| Basic Information | |
|---|---|
| Family ID | F016963 |
| Family Type | Metagenome |
| Number of Sequences | 243 |
| Average Sequence Length | 49 residues |
| Representative Sequence | MIEILPEQSTHEQLLNRVRSLARELAEAKAALAAAEGRENDLIDRIRSGL |
| Number of Associated Samples | 98 |
| Number of Associated Scaffolds | 243 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 78.84 % |
| % of genes near scaffold ends (potentially truncated) | 25.10 % |
| % of genes from short scaffolds (< 2000 bps) | 62.14 % |
| Associated GOLD sequencing projects | 81 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (82.716 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake (42.798 % of family members) |
| Environment Ontology (ENVO) | Unclassified (78.189 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (83.128 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 72.00% β-sheet: 0.00% Coil/Unstructured: 28.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 243 Family Scaffolds |
|---|---|---|
| PF12705 | PDDEXK_1 | 35.39 |
| PF08279 | HTH_11 | 10.70 |
| PF13481 | AAA_25 | 6.58 |
| PF00145 | DNA_methylase | 2.47 |
| PF04480 | DUF559 | 2.47 |
| PF05136 | Phage_portal_2 | 1.65 |
| PF08708 | PriCT_1 | 1.23 |
| PF02557 | VanY | 1.23 |
| PF05876 | GpA_ATPase | 1.23 |
| PF04545 | Sigma70_r4 | 1.23 |
| PF04851 | ResIII | 0.82 |
| PF05869 | Dam | 0.82 |
| PF00589 | Phage_integrase | 0.82 |
| PF00149 | Metallophos | 0.41 |
| PF04055 | Radical_SAM | 0.41 |
| PF11645 | PDDEXK_5 | 0.41 |
| PF03071 | GNT-I | 0.41 |
| PF00676 | E1_dh | 0.41 |
| PF00356 | LacI | 0.41 |
| PF05063 | MT-A70 | 0.41 |
| COG ID | Name | Functional Category | % Frequency in 243 Family Scaffolds |
|---|---|---|---|
| COG0270 | DNA-cytosine methylase | Replication, recombination and repair [L] | 2.47 |
| COG5511 | Phage capsid protein | Mobilome: prophages, transposons [X] | 1.65 |
| COG1876 | LD-carboxypeptidase LdcB, LAS superfamily | Cell wall/membrane/envelope biogenesis [M] | 1.23 |
| COG2173 | D-alanyl-D-alanine dipeptidase | Cell wall/membrane/envelope biogenesis [M] | 1.23 |
| COG5525 | Phage terminase, large subunit GpA | Mobilome: prophages, transposons [X] | 1.23 |
| COG4725 | N6-adenosine-specific RNA methylase IME4 | Translation, ribosomal structure and biogenesis [J] | 0.82 |
| COG0567 | 2-oxoglutarate dehydrogenase complex, dehydrogenase (E1) component, and related enzymes | Energy production and conversion [C] | 0.41 |
| COG1071 | TPP-dependent pyruvate or acetoin dehydrogenase subunit alpha | Energy production and conversion [C] | 0.41 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 82.72 % |
| Unclassified | root | N/A | 17.28 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000736|JGI12547J11936_1001967 | All Organisms → cellular organisms → Bacteria | 5799 | Open in IMG/M |
| 3300002835|B570J40625_100350839 | All Organisms → cellular organisms → Bacteria | 1462 | Open in IMG/M |
| 3300003490|JGI25926J51410_1051656 | All Organisms → cellular organisms → Bacteria | 710 | Open in IMG/M |
| 3300004448|Ga0065861_1058002 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 1561 | Open in IMG/M |
| 3300004448|Ga0065861_1129287 | Not Available | 1028 | Open in IMG/M |
| 3300004448|Ga0065861_1168895 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 951 | Open in IMG/M |
| 3300004460|Ga0066222_1036745 | All Organisms → cellular organisms → Bacteria | 2863 | Open in IMG/M |
| 3300004461|Ga0066223_1035104 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 863 | Open in IMG/M |
| 3300004461|Ga0066223_1035106 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 1393 | Open in IMG/M |
| 3300004461|Ga0066223_1114772 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 906 | Open in IMG/M |
| 3300004772|Ga0007791_10167545 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 636 | Open in IMG/M |
| 3300005581|Ga0049081_10001474 | All Organisms → cellular organisms → Bacteria | 8885 | Open in IMG/M |
| 3300005581|Ga0049081_10009228 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 3742 | Open in IMG/M |
| 3300005940|Ga0073913_10006431 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1549 | Open in IMG/M |
| 3300005943|Ga0073926_10141120 | Not Available | 508 | Open in IMG/M |
| 3300006005|Ga0073910_1004511 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 887 | Open in IMG/M |
| 3300006014|Ga0073919_1010178 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 858 | Open in IMG/M |
| 3300006639|Ga0079301_1001382 | All Organisms → cellular organisms → Bacteria | 11183 | Open in IMG/M |
| 3300006805|Ga0075464_10004477 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 6543 | Open in IMG/M |
| 3300006805|Ga0075464_10236857 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 1089 | Open in IMG/M |
| 3300006805|Ga0075464_10307648 | All Organisms → cellular organisms → Bacteria | 954 | Open in IMG/M |
| 3300006805|Ga0075464_10312439 | Not Available | 947 | Open in IMG/M |
| 3300006805|Ga0075464_10430991 | Not Available | 803 | Open in IMG/M |
| 3300006805|Ga0075464_10471429 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 767 | Open in IMG/M |
| 3300006805|Ga0075464_10506121 | Not Available | 739 | Open in IMG/M |
| 3300006805|Ga0075464_11104720 | Not Available | 500 | Open in IMG/M |
| 3300007559|Ga0102828_1121875 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 643 | Open in IMG/M |
| 3300007735|Ga0104988_10203 | All Organisms → cellular organisms → Bacteria | 11902 | Open in IMG/M |
| 3300009026|Ga0102829_1078511 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 1014 | Open in IMG/M |
| 3300009068|Ga0114973_10000471 | All Organisms → cellular organisms → Bacteria | 30394 | Open in IMG/M |
| 3300009068|Ga0114973_10000515 | Not Available | 29286 | Open in IMG/M |
| 3300009068|Ga0114973_10004861 | All Organisms → cellular organisms → Bacteria | 9241 | Open in IMG/M |
| 3300009068|Ga0114973_10007885 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 7051 | Open in IMG/M |
| 3300009068|Ga0114973_10023057 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 3840 | Open in IMG/M |
| 3300009068|Ga0114973_10024749 | All Organisms → cellular organisms → Bacteria | 3688 | Open in IMG/M |
| 3300009068|Ga0114973_10083069 | Not Available | 1837 | Open in IMG/M |
| 3300009068|Ga0114973_10105763 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 1596 | Open in IMG/M |
| 3300009068|Ga0114973_10132015 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 1399 | Open in IMG/M |
| 3300009068|Ga0114973_10163086 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 1234 | Open in IMG/M |
