006854 | Populus Rhizosphere | MKATLYEALGITPTSADEDVRAALRRLIRKYYAKTRDGQGNVE |
| Ga0075434_1011976212 | 3300006871 | Populus Rhizosphere | MKATLYEALGIQPASSDEEVRAALRRLIRKYYAKT |
| Ga0075434_1017499031 | 3300006871 | Populus Rhizosphere | MKATLYDALGVPRHASQDEVRAALRAQIRKYYANTRDGHG |
| Ga0068865_1008753862 | 3300006881 | Miscanthus Rhizosphere | MKATLYEALGILPTSSEEDVRAALRRLIRKYYAGTR |
| Ga0075524_101350423 | 3300006950 | Arctic Peat Soil | MRATLYEALGIAQNASTHDVRAALRGQIRKYYGKTRDG |
| Ga0074063_140909141 | 3300006953 | Soil | MKATLYEALGIPPAASDEEVRAALRRLIRKYYAKTRDGQGNVEEALRFI |
| Ga0079218_122876112 | 3300007004 | Agricultural Soil | MKATLYEALGIPPAASDEEVRASLRRLIRKYYAKTRDGQGNVEEALRFI |
| Ga0099795_104392282 | 3300007788 | Vadose Zone Soil | MKATLYEALGILPTSSDEDVRASLRRLIRKYYAKTRDGQGNVEEALRFIN |
| Ga0099795_106314752 | 3300007788 | Vadose Zone Soil | MKATLYEALGILPTSSDEDVRAALRRIIRKYYAKTRDG |
| Ga0105090_100509011 | 3300009075 | Freshwater Sediment | MKATLYEALGISPTASDEDVRASLRRLIRKYYTKTRD |
| Ga0105090_106232981 | 3300009075 | Freshwater Sediment | MKATLYEALGISPTASDEDVRASLRRLIRKYYTKTRDGHG |
| Ga0105103_1000236611 | 3300009085 | Freshwater Sediment | MKATLYEALGISPTASDEDVRASLRRLIRKYYTKTRDGHGNVEEALRFINHAS |
| Ga0102851_102706803 | 3300009091 | Freshwater Wetlands | MKTTLYEALGLAPNASDEDVRAALRRLIRKYYAKTRDGHGNVEEALRF |
| Ga0099792_107823332 | 3300009143 | Vadose Zone Soil | MKATLYEALGIKQLASEEEVRAALRRLIRKYYAKTRDGQGN |
| Ga0111538_124259062 | 3300009156 | Populus Rhizosphere | MRASLYEALGIPPTASDEEVRAALRRLIRKYYAKTRDG |
| Ga0113563_109336311 | 3300009167 | Freshwater Wetlands | MKATLYEALGIPPAASDEEVRAALRRLIRKYYAKTRDGHGNVEEA |
| Ga0113563_114805752 | 3300009167 | Freshwater Wetlands | MRASLYEALGIAPTASDEEVRAALRRLIRKYYAKTRDG |
| Ga0113563_119361101 | 3300009167 | Freshwater Wetlands | MKATLYEALGISPTASDEDVRASLRRLIRKYYTKTRDGHGNVEEALRF |
| Ga0105241_118514422 | 3300009174 | Corn Rhizosphere | MKATLYEALGITPTSADEDVRAALRRLIRKYYAKTRDGQGNVEEALRFIN |
| Ga0115028_119895811 | 3300009179 | Wetland | MKATLYEALGISPTASDEDVRASLRRLIRKYYTKTRDGHGNVEEALRFIN |
| Ga0126380_102735671 | 3300010043 | Tropical Forest Soil | MKATLYEALGIPPAAPDEEVRAALRRLIRKYYAKTRDGQGNVEEAL |
| Ga0126380_107391222 | 3300010043 | Tropical Forest Soil | MKATLYEALGILPTSSDEEVRAALRRLIRKYYAKTRDGQGNVEEALRFIN |
| Ga0134088_101826253 | 3300010304 | Grasslands Soil | LQFAAVAAMKATLYEALGIPQAASDEEVRAALRRLIRKYYAKTRD |
| Ga0134111_103930611 | 3300010329 | Grasslands Soil | MRASLYEALGIPPTASEEEVRAALRRLIRKYYAKTRDGQGNVE |
| Ga0126383_130991302 | 3300010398 | Tropical Forest Soil | MKATLYEALGIAPAASDEEVRAALRRLIRKYYAKTRDGQGNVEEALR |
| Ga0134127_107744541 | 3300010399 | Terrestrial Soil | MKATLYDALGILPTSSDEEVRAALRGLIRKYYAKTRDGQGNVEEALRFINHASRIL |
| Ga0134127_123353482 | 3300010399 | Terrestrial Soil | MKATLYEALGITPTSADEDVRAALRRLIRKYYAKTRDGQGN |
| Ga0134122_100725565 | 3300010400 | Terrestrial Soil | MKATLYEALGVPQLAPDEEVRAALRRLIRKYYAKT |
| Ga0105246_101484784 | 3300011119 | Miscanthus Rhizosphere | MKATLYDALGISPTSSDEDVRAALRGLIRKYYAKTRDGQGNVEEALRFINHA |
| Ga0137463_12474201 | 3300011444 | Soil | MFRPEKSMRATLYQALSIPKEASDDEVRAALRGQIRKYYAKT |
| Ga0137380_106499861 | 3300012206 | Vadose Zone Soil | LHFAAVAAMKATLYEALGIPQAASDEEVRAALRRLIRKY |
| Ga0137379_106768053 | 3300012209 | Vadose Zone Soil | LQFAAVAAMKATLYEALGIPQAASDEEVRAALRRLIRKYYAKTRDGQGNVE |
| Ga0137370_110216652 | 3300012285 | Vadose Zone Soil | MKASLYEALAIPQGATDEEVRAALRRLIRKYYAKTRDGQGNVEEALRFINHAS |
| Ga0137384_113708451 | 3300012357 | Vadose Zone Soil | MRATLYEALGIPQAASDEEVQAALRRLIRTYYGRTRAGQGNVEEA |
| Ga0137360_110966232 | 3300012361 | Vadose Zone Soil | MRATLYEALGIPMEASDAAVRAALRGQIRKYYAKTRDGHGNVEEALRFINHASRI |
| Ga0150984_1190922711 | 3300012469 | Avena Fatua Rhizosphere | MKSTLYDALGISPSSSDEEVRAALRGLIRKYYAKTRDGQGNVEEALRFIN |
| Ga0157352_10828931 | 3300012519 | Unplanted Soil | MRATLYEALGIPQDASDEEVRAALRRLIRKYYAKTRDGQGN |
| Ga0136635_102787491 | 3300012530 | Polar Desert Sand | MKSTLYEALGILPSSSDEDLRAALRRLIRKYYAKTRDGQGNVEEALRF |
| Ga0164299_103617022 | 3300012958 | Soil | MKATLYDALGISPTSSDEEVRAALRGLIRKYYAKTRDGQGNV |
| Ga0164302_111193412 | 3300012961 | Soil | MKATLYEALGILPTSSDEVVRAALRRVIRKYYAKTRDGQGNVEEALRFINH |
| Ga0126369_119145662 | 3300012971 | Tropical Forest Soil | MRATLYEALGIPPAAPDEEVRAALRRLIRKYYAKTRDG |
| Ga0126369_133076792 | 3300012971 | Tropical Forest Soil | MRATLYEALGIPQAASDEEVRAALRRLIRKYYAKTRDGQGNV |
| Ga0164307_107604232 | 3300012987 | Soil | MKSTLYDALGILPTSTDEEVRAALRGLIRKYYAKTRDGQGNVEEALRFIN |
| Ga0157373_110412451 | 3300013100 | Corn Rhizosphere | MKATLYEALGIQPTSSDEEVRAALRRVIRKYYAKTRDGQGNVEEALRFINHASRI |
| Ga0157373_114805612 | 3300013100 | Corn Rhizosphere | MKATLYEALGVPQLAPDEEVRAALRRLIRKYYAKTRDGQGNVEEALRF |