| 3300009068|Ga0114973_10189259 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 1128 | Open in IMG/M |
| 3300009068|Ga0114973_10190764 | Not Available | 1123 | Open in IMG/M |
| 3300009068|Ga0114973_10289492 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 875 | Open in IMG/M |
| 3300009068|Ga0114973_10579819 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 576 | Open in IMG/M |
| 3300009151|Ga0114962_10019315 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → Verrucomicrobium → unclassified Verrucomicrobium → Verrucomicrobium sp. GAS474 | 4844 | Open in IMG/M |
| 3300009151|Ga0114962_10061982 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 2423 | Open in IMG/M |
| 3300009152|Ga0114980_10034551 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 3115 | Open in IMG/M |
| 3300009152|Ga0114980_10037977 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 2956 | Open in IMG/M |
| 3300009152|Ga0114980_10067122 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 2162 | Open in IMG/M |
| 3300009152|Ga0114980_10097972 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 1754 | Open in IMG/M |
| 3300009152|Ga0114980_10257782 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 1017 | Open in IMG/M |
| 3300009152|Ga0114980_10296808 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 938 | Open in IMG/M |
| 3300009152|Ga0114980_10307878 | Not Available | 918 | Open in IMG/M |
| 3300009154|Ga0114963_10004510 | All Organisms → cellular organisms → Bacteria | 9573 | Open in IMG/M |
| 3300009154|Ga0114963_10018057 | All Organisms → cellular organisms → Bacteria | 4718 | Open in IMG/M |
| 3300009154|Ga0114963_10030777 | All Organisms → cellular organisms → Bacteria | 3537 | Open in IMG/M |
| 3300009154|Ga0114963_10075592 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 2096 | Open in IMG/M |
| 3300009154|Ga0114963_10182026 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 1227 | Open in IMG/M |
| 3300009154|Ga0114963_10334348 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 835 | Open in IMG/M |
| 3300009155|Ga0114968_10004306 | All Organisms → cellular organisms → Bacteria | 10622 | Open in IMG/M |
| 3300009155|Ga0114968_10006194 | All Organisms → cellular organisms → Bacteria | 8829 | Open in IMG/M |
| 3300009155|Ga0114968_10007290 | All Organisms → cellular organisms → Bacteria | 8106 | Open in IMG/M |
| 3300009155|Ga0114968_10012690 | All Organisms → cellular organisms → Bacteria | 6005 | Open in IMG/M |
| 3300009155|Ga0114968_10038505 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → Verrucomicrobium → unclassified Verrucomicrobium → Verrucomicrobium sp. GAS474 | 3150 | Open in IMG/M |
| 3300009158|Ga0114977_10055583 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 2445 | Open in IMG/M |
| 3300009159|Ga0114978_10007155 | All Organisms → cellular organisms → Bacteria | 8815 | Open in IMG/M |
| 3300009159|Ga0114978_10010760 | All Organisms → cellular organisms → Bacteria | 7048 | Open in IMG/M |
| 3300009160|Ga0114981_10009579 | All Organisms → cellular organisms → Bacteria | 5797 | Open in IMG/M |
| 3300009160|Ga0114981_10151531 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 1279 | Open in IMG/M |
| 3300009160|Ga0114981_10226280 | Not Available | 1022 | Open in IMG/M |
| 3300009160|Ga0114981_10452110 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 689 | Open in IMG/M |
| 3300009161|Ga0114966_10103493 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 1910 | Open in IMG/M |
| 3300009161|Ga0114966_10368657 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 849 | Open in IMG/M |
| 3300009161|Ga0114966_10540650 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 658 | Open in IMG/M |
| 3300009161|Ga0114966_10573314 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 633 | Open in IMG/M |
| 3300009163|Ga0114970_10032518 | All Organisms → cellular organisms → Bacteria | 3460 | Open in IMG/M |
| 3300009163|Ga0114970_10189391 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 1216 | Open in IMG/M |
| 3300009163|Ga0114970_10306116 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 903 | Open in IMG/M |
| 3300009164|Ga0114975_10005283 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 8392 | Open in IMG/M |
| 3300009180|Ga0114979_10006519 | All Organisms → cellular organisms → Bacteria | 7678 | Open in IMG/M |
| 3300009180|Ga0114979_10048171 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 2675 | Open in IMG/M |
| 3300009180|Ga0114979_10300746 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 953 | Open in IMG/M |
| 3300009180|Ga0114979_10476248 | Not Available | 723 | Open in IMG/M |
| 3300009183|Ga0114974_10009393 | All Organisms → cellular organisms → Bacteria | 7119 | Open in IMG/M |
| 3300009183|Ga0114974_10028094 | All Organisms → cellular organisms → Bacteria | 3912 | Open in IMG/M |
| 3300009183|Ga0114974_10176098 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 1321 | Open in IMG/M |
| 3300009184|Ga0114976_10191103 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 1131 | Open in IMG/M |
| 3300009187|Ga0114972_10692586 | Not Available | 563 | Open in IMG/M |
| 3300010157|Ga0114964_10239930 | Not Available | 865 | Open in IMG/M |
| 3300010160|Ga0114967_10241368 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 951 | Open in IMG/M |
| 3300010885|Ga0133913_12104346 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 1397 | Open in IMG/M |
| 3300011010|Ga0139557_1065602 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 609 | Open in IMG/M |
| 3300011113|Ga0151517_1107 | All Organisms → cellular organisms → Bacteria | 35092 | Open in IMG/M |
| 3300011114|Ga0151515_10872 | All Organisms → cellular organisms → Bacteria | 12122 | Open in IMG/M |
| 3300011995|Ga0153800_1022835 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 643 | Open in IMG/M |
| 3300012000|Ga0119951_1118285 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 610 | Open in IMG/M |
| 3300013006|Ga0164294_10014101 | All Organisms → cellular organisms → Bacteria | 6596 | Open in IMG/M |
| 3300013372|Ga0177922_10399912 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 2107 | Open in IMG/M |
| 3300017701|Ga0181364_1029337 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 891 | Open in IMG/M |
| 3300017722|Ga0181347_1045350 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 1337 | Open in IMG/M |
| 3300017722|Ga0181347_1057926 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 1160 | Open in IMG/M |
| 3300017722|Ga0181347_1163840 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 601 | Open in IMG/M |
| 3300017736|Ga0181365_1021356 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 1630 | Open in IMG/M |
| 3300017736|Ga0181365_1119564 | Not Available | 632 | Open in IMG/M |
| 3300017736|Ga0181365_1157089 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 537 | Open in IMG/M |
| 3300017761|Ga0181356_1089501 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 1013 | Open in IMG/M |
| 3300017761|Ga0181356_1134618 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 777 | Open in IMG/M |
| 3300017761|Ga0181356_1194063 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 605 | Open in IMG/M |
| 3300017766|Ga0181343_1146950 | Not Available | 658 | Open in IMG/M |
| 3300017774|Ga0181358_1150151 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 796 | Open in IMG/M |
| 3300017774|Ga0181358_1176101 | Not Available | 715 | Open in IMG/M |
| 3300017774|Ga0181358_1178229 | Not Available | 709 | Open in IMG/M |
| 3300017774|Ga0181358_1227828 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 596 | Open in IMG/M |
| 3300017777|Ga0181357_1025369 | All Organisms → cellular organisms → Bacteria | 2350 | Open in IMG/M |
| 3300017777|Ga0181357_1168048 | Not Available | 799 | Open in IMG/M |
| 3300017778|Ga0181349_1095051 | Not Available | 1121 | Open in IMG/M |
| 3300017780|Ga0181346_1117434 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1021 | Open in IMG/M |
| 3300017784|Ga0181348_1303530 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 534 | Open in IMG/M |
| 3300017785|Ga0181355_1026905 | All Organisms → cellular organisms → Bacteria | 2491 | Open in IMG/M |
| 3300018790|Ga0187842_1207997 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 571 | Open in IMG/M |
| 3300018815|Ga0187845_1282067 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 524 | Open in IMG/M |
| 3300018815|Ga0187845_1289391 | Not Available | 516 | Open in IMG/M |
| 3300018868|Ga0187844_10077337 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 1527 | Open in IMG/M |
| 3300018868|Ga0187844_10266248 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 721 | Open in IMG/M |
| 3300018868|Ga0187844_10424346 | Not Available | 543 | Open in IMG/M |
| 3300019093|Ga0187843_10052009 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 1957 | Open in IMG/M |
| 3300019784|Ga0181359_1002735 | All Organisms → cellular organisms → Bacteria | 5214 | Open in IMG/M |
| 3300019784|Ga0181359_1011542 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 3177 | Open in IMG/M |
| 3300019784|Ga0181359_1032623 | All Organisms → cellular organisms → Bacteria | 2013 | Open in IMG/M |
| 3300019784|Ga0181359_1044283 | Not Available | 1722 | Open in IMG/M |
| 3300019784|Ga0181359_1061327 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 1439 | Open in IMG/M |
| 3300019784|Ga0181359_1081129 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1215 | Open in IMG/M |
| 3300019784|Ga0181359_1207013 | Not Available | 627 | Open in IMG/M |
| 3300019784|Ga0181359_1231716 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 573 | Open in IMG/M |
| 3300019784|Ga0181359_1250202 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 538 | Open in IMG/M |
| 3300019784|Ga0181359_1250570 | Not Available | 537 | Open in IMG/M |
| 3300020573|Ga0208485_1079116 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 536 | Open in IMG/M |
| 3300021438|Ga0213920_1111759 | Not Available | 515 | Open in IMG/M |
| 3300021519|Ga0194048_10062708 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 1476 | Open in IMG/M |
| 3300021519|Ga0194048_10111341 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 1048 | Open in IMG/M |
| 3300021519|Ga0194048_10151905 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 870 | Open in IMG/M |
| 3300021519|Ga0194048_10276794 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 608 | Open in IMG/M |
| 3300021519|Ga0194048_10331474 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 544 | Open in IMG/M |
| 3300021962|Ga0222713_10011280 | All Organisms → cellular organisms → Bacteria | 7990 | Open in IMG/M |
| 3300021962|Ga0222713_10338408 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 945 | Open in IMG/M |
| 3300021963|Ga0222712_10001491 | All Organisms → cellular organisms → Bacteria | 28867 | Open in IMG/M |
| 3300021963|Ga0222712_10382375 | Not Available | 860 | Open in IMG/M |
| 3300021963|Ga0222712_10793301 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 523 | Open in IMG/M |
| 3300022190|Ga0181354_1012898 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 2515 | Open in IMG/M |
| 3300022190|Ga0181354_1017991 | All Organisms → cellular organisms → Bacteria | 2206 | Open in IMG/M |
| 3300022190|Ga0181354_1096701 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 965 | Open in IMG/M |
| 3300022190|Ga0181354_1114985 | Not Available | 868 | Open in IMG/M |
| 3300022190|Ga0181354_1183415 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 634 | Open in IMG/M |
| 3300022747|Ga0228703_1083562 | Not Available | 775 | Open in IMG/M |
| 3300022752|Ga0214917_10013227 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 7392 | Open in IMG/M |
| 3300022752|Ga0214917_10019608 | All Organisms → cellular organisms → Bacteria | 5609 | Open in IMG/M |
| 3300022752|Ga0214917_10022272 | All Organisms → cellular organisms → Bacteria | 5124 | Open in IMG/M |
| 3300022752|Ga0214917_10026477 | All Organisms → cellular organisms → Bacteria | 4510 | Open in IMG/M |
| 3300022752|Ga0214917_10035120 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 3668 | Open in IMG/M |
| 3300022752|Ga0214917_10049019 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 2881 | Open in IMG/M |
| 3300022752|Ga0214917_10055590 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 2629 | Open in IMG/M |
| 3300022752|Ga0214917_10081293 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 1979 | Open in IMG/M |
| 3300022752|Ga0214917_10097647 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 1723 | Open in IMG/M |
| 3300022752|Ga0214917_10115760 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 1512 | Open in IMG/M |
| 3300022752|Ga0214917_10117022 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 1499 | Open in IMG/M |
| 3300022752|Ga0214917_10197883 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 995 | Open in IMG/M |
| 3300022752|Ga0214917_10200532 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 984 | Open in IMG/M |
| 3300022752|Ga0214917_10242180 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 849 | Open in IMG/M |
| 3300022752|Ga0214917_10294568 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 726 | Open in IMG/M |
| 3300022752|Ga0214917_10425794 | Not Available | 538 | Open in IMG/M |