| Ga0157370_100306168 | 3300013104 | Corn Rhizosphere | MKATLYEALGIPQAALDEEVRASLRRLIRKYYAKTRDGQGNVEEALRFI |
| Ga0157378_109034813 | 3300013297 | Miscanthus Rhizosphere | MPATLYDALGVPPSASDSDVRAALRRQIRKYYAKTRDGHGGVEEALRFINHA |
| Ga0163162_113765972 | 3300013306 | Switchgrass Rhizosphere | MKATLYDALGISPTSSDEDVRAALRGLIRKYYAKTRDGQGNVEE |
| Ga0157375_119759832 | 3300013308 | Miscanthus Rhizosphere | MKATLYEALGVQPGSSDEEIRAALRRLIRKYYAKTRDGQGNVEEAL |
| Ga0157375_132754841 | 3300013308 | Miscanthus Rhizosphere | MKATLYDALGISPTSSDEDVRAALRGLIRKYYAKTRDGQGNVEEALRFI |
| Ga0134079_102608711 | 3300014166 | Grasslands Soil | MKSTLYEALGVQASSSDEEVRAALRRLIRKYYAKTRDGQGNVEEALR |
| Ga0075343_11716602 | 3300014317 | Natural And Restored Wetlands | MMRATLYEALGISQSASDEDVRAALRRQIRKYYTRTRDGHGNVEEALRFINHAS |
| Ga0157380_133550841 | 3300014326 | Switchgrass Rhizosphere | MKATLYEALGITPTSADEDVRAALRRLIRKYYAKTRDGQGNV |
| Ga0157379_120150812 | 3300014968 | Switchgrass Rhizosphere | MPATLYDALGVPPSASDSDVRAALRRQIRKYYATTRNGHGG |
| Ga0157379_123457541 | 3300014968 | Switchgrass Rhizosphere | MRASLYEALGIPPTASDEEVRAALRRLIRKYYAKTRDGQGNVEEALR |
| Ga0157376_107320203 | 3300014969 | Miscanthus Rhizosphere | MKTTLYEALGIAPSASEEEVRAALRGHIRKYYTKTRDGRGNVEE |
| Ga0157376_115168742 | 3300014969 | Miscanthus Rhizosphere | MKATLYEALGIQPTSSDEEVRAALRRVIRKYYAKTRNGQGNVEEALRF |
| Ga0157376_123869902 | 3300014969 | Miscanthus Rhizosphere | MPATLYDALGVPPSASDTDVRAALRRQIRKYYAKTRDG |
| Ga0167639_10079853 | 3300015080 | Glacier Forefield Soil | MKATLYEALGIKQLASEEEVRAALRRLIRKYYAKTRDG |
| Ga0134072_104289691 | 3300015357 | Grasslands Soil | MKATLYEALGIPQLASDEDVRAALRRLIRKYYAKTRDGQG |
| Ga0134085_103495781 | 3300015359 | Grasslands Soil | LQFAAVAAMKATLYEALGIPQAASDEEVRAALRRLIRKY |
| Ga0182034_113857561 | 3300016371 | Soil | MKATLYEALGINAAAPDEEVRAALRRLIRKYYAKTRDGQG |
| Ga0187776_114466391 | 3300017966 | Tropical Peatland | MKATLYEALGIPPAAAEEEVRAALRRLIRKYYAKTRDGQ |
| Ga0187777_104757822 | 3300017974 | Tropical Peatland | MRASLYEALGIAPAASDEEVRAALRRLIRKYYAKTRDGQGNVEEALRFIN |
| Ga0187788_103192812 | 3300018032 | Tropical Peatland | MKATLYEALGIAPAASDEDVRAALRRLIRKYYAKTRDGQGNV |
| Ga0184626_104229541 | 3300018053 | Groundwater Sediment | MKATLYEALGIPQAASDEEVRAALRRLIRKYYAKTRD |
| Ga0187765_106801241 | 3300018060 | Tropical Peatland | MRATLYEALGIPQAASDEEVRAALRRLIRKYYAKTRDG |