| 3300023174|Ga0214921_10010146 | All Organisms → cellular organisms → Bacteria | 11721 | Open in IMG/M |
| 3300023174|Ga0214921_10018134 | All Organisms → cellular organisms → Bacteria | 7739 | Open in IMG/M |
| 3300023174|Ga0214921_10023280 | All Organisms → cellular organisms → Bacteria | 6459 | Open in IMG/M |
| 3300023174|Ga0214921_10036231 | All Organisms → cellular organisms → Bacteria | 4686 | Open in IMG/M |
| 3300023174|Ga0214921_10043007 | All Organisms → cellular organisms → Bacteria | 4130 | Open in IMG/M |
| 3300023174|Ga0214921_10089592 | All Organisms → cellular organisms → Bacteria | 2374 | Open in IMG/M |
| 3300023174|Ga0214921_10122814 | All Organisms → cellular organisms → Bacteria | 1858 | Open in IMG/M |
| 3300023174|Ga0214921_10237278 | All Organisms → cellular organisms → Bacteria | 1087 | Open in IMG/M |
| 3300023179|Ga0214923_10036318 | All Organisms → cellular organisms → Bacteria | 3999 | Open in IMG/M |
| 3300023179|Ga0214923_10200999 | Not Available | 1175 | Open in IMG/M |
| 3300025896|Ga0208916_10007290 | All Organisms → cellular organisms → Bacteria | 4325 | Open in IMG/M |
| 3300027114|Ga0208009_1001182 | All Organisms → cellular organisms → Bacteria | 7421 | Open in IMG/M |
| 3300027393|Ga0209867_1046816 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 644 | Open in IMG/M |
| 3300027393|Ga0209867_1080140 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 505 | Open in IMG/M |
| 3300027608|Ga0208974_1000140 | All Organisms → cellular organisms → Bacteria | 31372 | Open in IMG/M |
| 3300027656|Ga0209357_1084064 | Not Available | 927 | Open in IMG/M |
| 3300027656|Ga0209357_1090431 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 881 | Open in IMG/M |
| 3300027712|Ga0209499_1027420 | All Organisms → cellular organisms → Bacteria | 2550 | Open in IMG/M |
| 3300027712|Ga0209499_1291516 | Not Available | 554 | Open in IMG/M |
| (restricted) 3300027730|Ga0247833_1044679 | All Organisms → cellular organisms → Bacteria | 2491 | Open in IMG/M |
| 3300027733|Ga0209297_1006287 | All Organisms → cellular organisms → Bacteria | 6023 | Open in IMG/M |
| 3300027733|Ga0209297_1244289 | Not Available | 691 | Open in IMG/M |
| 3300027734|Ga0209087_1003113 | All Organisms → cellular organisms → Bacteria | 9171 | Open in IMG/M |
| 3300027734|Ga0209087_1003564 | All Organisms → cellular organisms → Bacteria | 8570 | Open in IMG/M |
| 3300027734|Ga0209087_1019058 | All Organisms → cellular organisms → Bacteria | 3391 | Open in IMG/M |
| 3300027734|Ga0209087_1202673 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 760 | Open in IMG/M |
| 3300027736|Ga0209190_1212392 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 789 | Open in IMG/M |
| 3300027736|Ga0209190_1388451 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 505 | Open in IMG/M |
| 3300027741|Ga0209085_1011051 | All Organisms → cellular organisms → Bacteria | 4521 | Open in IMG/M |
| 3300027741|Ga0209085_1025688 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 2814 | Open in IMG/M |
| 3300027741|Ga0209085_1032554 | All Organisms → cellular organisms → Bacteria | 2466 | Open in IMG/M |
| 3300027741|Ga0209085_1136772 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 1046 | Open in IMG/M |
| 3300027741|Ga0209085_1275359 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 650 | Open in IMG/M |
| 3300027754|Ga0209596_1088451 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 1490 | Open in IMG/M |
| 3300027759|Ga0209296_1078559 | Not Available | 1631 | Open in IMG/M |
| 3300027759|Ga0209296_1358110 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 559 | Open in IMG/M |
| 3300027760|Ga0209598_10014734 | All Organisms → cellular organisms → Bacteria | 4827 | Open in IMG/M |
| 3300027760|Ga0209598_10028451 | All Organisms → cellular organisms → Bacteria | 3132 | Open in IMG/M |
| 3300027760|Ga0209598_10062138 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 1875 | Open in IMG/M |
| 3300027760|Ga0209598_10086118 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1510 | Open in IMG/M |
| 3300027760|Ga0209598_10105397 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 1317 | Open in IMG/M |
| 3300027763|Ga0209088_10002527 | All Organisms → cellular organisms → Bacteria | 11177 | Open in IMG/M |
| 3300027763|Ga0209088_10051518 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1999 | Open in IMG/M |
| 3300027770|Ga0209086_10068146 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 1918 | Open in IMG/M |
| 3300027770|Ga0209086_10349461 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 612 | Open in IMG/M |
| 3300027782|Ga0209500_10085097 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 1596 | Open in IMG/M |
| 3300027785|Ga0209246_10156045 | Not Available | 896 | Open in IMG/M |
| 3300027963|Ga0209400_1006174 | All Organisms → cellular organisms → Bacteria | 8100 | Open in IMG/M |
| 3300027963|Ga0209400_1007641 | All Organisms → cellular organisms → Bacteria | 7156 | Open in IMG/M |
| 3300027963|Ga0209400_1181586 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 888 | Open in IMG/M |
| 3300027971|Ga0209401_1000297 | All Organisms → cellular organisms → Bacteria | 34126 | Open in IMG/M |
| 3300027971|Ga0209401_1000320 | Not Available | 32925 | Open in IMG/M |
| 3300027971|Ga0209401_1000344 | All Organisms → cellular organisms → Bacteria | 32011 | Open in IMG/M |
| 3300027971|Ga0209401_1003379 | All Organisms → cellular organisms → Bacteria | 10075 | Open in IMG/M |
| 3300027971|Ga0209401_1003935 | All Organisms → cellular organisms → Bacteria | 9268 | Open in IMG/M |
| 3300027971|Ga0209401_1007121 | All Organisms → cellular organisms → Bacteria | 6538 | Open in IMG/M |
| 3300027973|Ga0209298_10001910 | All Organisms → cellular organisms → Bacteria | 13256 | Open in IMG/M |
| 3300027973|Ga0209298_10003599 | All Organisms → cellular organisms → Bacteria | 9265 | Open in IMG/M |
| 3300027973|Ga0209298_10116421 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 1152 | Open in IMG/M |
| 3300027973|Ga0209298_10133488 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 1057 | Open in IMG/M |
| 3300027974|Ga0209299_1026162 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 2574 | Open in IMG/M |
| (restricted) 3300028557|Ga0247832_1100070 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 1239 | Open in IMG/M |
| 3300031707|Ga0315291_10237097 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 1832 | Open in IMG/M |
| 3300031707|Ga0315291_10368283 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1379 | Open in IMG/M |
| 3300031707|Ga0315291_10520789 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1098 | Open in IMG/M |
| 3300031707|Ga0315291_10684747 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 913 | Open in IMG/M |
| 3300031746|Ga0315293_10852520 | Not Available | 662 | Open in IMG/M |
| 3300031952|Ga0315294_10426478 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1233 | Open in IMG/M |
| 3300031997|Ga0315278_10802552 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 951 | Open in IMG/M |
| 3300031999|Ga0315274_11432750 | Not Available | 662 | Open in IMG/M |
| 3300032053|Ga0315284_10462175 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 1549 | Open in IMG/M |
| 3300032256|Ga0315271_10903838 | Not Available | 762 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 42.80% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 16.87% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 11.93% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 5.35% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 4.12% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 3.70% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 2.88% |
| Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Sand | 2.47% |
| Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 2.06% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 2.06% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 1.23% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 0.41% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater And Sediment | 0.41% |
| Freshwater | Environmental → Aquatic → Freshwater → Ice → Unclassified → Freshwater | 0.41% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 0.82% |
| Freshwater | Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater | 0.82% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 0.82% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 0.82% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000736 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB epilimnion July 2011 | Environmental | Open in IMG/M |
| 3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
| 3300003490 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SN | Environmental | Open in IMG/M |
| 3300004448 | Marine viral communities from Newfoundland, Canada BC-1 | Environmental | Open in IMG/M |
| 3300004460 | Marine viral communities from Newfoundland, Canada BC-1 | Environmental | Open in IMG/M |
| 3300004461 | Marine viral communities from Newfoundland, Canada BC-2 | Environmental | Open in IMG/M |
| 3300004772 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA0.5M | Environmental | Open in IMG/M |
| 3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
| 3300005940 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_25-Nov-14 | Environmental | Open in IMG/M |
| 3300005943 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_4-Nov-14 | Environmental | Open in IMG/M |
| 3300006005 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T2_25-Nov-14 | Environmental | Open in IMG/M |
| 3300006014 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T3_25-Nov-14 | Environmental | Open in IMG/M |
| 3300006639 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_11 | Environmental | Open in IMG/M |
| 3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007559 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541 | Environmental | Open in IMG/M |
| 3300007735 | Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea ? 2014Oct | Environmental | Open in IMG/M |
| 3300009026 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575 | Environmental | Open in IMG/M |
| 3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009151 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG | Environmental | Open in IMG/M |
| 3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
| 3300009154 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG | Environmental | Open in IMG/M |
| 3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
| 3300009158 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG | Environmental | Open in IMG/M |
| 3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
| 3300009160 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG | Environmental | Open in IMG/M |
| 3300009161 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG | Environmental | Open in IMG/M |
| 3300009163 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG | Environmental | Open in IMG/M |
| 3300009164 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG | Environmental | Open in IMG/M |
| 3300009180 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG | Environmental | Open in IMG/M |
| 3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
| 3300009184 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG | Environmental | Open in IMG/M |
| 3300009187 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_EF_MetaG | Environmental | Open in IMG/M |
| 3300010157 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaG | Environmental | Open in IMG/M |
| 3300010160 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG | Environmental | Open in IMG/M |
| 3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
| 3300011010 | Freshwater microbial communities from Western Basin Lake Erie, Ontario, Canada - Station 970 - Surface Ice | Environmental | Open in IMG/M |
| 3300011113 | Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea - SYL_2015Sep | Environmental | Open in IMG/M |
| 3300011114 | Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea - SYL_2016Feb | Environmental | Open in IMG/M |
| 3300011995 | Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 880 - Top - Depth 1m | Environmental | Open in IMG/M |
| 3300012000 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007A | Environmental | Open in IMG/M |
| 3300013006 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES005 metaG | Environmental | Open in IMG/M |
| 3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
| 3300017701 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.S.N | Environmental | Open in IMG/M |
| 3300017722 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017736 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N | Environmental | Open in IMG/M |
| 3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017766 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D | Environmental | Open in IMG/M |
| 3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017778 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300018790 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - SP09_SKY_41 | Environmental | Open in IMG/M |
| 3300018815 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - SP09_SKY_68 | Environmental | Open in IMG/M |