| Ga0184635_101712272 | 3300018072 | Groundwater Sediment | MRASLYEALGIAPPASDEEVRAALRRLIRKYYAKTRDGQGNV |
| Ga0184612_100315771 | 3300018078 | Groundwater Sediment | MKATLYEALGILPTSSDEDVRASLRRLIRKYYAKTRDGQGNVEEA |
| Ga0184628_102260641 | 3300018083 | Groundwater Sediment | MKATLYEALGILPTSSDEDVRASLRRLIRKYYAKT |
| Ga0066667_119552532 | 3300018433 | Grasslands Soil | MKATLYEALGISQTASDDEVRAALRRLIRKYYAKT |
| Ga0190270_121178042 | 3300018469 | Soil | MKATLYEALGIQPGSSDEEVRAALRRLIRKYYAKTRDGQGNVEEA |
| Ga0190270_127598532 | 3300018469 | Soil | MKATLYEALGILPTSSDEDVRASLRRLVRKYYAKTR |
| Ga0190271_105628393 | 3300018481 | Soil | MKATLYEALGILPTSSDEDVRASLRRLIRKYYAKTRDGQGNVEEALRFINHASR |
| Ga0066669_122999462 | 3300018482 | Grasslands Soil | MKATLYEALGIPQAASDEEVRAALRRLIRKYYAKTRDGQGNVEEALRFIN |
| Ga0193751_12156271 | 3300019888 | Soil | MKATLYEALGIPQLASDEEVRAALRRLIRKYYAKTRDGQ |
| Ga0193733_10459143 | 3300020022 | Soil | MKATLYEALGILPLASDEEVRAALRRLIRKYYAKTRDG |
| Ga0206353_117847051 | 3300020082 | Corn, Switchgrass And Miscanthus Rhizosphere | MKATLYEALAISPTSSDEEVRAALRRVIRKYYAKTRDGQGNVEEALRSINHASRI |
| Ga0187768_10457591 | 3300020150 | Tropical Peatland | MKATLYEALGIPQVASDQEVRAALRRLIRKYYAKTRDGQGNVEEA |
| Ga0210378_102124491 | 3300021073 | Groundwater Sediment | MKATLYEALGIPQAASDEEVRAALRRLIRKYYAKTRDGQGNVEEALR |
| Ga0210382_105414781 | 3300021080 | Groundwater Sediment | MKATLYEALGIPQAASDEEVRAALRRLIRKYYAKTRDGQGNVEEALRFINH |
| Ga0182009_105038052 | 3300021445 | Soil | MKSTLYDALGISPSSSDEEVRAALRGLIRKYYAKTRD |
| Ga0182009_106104131 | 3300021445 | Soil | MKATLYDALGISPTSSDEEVRAALRGLIRKYYAKTRDGQGN |
| Ga0213857_10331121 | 3300022171 | Watersheds | MRASLYEALGIPPTASEEEVRTALRRLIRKYYAKTRDG |
| Ga0247745_10581722 | 3300022898 | Soil | MKATLYEALGVPQLAPDEEVRAALRRLIRKYYAKTRD |
| Ga0210133_11159461 | 3300025573 | Natural And Restored Wetlands | MRATLYQALGIPNDASHDEVRAALRGQIRKYYAKTRDGQGNVEEALRFI |
| Ga0207682_104713091 | 3300025893 | Miscanthus Rhizosphere | MKATLYEALGILPTSSDEEVRAALRRVIRKYYAKTRDGQGNVEEALRFI |
| Ga0207680_104919001 | 3300025903 | Switchgrass Rhizosphere | MKATLYEALGVPQLAPDEEVRAALRRLIRKYYAKTRDGQGN |
| Ga0207699_103693281 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MKATLYEALGVPQLAPDEEVRAALRRLIRKYYAKTRDGQGNV |
| Ga0207645_106930241 | 3300025907 | Miscanthus Rhizosphere | MRASLYEALGIAPTASDEEVRAALRRLIRKYYAKTRDGQGNVEEALR |
| Ga0207693_100787455 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MKATLYEALGVPQLAPDEEVRAALRRLIRKYYAKTRDGQGNVEEALRFINHAS |
| Ga0207660_112198332 | 3300025917 | Corn Rhizosphere | MKATLYDALGISPTSSDEEVRAALRGLIRKYYAKTRDGQGNVEEALR |
| Ga0207657_105105461 | 3300025919 | Corn Rhizosphere | MKATLYDALGILPTSSDEEVRAALRGLIRKYYAKTRDGQGNVE |
| Ga0207657_107482931 | 3300025919 | Corn Rhizosphere | MKATLYEALGIPQAASDEEVRASLRRLIRKYYAKTRDGQ |
| Ga0207657_108942371 | 3300025919 | Corn Rhizosphere | MKATLYEALGIQPTSSDEEVRAALRRVIRKYYAKTRDGQG |
| Ga0207694_111138552 | 3300025924 | Corn Rhizosphere | MKATLYEALGVPQLAPDEEVRAALRRLIRKYYAKTRDGQGNVEEALRFIN |
| Ga0207700_100103391 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MKATLYEALGVPQLAPDEEVRAALRRLIRKYYAKTRDG |
| Ga0207701_109072881 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | MKATLYDALGISPTSSDEEVRAALRGLIRKYYAKT |
| Ga0207690_110637322 | 3300025932 | Corn Rhizosphere | MKATLYEALGITPTSADEDVRAALRRLIRKYYAKTRDGQGNVEEALR |
| Ga0207670_103745681 | 3300025936 | Switchgrass Rhizosphere | MRATLYEALGISPTASDEEVRAALRRLIRKYYAKTR |
| Ga0207669_113370201 | 3300025937 | Miscanthus Rhizosphere | MKATLYEALGILPTTSDEDVRAALRRLIRKYYAKTRDGQGNVEEAL |
| Ga0207711_109187942 | 3300025941 | Switchgrass Rhizosphere | MKATLYDALGVQPGASGEEVRAALRRLIRKYYAKTRDGQ |
| Ga0207711_121576501 | 3300025941 | Switchgrass Rhizosphere | MRASLYEALGIPPTASEEDVRAALRRLIRKYYAKTRDGQGNVEEAL |
| Ga0207679_106424783 | 3300025945 | Corn Rhizosphere | MKATLYEALAISPTSSDEEVRAALRRVIRKYYAKTRD |
| Ga0207667_108247272 | 3300025949 | Corn Rhizosphere | MKATLYDALGILPTSSEEEVRAALRGLIRKYYAKTRDGQGNVEEALRFINH |
| Ga0207651_107092233 | 3300025960 | Switchgrass Rhizosphere | MPATLYDALGVPPSASDSDVRAALRRQIRKYYATT |
| Ga0207651_114177451 | 3300025960 | Switchgrass Rhizosphere | MKATLYEALGILPTSSEEDVRAALRRLIRKYYAGTRDGQGNVEEALR |
| Ga0207651_115848252 | 3300025960 | Switchgrass Rhizosphere | MKATLYEALGILPTSSDEDVRASLRRLIRKYYAKTRDGQGN |
| Ga0207712_109885692 | 3300025961 | Switchgrass Rhizosphere | MPATLYDALGVPPSASDSDVRAALRRQIRKYYAKTRDGHGGVEEALRFINHAS |
| Ga0207668_117366941 | 3300025972 | Switchgrass Rhizosphere | MKATLYEALGISQTASDEEVRASLRRLIRKYYAKTRDGQGNVEEALRF |
| Ga0208286_10164252 | 3300026015 | Rice Paddy Soil | MKATLYDALGIVPTCSDEEVRAALRGLIRKYYAKTR |
| Ga0207639_106664363 | 3300026041 | Corn Rhizosphere | MKATLYDALGISPASSDEEVRAALRGLIRKYYAKT |