| 3300018868 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - SP09_SKY_50 | Environmental | Open in IMG/M |
| 3300019093 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - SP09_SKY_43 | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020573 | Freshwater microbial communities from Lake Mendota, WI - 17JUL2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300021438 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 11-17 MG | Environmental | Open in IMG/M |
| 3300021519 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L222-5m | Environmental | Open in IMG/M |
| 3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
| 3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
| 3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
| 3300022747 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 29-17_Aug_MG | Environmental | Open in IMG/M |
| 3300022752 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BB | Environmental | Open in IMG/M |
| 3300023174 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505 | Environmental | Open in IMG/M |
| 3300023179 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1510 | Environmental | Open in IMG/M |
| 3300025896 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027114 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_16 (SPAdes) | Environmental | Open in IMG/M |
| 3300027393 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_4-Nov-14 (SPAdes) | Environmental | Open in IMG/M |
| 3300027608 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027656 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027712 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130208_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027730 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_8m | Environmental | Open in IMG/M |
| 3300027733 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027734 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027736 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027741 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027754 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027760 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027763 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027770 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027782 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027785 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027963 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027971 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027973 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027974 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028557 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_4m | Environmental | Open in IMG/M |
| 3300031707 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_20 | Environmental | Open in IMG/M |
| 3300031746 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_20 | Environmental | Open in IMG/M |
| 3300031952 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_40 | Environmental | Open in IMG/M |
| 3300031997 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0 | Environmental | Open in IMG/M |
| 3300031999 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20 | Environmental | Open in IMG/M |
| 3300032053 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_16 | Environmental | Open in IMG/M |
| 3300032256 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_top | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12547J11936_100196713 | 3300000736 | Freshwater And Sediment | MIEILPEQSTHEQLLNRVRSLARELAEAKAALAAAEGRENDLIDRIRAGL* |
| B570J40625_1003508392 | 3300002835 | Freshwater | VIEILPEQSTHEQLLNRVRSLARELAEAKAALAAAEGRENDLIDRIRAGL* |
| JGI25926J51410_10516562 | 3300003490 | Freshwater Lake | MIEVLPEETTHEQLLNRVRSLARQLAEAKAALAASEARENDLIDRIRGGL* |
| Ga0065861_10580022 | 3300004448 | Marine | MIEILPDQTTQEQLLNRVRSLARELAEAKAALVAAETRENVLIDRIREGL* |
| Ga0065861_11292873 | 3300004448 | Marine | MIDVLPDETTHDQLLNRVRSLARQLAEAKAALAASEARENDLIDRIRSGL* |
| Ga0065861_11688953 | 3300004448 | Marine | MIEILPEQSTHEQLLNRVRSLARELAEEKAALAAAEGRENDLIDRMRLGL* |
| Ga0066222_10367453 | 3300004460 | Marine | VIEILPEQSTHEQLLNRVRSLARELAEAKAALAAAEGRENDLIDRMRLGL* |
| Ga0066223_10351043 | 3300004461 | Marine | VIEILPEQSTHEQLLNRVRSLARELAEAKAALAAAETRENVLIDRIREGL* |
| Ga0066223_10351062 | 3300004461 | Marine | MIEILPEQSTHEQLLNRVRSLARELAEAKAALAAAEGRENDLIDRIRSGL* |
| Ga0066223_11147723 | 3300004461 | Marine | MIEILPDQTTHEQLLNRVRSLARELAEAKAALAAAETRENVLIDRIREGL* |
| Ga0007791_101675452 | 3300004772 | Freshwater | MTLGRCVVIEILPDQTTHEQLLNRVRSLARELAEAKAALAAAETRENDLIDRIRAGL* |
| Ga0049081_1000147414 | 3300005581 | Freshwater Lentic | VIEILPEQSTQEQLLNRVRSLARELAEAKAALAAAEGRENDLIDRIRAGL* |
| Ga0049081_100092282 | 3300005581 | Freshwater Lentic | MIEVLPEETTHDQLLNRVRSLARQLAEAKAALAASEARENDLIDRIRSGL* |
| Ga0073913_100064312 | 3300005940 | Sand | MIEVLPEETTHDQLLNRVRSLARQLAEAKAALAASEARENDLIDRIRGGL* |
| Ga0073926_101411202 | 3300005943 | Sand | VIEILPEQSTHDQLLNRVRSLARQLAEAKAALAASEARENDLIDRIRSGL* |
| Ga0073910_10045112 | 3300006005 | Sand | MIEVLPDETTHDQLLNRVRSLARQLAEAKAALAAAEGRENDLMDRIRAGL* |
| Ga0073919_10101781 | 3300006014 | Sand | STTRVRCRMIEVLPEETTHDQLLNRVRSLARQLAEAKAALAASEARENDLIDRIRGGL* |
| Ga0079301_10013827 | 3300006639 | Deep Subsurface | VIEILPEQSTQEQLLNRVRSLARELAEAKAALAAAEGRENDLIDRIRSGL* |
| Ga0075464_100044779 | 3300006805 | Aqueous | MIEVLPDETTHDQLLNRVRSLARQLAEAKAALAASEARENDLIDRIRSGL* |
| Ga0075464_102368571 | 3300006805 | Aqueous | CAVIEVLPEETTHDQLLNRVRSLARELAEAKAALAAAEGRENDLIDRIRGGL* |
| Ga0075464_103076482 | 3300006805 | Aqueous | VIEILPEQSTHEQLLNRVRSLARELAEAKAALAAAEGRENDLMDRIRSGL* |
| Ga0075464_103124392 | 3300006805 | Aqueous | MIEVMPDETTHDQLLNRVRSLARQLAEAKAALAASEARENDLIDRIRGGL* |
| Ga0075464_104309912 | 3300006805 | Aqueous | MIEILPEQSTYQQLLDRVRSLARQLAEARAALAASEARENDLIDRMREGL* |
| Ga0075464_104714292 | 3300006805 | Aqueous | VIEILPEQTTHEQLLNRVRSLARQLAEAKAALAASEARENDLIDRIRSGL* |
| Ga0075464_105061211 | 3300006805 | Aqueous | MIEVMPEETTHEQLLNRVRSLARQLAEAKAALAASEARENDLIDRIRGGL* |
| Ga0075464_111047202 | 3300006805 | Aqueous | VIEILPDQTTHEQLLNRVRSLARELAEAKAALAAAETRENVLIDRIREGL* |
| Ga0102828_11218751 | 3300007559 | Estuarine | MIEVLPDETTHDQLLNRVRSLARQLAEAKAALAASEARENDLIDRIRGGL* |
| Ga0104988_1020325 | 3300007735 | Freshwater | VIEILPEQTTHEQLLNRVRSLARELAEAKAALAAAEGRENDLIDRIRAGL* |
| Ga0102829_10785112 | 3300009026 | Estuarine | VIEVLPDETTHDQLLNRVRSLARQLAEAKAALAASEARENDLIDRIRGGL* |
| Ga0114973_100004719 | 3300009068 | Freshwater Lake | VIEVLPEQSTHEQLLNRVRSLARELAEAKAALVAAEGRENDLIDRIRAGL* |