| Ga0207678_103089581 | 3300026067 | Corn Rhizosphere | MKATLYEALGVPQLAPDEEVRAALRRLIRKYYAKTR |
| Ga0207678_109328341 | 3300026067 | Corn Rhizosphere | MKATLYEALGIPQAASDEEVRASLRRLIRKYYAKTRDGQGN |
| Ga0207678_110330272 | 3300026067 | Corn Rhizosphere | MKATLYEALAISPTSSDEEVRAALRRVIRKYYAKTRDGQGNVEEAL |
| Ga0207678_117384231 | 3300026067 | Corn Rhizosphere | MKATLYDALGISPTSSDEEVRAALRGLIRKYYAKTRDGQGNVEEALRFINH |
| Ga0207641_124161172 | 3300026088 | Switchgrass Rhizosphere | MPATLYDALGVPPSASDSDVRAALRRQIRKYYAKTRDGHGGV |
| Ga0207676_118763331 | 3300026095 | Switchgrass Rhizosphere | MKATLYEALGITQAASDQDVRSALRGLIRKYYAKTRDGQGNLEEALRFINHASRI |
| Ga0207675_1001561321 | 3300026118 | Switchgrass Rhizosphere | MKATLYEALGIPQAASDEEVRASLRRLIRKYYAKTRDGQGNVEEALRF |
| Ga0207683_114972772 | 3300026121 | Miscanthus Rhizosphere | MRASLYEALGIPPTASDEEVRAALRRLIRKYYAKTRDGQGNVEEALRF |
| Ga0207698_117478171 | 3300026142 | Corn Rhizosphere | MKATLYEALGILPTSSDEEVRAALRRIIRKYYAKTRDGQGNVEEALRFINHAS |
| Ga0209687_11678872 | 3300026322 | Soil | MKSTLYEALGIQPSSSDEEVRAALRRLIRKYYAKTRDGQGNVEE |
| Ga0209139_102470112 | 3300027795 | Bog Forest Soil | MKATLYEALGIPQAASDEEVRAALRRLIRKYYAKT |
| Ga0209450_104820601 | 3300027885 | Freshwater Lake Sediment | MKATLYEALGVAQSASNDEVHDALRRVIRKYYAKTRDGHGNVEEALRFINH |
| Ga0209254_102700861 | 3300027897 | Freshwater Lake Sediment | MRASLYEALGIAPTASDEEVRAALRRLIRKYYAKTRDGQGNVEE |
| Ga0209254_108394182 | 3300027897 | Freshwater Lake Sediment | MKATLYEALGILPTTSDEDVRAALRRLIRKYYAKTRDGQGNVEEA |
| Ga0209668_108020241 | 3300027899 | Freshwater Lake Sediment | MKATLYEALGILPTTSDEDVRAALRRLIRKYYAKTRDGQGNVEEALRFINH |
| Ga0209391_101577211 | 3300027975 | Freshwater Sediment | MKATLYEALGISPTASDEDVRASLRRLIRKYYTKTRDGHGNVEEALRFI |
| Ga0268266_109829181 | 3300028379 | Switchgrass Rhizosphere | MKATLYEALGILPTTSDEDVRAALRRLIRKYYAKTRDGQGNVEEALRFINHASR |
| Ga0268265_122306591 | 3300028380 | Switchgrass Rhizosphere | MKSTLYDALGISPSSSDEEVRAALRGLIRKYYAKTRDGLGNVE |
| Ga0247822_115787461 | 3300028592 | Soil | MKATLYDALGISPTSSDEDVRAALRGLIRKYYAKTRDGQGNVEEALRFINHASR |
| Ga0302160_100800192 | 3300028665 | Fen | MKATLYEALGILPTSSDEDVRASLRGLIRKYYAKTRD |
| Ga0302205_100299901 | 3300028739 | Fen | MKATLYEALGILPTSSDEDVRASLRRLIRKYYAKTRD |
| Ga0302254_102521122 | 3300028870 | Fen | MKATLYEALGVPPVASDEEVRAALRRLIRKYYAKT |
| Ga0311332_103845901 | 3300029984 | Fen | MKATLYEALGILPTSSDEDVRASLRRLIRKYYAKTRDGQG |
| Ga0302299_102560181 | 3300030010 | Fen | MRATLYDALGIPPAASDQEVRAALRGQIRKYYAKTRDGHGNVEEALRFINHA |
| Ga0302255_11200451 | 3300030050 | Fen | MKATLYEALGILPTSSDEDVRASLRRLIRKYYAKTRDGQGNVEEALRFINHASRIL |
| Ga0302211_100879871 | 3300030491 | Fen | MKATLYEALGILPTSSDEDVRASLRRLIRKYYAKTRDGQGNVEEALRFINHA |
| Ga0307497_105920911 | 3300031226 | Soil | MKATLYEGLGVPQLAPDEEVRAALRRLIRKYYAKTRDGQGNVEEALRFIN |
| Ga0170818_1104021311 | 3300031474 | Forest Soil | MKATLYEALGIPQAASDEEVRASLRRLIRKYYAKTRDGQGNVE |
| Ga0318560_104181122 | 3300031682 | Soil | MKATLYDALGIQPGSSDEEVRAALRRLIRKYYAKTRDGQGN |
| Ga0310813_112389641 | 3300031716 | Soil | MKSTLYDALGIVPTSSDEEVRAALRARIRTYYAKTRDGQ |
| Ga0307469_112677172 | 3300031720 | Hardwood Forest Soil | MKSTLYEALGIQAGSSDEEVRAALRRLIRKYYAKTRDGQGN |
| Ga0311351_106778183 | 3300031722 | Fen | MKATLYEALGILPTSSDEDVRASLRRLIRKYYAKTRDGQGNVEEALRF |
| Ga0318529_103273772 | 3300031792 | Soil | MRASLYEALGIAPTASDEEVRAALRRLIRKYYAKT |
| Ga0318557_104958032 | 3300031795 | Soil | MKATLYDALGIQPGSSDEEVRAALRRLIRKYYAKTRD |
| Ga0307473_109268542 | 3300031820 | Hardwood Forest Soil | MRASLYEALGIAPTASDEDVRAALRRLIRKYYAKTRDGQGNVEEALRFINH |
| Ga0307413_113628531 | 3300031824 | Rhizosphere | MKATLYEALGILPTTSDEDVRAALRRLIRKYYAKTRDGQGNVEEALRFINHA |
| Ga0315290_112839552 | 3300031834 | Sediment | MKATLYDALGIPPAASDDEVRSALRRQIRKYYAKTRDGHGNVEE |
| Ga0302322_1006189853 | 3300031902 | Fen | MKATLYEALGILPTSSDEDVRASLRGLIRKYYAKTRDG |
| Ga0302322_1014768472 | 3300031902 | Fen | MKATLYEALGVLPTSTDVDVRASLRRLIRKYYAKTRDGQGNVEEALRFINHASRI |
| Ga0307407_100917691 | 3300031903 | Rhizosphere | MKATLYEALGIPPAASDEEVRASLRRLIRKYYAKTRDGQGN |
| Ga0307407_115818061 | 3300031903 | Rhizosphere | MKATLYEALGILPTTSDEDVRAALRRLIRKYYAKTRDGQ |
| Ga0307412_103816581 | 3300031911 | Rhizosphere | MKATLYEALGILPTTSDEDVRAALRRLIRKYYAKTRDGQG |
| Ga0311367_102201441 | 3300031918 | Fen | MKATLYEALGILPTSSEEDVRAALRRLIRKYYAKTR |
| Ga0310901_103755062 | 3300031940 | Soil | MKATLYEALGIQPGSSDEEVRAALRRLIRKYYAKTRDGQGNVEEALRF |
| Ga0306926_104826063 | 3300031954 | Soil | MKATLYEALGVPQVASDQEVRAALRRLIRKYYAKTRDGQGNVEEALRFINH |
| Ga0315278_120771001 | 3300031997 | Sediment | MKATLYEALGILPTSSDEDVRASLRRLIRKYYAKTRDGQGNVEEALRFINHAS |
| Ga0310902_112915942 | 3300032012 | Soil | MKATLYDALGISPTSSDEDVRAALRGLIRKYYAKTRD |