| Ga0114973_100005155 | 3300009068 | Freshwater Lake | VIEILPEQSTHEQLLNRVRSLARELAEAKSALAAAEGRENNLIERIRAGL* |
| Ga0114973_1000486112 | 3300009068 | Freshwater Lake | MIEILPEQSTHEQLLDRVRSLARQLAEARAALAASEARENDLIDRMREGL* |
| Ga0114973_100078858 | 3300009068 | Freshwater Lake | VIEVLPEESIHEQLLNRVRSLARQLAEAKAALAASEARENDLIDRIRGGL* |
| Ga0114973_100230572 | 3300009068 | Freshwater Lake | VIEILPEQSTHEQLLNRVRSLARELAEAKAALAAAEGRENDLIDRIRSGL* |
| Ga0114973_100247498 | 3300009068 | Freshwater Lake | VIEVLPEQSTHEQLLNRVRSLARELAEAKAALAAAEGRENNLIERIRAGL* |
| Ga0114973_100830692 | 3300009068 | Freshwater Lake | VIEILPEQTTHEQLLNRVRSLARELAEAKAALAAAETRENVLIDRIREGL* |
| Ga0114973_101057635 | 3300009068 | Freshwater Lake | VIEILPEQSTQEQLLNRVRSLARELAEAKAALAASEARENDLIDRIRAGL* |
| Ga0114973_101320153 | 3300009068 | Freshwater Lake | VIEILPDQTTHEQLLNRVRSLARELAEAKAALAVAETRENVLIDRIREGL* |
| Ga0114973_101630864 | 3300009068 | Freshwater Lake | VIEILPEQSTHEQLLNRVRSLARQLAEAKAALAAAEGRENDLIERIRAGL* |
| Ga0114973_101892592 | 3300009068 | Freshwater Lake | VIEILPEQSTHEQLLNRVRSLARELAEAKAALAAAEGRENDLMDRIRAGL* |
| Ga0114973_101907641 | 3300009068 | Freshwater Lake | VIEILPEQSTHEQLLNRVRSLARELAEAKAALAAAEGRENNLIERIRAGL* |
| Ga0114973_102894922 | 3300009068 | Freshwater Lake | MIEILPEETTHEQLLNRVRSLARQLAEAKAALAASEARENDLIDRIRGGL* |
| Ga0114973_105798192 | 3300009068 | Freshwater Lake | VIEILPEQSTYEQLLNRVRSLARQLAEAKAALAAAEGRENDLIDRIRSGL* |
| Ga0114962_1001931510 | 3300009151 | Freshwater Lake | MIEILPDQTTHEQLINRVRSLARELAEAKAALAAAETRENVLIDRIREGL* |
| Ga0114962_100619827 | 3300009151 | Freshwater Lake | MIEILPEQTTYQQLLDRVRSLARQLAEARAALAASEARENDLIDRMREGL* |
| Ga0114980_100345513 | 3300009152 | Freshwater Lake | MIEILPEQSTHEQLLNRVRSLARELAEAKAALAAAEVRENDLIERMRPGL* |
| Ga0114980_100379774 | 3300009152 | Freshwater Lake | VIEILPEQSTHEQLLNRVRSLARELAEAKAALAAAEGRENDLIDRMRPGL* |
| Ga0114980_100671223 | 3300009152 | Freshwater Lake | MIEILPEQSTHEQLLNRVRSLARELAEAKAALAAAEGRENDLIERMRPGL* |
| Ga0114980_100979722 | 3300009152 | Freshwater Lake | VIEILAEQSTHEQLLNRVRSLARELAEAKAALAAAEGRENDLIERMRPGL* |
| Ga0114980_102577822 | 3300009152 | Freshwater Lake | VIDILPEETTHDQLLNRVRSLARQLAEAKAALAASEARENDLIDRIRAGL* |
| Ga0114980_102968081 | 3300009152 | Freshwater Lake | STHEQLLNRVRSLARELAEAKAALAASEARENDLIDRIRSGL* |
| Ga0114980_103078782 | 3300009152 | Freshwater Lake | VIELLPEQSTHEQLLNRVRSLARELAEAKAALAAAEGRENDLIDRIRSGL* |
| Ga0114963_1000451010 | 3300009154 | Freshwater Lake | MIEVLPEETTHEQLLNRVRSLARELAEAKAALAAAEGRENDLIDRIRSGL* |
| Ga0114963_100180578 | 3300009154 | Freshwater Lake | MIEILPDQTTHEQLLNRVRSLARELAEAKAALAAAETRENNLIDRIRAGL* |
| Ga0114963_100307774 | 3300009154 | Freshwater Lake | MIEILPDQTTHEQLLNRVRSLARELAEAKAALAAAETRENDLIDRIRAGL* |
| Ga0114963_100755923 | 3300009154 | Freshwater Lake | MIEILPDQTTHEQLLNRVRSLARELAEAKAALTAAETRENVLIDRIREGL* |
| Ga0114963_101820262 | 3300009154 | Freshwater Lake | MIEVLPEETTQDQLLNRVRSLARQLAEAKAALAASEARENDLIDRIRGGL* |
| Ga0114963_103343483 | 3300009154 | Freshwater Lake | VIEILPDQTTHEQLLNRVRSLARELAEAKAALTAAETRENVLIDRIREGL* |
| Ga0114963_104737971 | 3300009154 | Freshwater Lake | MIEILPDQTTHEQLLNRVRSLARELAEAKAALAAAETREN |
| Ga0114968_100043064 | 3300009155 | Freshwater Lake | MIEILPEQSTHEQLLNRVRSLARELAEAKAALAAAEGREYDLIERIRSGL* |
| Ga0114968_100061943 | 3300009155 | Freshwater Lake | VIEILPEQSTHEQLLNRVRSLARELAEAKAALAASEARENDLIDRIRSGL* |
| Ga0114968_100072909 | 3300009155 | Freshwater Lake | MIEILPEQSTNEQLLNRVRSLARELAEAKAALAAAEGRENDLIDRIRGGL* |
| Ga0114968_100126904 | 3300009155 | Freshwater Lake | MIEILPEQSTHEQLLNRVRSLARELAEAKAALAAAEGRENDLIERIRSGL* |
| Ga0114968_100385059 | 3300009155 | Freshwater Lake | MIEVLPEETTQDQLLNRVRSLARQLAEAKAALAASEARENDLMDRIRSGL* |
| Ga0114977_100555831 | 3300009158 | Freshwater Lake | LNRVRSLARELAEAKAALAAAETRENNLIDRIRAGL* |
| Ga0114978_100071559 | 3300009159 | Freshwater Lake | VIEVLAEQSTHEQLLNRVRSLARELAEAKAALAAAEGRENDLIDRIRAGL* |
| Ga0114978_1001076012 | 3300009159 | Freshwater Lake | MIEVLPEETTHDQLLNRVRSLSRQLAEAKAALAASEARENDLIDRIRSGL* |
| Ga0114981_100095792 | 3300009160 | Freshwater Lake | VIELLPEQSTHEQLLNRVRSLARELAEAKAALAAAEGRENDLIDRIRAGL* |
| Ga0114981_101515313 | 3300009160 | Freshwater Lake | MIEILPEQSTHEQLLNRVRSLARELAEAKAALAASEARENDLIDRIRSGL* |
| Ga0114981_102262802 | 3300009160 | Freshwater Lake | VIEILPEQSTHEQLLNRVRSLARELAEAKAALAAAEGRENDLIERMRPGL* |
| Ga0114981_104521102 | 3300009160 | Freshwater Lake | VIEILPDQTTHEQLLNRVRSLARELAEAKAALAAAETRENNLIDRIRAGL* |
| Ga0114966_101034933 | 3300009161 | Freshwater Lake | VIEILPEQSTNEQLLNRVRSLARELAEAKAALAAAEGRENDLIDRMRPGL* |
| Ga0114966_103686571 | 3300009161 | Freshwater Lake | NMTRVRCVVIEILPEQSTHEQLLNRVRSLARELAEAKAALAAAEGRENDLIDRIRSGL* |
| Ga0114966_105406502 | 3300009161 | Freshwater Lake | VIEILPEQSTHEQLLNRVRSLARELAEAKAALAAAEGRENDLIERMRLGL* |
| Ga0114966_105733141 | 3300009161 | Freshwater Lake | TTRGRCVVIEVLPEETTHDQLLNRVRSLARQLAEAKAALAAAEGRENDLIDRIRGGL* |
| Ga0114970_100325181 | 3300009163 | Freshwater Lake | RSTTRGRCVVIEILPDQTTHEQLLNRVRSLARELAEAKAALAAAETRENVLIDRIREGL* |
| Ga0114970_101893911 | 3300009163 | Freshwater Lake | PEQSTHEQLLNRVRSLARELAEAKAALAAAEGRENDLIERIRSGL* |
| Ga0114970_103061161 | 3300009163 | Freshwater Lake | MIEILAEQSTYQQLLDRVRSLARQLAEARAALAASEARENDLIDRMREGL* |
| Ga0114975_1000528310 | 3300009164 | Freshwater Lake | MIEVLPEETTHDQLLNRVRSLARQLAEAKAALAASEARENDLMDRIRSGL* |
| Ga0114979_1000651916 | 3300009180 | Freshwater Lake | MIEILPEQSTHEQLLNRVRSLARELAEAKAALAAAEGRENDLIDRIRGGL* |
| Ga0114979_100481714 | 3300009180 | Freshwater Lake | VIEILPDQTTHEQLLNRVRSLARELAEAKAALAAAETRENVLIDRIREVL* |
| Ga0114979_103007462 | 3300009180 | Freshwater Lake | MIDILPEETTHDQLLNRVRSLARQLAEAKAALAASEARENDLIDRIRAGL* |
| Ga0114979_104762482 | 3300009180 | Freshwater Lake | VIEILPEESIHEQLLNRVRSLARQLAEAKAALAASEARENDLIDRI |
| Ga0114974_100093933 | 3300009183 | Freshwater Lake | MIEILPEQSTHEQLLNRVRSLARQLAEAKAALAASEARENDLIDRIRSGL* |
| Ga0114974_100280948 | 3300009183 | Freshwater Lake | VIEILPQQSTQEQLLNRVRSLARELAEAKAALAAAEGRENDLIERMRPGL* |
| Ga0114974_101760982 | 3300009183 | Freshwater Lake | VIEILAEQSTHEQLLNRVRSLARELAEAKAALAAAEGREKDLIERMRPGL* |
| Ga0114976_101911032 | 3300009184 | Freshwater Lake | VIEILPDQTTHEQLLNRVRSLARELAEAKAALAAAETRENDLIDRIRAGL* |
| Ga0114972_106925862 | 3300009187 | Freshwater Lake | MIEILPEQSTHEQLLNRVRSLARQLAEAKAALAASEARENDLIDRIRGGL* |
| Ga0114964_102399301 | 3300010157 | Freshwater Lake | MIEILPDQTTHEQLLNRVRSLARELAEAKAALAAAETRENDLID |
| Ga0114967_102413683 | 3300010160 | Freshwater Lake | MIEVLPEETTHDQLLNRVRSLARQLAEAKAALAAAEGRENDLIDRIRGGL* |
| Ga0133913_121043462 | 3300010885 | Freshwater Lake | MIEILPDQTTHEQLLNRVRSLARELAEAKAALAAAETRENFLIDRIREGL* |
| Ga0139557_10656021 | 3300011010 | Freshwater | ETTHEQLLNRVRSLARQLAEAKAALAASEARENDLIDRIRGGL* |