| Ga0318559_100247004 | 3300032039 | Soil | MKATLYEALGILPTSSDEEVRAALRRLIRKYYAKTRDGQGNVEEALRFINHASR |
| Ga0315283_113943012 | 3300032164 | Sediment | MRASLYEALGIPPTASDEEVRAALRRLIRKYYAKTRD |
| Ga0315276_104113541 | 3300032177 | Sediment | MRASLYEALGIPPTASDEEVRAALRRLIRKYYAKTRDGQGNVEE |
| Ga0307471_1037234631 | 3300032180 | Hardwood Forest Soil | MRASLYEALGISPTASDEEVRAALRRLIRKYYAKTRDGQG |
| Ga0307472_1002209341 | 3300032205 | Hardwood Forest Soil | MKATLYEALGIPQVASDEEVRASLRRLIRKYYAKTRDGQGNVEEALRFINH |
| Ga0315271_113790532 | 3300032256 | Sediment | MRATLYDALGIPPAASDDEVRAALRRQIRKYYTKTRDGHG |
| Ga0315275_115505311 | 3300032401 | Sediment | MRATLYDALGVPPAASDDEVRAALRRQIRKHYTKTRDGHGNVEEA |
| Ga0335082_110114071 | 3300032782 | Soil | MRATLYEALGISPTASDEDVRASLRRLIRKYYAKT |
| Ga0335070_118053061 | 3300032829 | Soil | MKATLYEALGISAKASDEEVRASLRRIIRKYYAKTRDGQ |
| Ga0335083_113686292 | 3300032954 | Soil | MRASLYEALGIAPAASDEEVRAALRRLIRKYYAKTRDGQGNVEEA |
| Ga0318519_100143496 | 3300033290 | Soil | MKATLYEALGILPTSSDEEVRAALRRLIRKYYAKTRDGQGNVEEALRFINHAS |
| Ga0316605_109716102 | 3300033408 | Soil | MKTTLYEALGLAPNASDEDVRAALRRLIRKYYAKTRDGHGN |
| Ga0310810_107518152 | 3300033412 | Soil | MKATLYDALGISPTSSDEEVRAALRGLIRKYYAKTRDGQ |
| Ga0316603_119114281 | 3300033413 | Soil | MKATLYEALGIPPAASDEEVRAALRRLIRKYYAKTR |
| Ga0316619_116103072 | 3300033414 | Soil | MKATLYEALGISPTASDEDVRASLRRLIRKYYTKTRDGHGNVE |
| Ga0316622_1018977622 | 3300033416 | Soil | MKTTLYEALGLAPNASDEDVRAALRRLIRKYYAKTRDGHGNVEEALRFIND |
| Ga0316625_1009678432 | 3300033418 | Soil | MKATLYEALGISPTASDEDVRASLRRLIRKYYAKTRDGHGN |
| Ga0316625_1015145811 | 3300033418 | Soil | MKATLYEALGISPTASDEDVRASLRRLIRKYYTKTRDGHGNVEEALR |
| Ga0326726_118622902 | 3300033433 | Peat Soil | MKATLYEALGIPPAASDEEVRAALRRLIRKYYAKTRDGQG |
| Ga0316620_126136952 | 3300033480 | Soil | MKSTLYDALGILPTSSDEDVRAALRGLIRKYYTKTRDGQGNVEEALRFI |
| Ga0316627_1023908971 | 3300033482 | Soil | MKATLYEALGISPTASDEDVRASLRRLIRKYYTKTRDGHGNVEEA |
| Ga0316616_1001666231 | 3300033521 | Soil | MKATIYEALGIPQTASDEEVRAALRRLIRKYYARTRDGQG |
| Ga0247829_104414423 | 3300033550 | Soil | MKATLYDALGISPTSSDEEVRAALRGLIRKYYAKTRDA |
| Ga0316617_1026392201 | 3300033557 | Soil | MKATLYEALGISPTASDEDVRASLRRLIRKYYTKTRDGHGNVEEALRFINHA |
| Ga0370486_007111_2_151 | 3300034126 | Untreated Peat Soil | VKATLYEALGILPTSSDEDVRAALRRLIRKYYAGTRDGQGNVEEALRFIN |
| ⦗Top⦘ |