| Ga0151517_110712 | 3300011113 | Freshwater | VIEVLPEQSTHEQLLNRVRALARELAEAKAALAAAEGRENDLIDRIRSGL* |
| Ga0151515_1087219 | 3300011114 | Freshwater | MIDILPDQTTHEQLLNRVRALARELAEAKAALAAAETRENVLIDRIREGL* |
| Ga0153800_10228352 | 3300011995 | Freshwater | MIEILPEQSTHEQLLNRVRSLARELAEAKAALAAAEGRENDLIDRMRPGL* |
| Ga0119951_11182851 | 3300012000 | Freshwater | MIEILPEQSTYQQLLDRVRSLARQLAEARAALAASEARENDLIDRLREGL* |
| Ga0164294_100141017 | 3300013006 | Freshwater | VIEILPEQSTHEQLLNRVRSLARELAEAKAALAAAEGRENNLIDRIRAGL* |
| Ga0177922_103999121 | 3300013372 | Freshwater | EQLLNRVRSLARELAEAKAALAAAEGRENDLIDRMRPGL* |
| Ga0181364_10293371 | 3300017701 | Freshwater Lake | MIEVLPEETTNEQLLNRVRSLARQLAEAKAALAASEARENDL |
| Ga0181347_10453503 | 3300017722 | Freshwater Lake | MIELLPDETTHDQLLNRVRSLARQLAEAKAALAASEARENDLIDRIRSGL |
| Ga0181347_10579261 | 3300017722 | Freshwater Lake | RCRMIEVLPEETTHEQLLNRVRSLARQLAEAKAALAASEARENDLIDRIRGGL |
| Ga0181347_11638402 | 3300017722 | Freshwater Lake | IEVLPEETTHDQLLNRVRSLARQLAEAKAALAAAEGRENDLIDRIRGGL |
| Ga0181365_10213561 | 3300017736 | Freshwater Lake | VIEILPEQSTDEQLLNRVRSLARELAEAKAALAASEARENDLIDRIRGGL |
| Ga0181365_11195642 | 3300017736 | Freshwater Lake | VIEILPEQSTQEQLLNRVRSLARELAEAKAALAASEAREND |
| Ga0181365_11570892 | 3300017736 | Freshwater Lake | MIEVLPEETTHEQLLNRVRSLARQLAEAKAALAASEARENDLMDRIRSGL |
| Ga0181356_10895012 | 3300017761 | Freshwater Lake | MIEILPEQSTHEQLLNRVRSLARELAEAKAALAAAEGRENDLIERMRLGL |
| Ga0181356_11346183 | 3300017761 | Freshwater Lake | VLPEETTHDQLLNRVRSLARQLAEAKAALAASEARENDLIDRIRGGL |
| Ga0181356_11940632 | 3300017761 | Freshwater Lake | LNRVRSLARQLAEAKAALAASEARENDLINRIRSGL |
| Ga0181343_11469502 | 3300017766 | Freshwater Lake | MIEVLPDETTHDQLLNRVRSLARQLAEAKSALAASEARENDLIDRIRGGL |
| Ga0181358_11501513 | 3300017774 | Freshwater Lake | AVIEILPEQSTHEQLLNRVRSLARELAEAKAALAAAEGRENDLIERMRLGL |
| Ga0181358_11761011 | 3300017774 | Freshwater Lake | MIEVLPDETTHEQLLNRVRSLARQLAEAKAALAASEARENDLIDRI |
| Ga0181358_11782292 | 3300017774 | Freshwater Lake | MIEVLPDETTHDQLLNRVRSLARQLAEAKAALAASEARENDLIDR |
| Ga0181358_12278282 | 3300017774 | Freshwater Lake | LKSTTRVRCRMIELLPEETTHDQLLNRVRSLARQLVEAKAALAASEARENDLIDRIRSGL |
| Ga0181357_10253691 | 3300017777 | Freshwater Lake | ETTHDQLLNRVRSLARQLAEAKAALAASESRENDLIDRIRGGL |
| Ga0181357_11680482 | 3300017777 | Freshwater Lake | MIEVLADETTHDQLLNRVRSLARQLAEAKAALAASEARENDLIDRIRSGL |
| Ga0181349_10950513 | 3300017778 | Freshwater Lake | MIEILPEQSTHEQLLNRVRSLARELAEAKAALAAAEGRENDLIERM |
| Ga0181346_11174343 | 3300017780 | Freshwater Lake | MIEVLPDETTHDQLLNRVRSLARQLAEAKAALAASEARENDL |
| Ga0181348_13035302 | 3300017784 | Freshwater Lake | CRMIEVLPDETTHDQLLNRVRSLARQLAEAKAALAASEARENDLIDRIRGGL |
| Ga0181355_10269051 | 3300017785 | Freshwater Lake | NRVRSLARQLAEAKAALAASEARENDLIDRIRGGL |
| Ga0181355_13108791 | 3300017785 | Freshwater Lake | VIEILPEQSTQEQLLNRVRSLARELAEAKAALAASEAREN |
| Ga0187842_12079972 | 3300018790 | Freshwater | MIEVLPEETTHDQLLNRVRSLARELAEAKAALAAAEGRENDLIDRIRAGL |
| Ga0187845_12820672 | 3300018815 | Freshwater | CRMIEVLPEETTHDQLLNRVRSLARQLAEAKAALAASEARENDLIDRIRGGL |
| Ga0187845_12893912 | 3300018815 | Freshwater | MIEVLPEETTHDQLLNRVRSLIRELAEAKAALAASEGRENDLIDRIRTRL |
| Ga0187844_100773371 | 3300018868 | Freshwater | RCRMIEVLPEETTHDQLLNRVRSLARQLAEAKAALAASEARENDLIDRIRSGL |
| Ga0187844_102662481 | 3300018868 | Freshwater | STTRVRCRMIEVLPEETTHDQLLNRVRSLARQLAEAKAALAASEARENDLIDRIRGGL |
| Ga0187844_104243461 | 3300018868 | Freshwater | STTRGRCRMIEVLPEETTHDQLLNRVRSLTRELAEAKAALAASEARENDLIDRIRGGL |
| Ga0187843_100520092 | 3300019093 | Freshwater | MIEVLPEETTHDQLLNRVRSLTRELAEAKAALAASEARENDLIDRIRGGL |
| Ga0181359_10027357 | 3300019784 | Freshwater Lake | MIEVLPDETTHDQLLNRVRSLARQLAEAKAALAASEARENDLIDRIRGGL |
| Ga0181359_101154210 | 3300019784 | Freshwater Lake | RSTTRARCRMIEVLPDETTHDQLLNRVRSLARQLAEAKAALAASEARENDLIDRIRGGL |
| Ga0181359_10326233 | 3300019784 | Freshwater Lake | MIEVLPEETTHEQLLNRVRSLARQLAEAKAALAASEARENDLIDRIRGGL |
| Ga0181359_10442834 | 3300019784 | Freshwater Lake | MIEVLPEETTHDQLLNRVRSLARQLAEAKAALAASEARENDLIDRIRGGL |
| Ga0181359_10613271 | 3300019784 | Freshwater Lake | HDQLLNRVRSLARQLAEAKAALAASEARENDLINRIRSGL |
| Ga0181359_10811293 | 3300019784 | Freshwater Lake | MIELLPEETTHDQLLNRVRSLARQLAEAKAALAASEARENDLIDRIRGGL |
| Ga0181359_12070131 | 3300019784 | Freshwater Lake | MIEVLPDETTHEQLLNRVRSLARQLAEAKAALAASEARENDLIDRIRGGL |
| Ga0181359_12317162 | 3300019784 | Freshwater Lake | SDETTHDQLLNRVRSLARQLAEAKAALAASEARENDLIDRIRSGL |
| Ga0181359_12502022 | 3300019784 | Freshwater Lake | VIEILPEQSTQEQLLNRVRSLARELAEAKAALAASEARENDLMDRIRSGL |
| Ga0181359_12505701 | 3300019784 | Freshwater Lake | MIEVLSDETTHDQLLNRVRSLARQLAEAKAALAASEARENDLIDL |
| Ga0208485_10791161 | 3300020573 | Freshwater | HDQLLNRVRSLARQLAEAKAALAASEARENDLIDRIRSGL |
| Ga0213920_11117592 | 3300021438 | Freshwater | MIEILPDQTTHEQLLNRVRSLARELAEAKAALAAAETRENDLIDRIRAGL |
| Ga0194048_100627082 | 3300021519 | Anoxic Zone Freshwater | VIEILAEQSTHEQLLNRVRSLARELAEAKAALAASEARENDLIDRIRSGL |
| Ga0194048_101113412 | 3300021519 | Anoxic Zone Freshwater | MIQILPDQTTHEQLLNRVRSLARELAEAKAALAAAETRENDLMDRIRAGL |
| Ga0194048_101519053 | 3300021519 | Anoxic Zone Freshwater | EQLLNRVRSLARELAEAKAALAAAETRENILIDRIREGM |
| Ga0194048_102767942 | 3300021519 | Anoxic Zone Freshwater | VIEILPEQSTHEQLLNRVRSLARELAEAKAALAAAEGRENDLIDRMRLGL |
| Ga0194048_103314742 | 3300021519 | Anoxic Zone Freshwater | VIEVLPEQSTHEQLLNRVRSLARELAEAKAALAAAEGRENDLIDRIRAGL |
| Ga0222713_1001128010 | 3300021962 | Estuarine Water | VIEVLPDETTHEQLLNRVRSLARELAEAKAALAAAEGRENDLIDRIRSGL |
| Ga0222713_103384083 | 3300021962 | Estuarine Water | VIEILPEQSTHEQLLNRVRSLARELAEAKAALAAAEGRENDLIDRIRAGL |
| Ga0222712_1000149111 | 3300021963 | Estuarine Water | MIEILPEQSTHEQLLNRVRSLARELAEAKAALAAAEGRENDLIDRIRAGL |
| Ga0222712_103823752 | 3300021963 | Estuarine Water | VIEILPDQTTHEQLLNRVRALARELAEAKAALAAAETRENVLIDRIREGL |
| Ga0222712_107933011 | 3300021963 | Estuarine Water | RMIEILAEQSTYQQLLDRVRSLARQLAEARAALAASEARENDLIDRMREGL |
| Ga0181354_10128986 | 3300022190 | Freshwater Lake | MIEVLSDETTHDQLLNRVRSLARQLAEAKAALAASEARENDLIDRIRSGL |
| Ga0181354_10179913 | 3300022190 | Freshwater Lake | MIEVLPEETTPDQLLNRVRSLARQLAEAKAALAASEARENDLIDRIRGGL |
| Ga0181354_10967012 | 3300022190 | Freshwater Lake | VIEILPEQSTHEQLLNRVRSLARELAEAKAALAAAEGRENDLIERMRLGL |
| Ga0181354_11149852 | 3300022190 | Freshwater Lake | MIEVLPDETTHDQLLNRVRSLARQLAEAKAALAASEARENDLIDRS |
| Ga0181354_11834153 | 3300022190 | Freshwater Lake | PEETTHDQLLNRVRSLARQLAEAKAALAASEARENDLIDRIRGGL |
| Ga0228703_10835621 | 3300022747 | Freshwater | MIEILPDQTTHEQLLNRVRALARELAEAKAALAAAETRENDLIDRIRAGL |
| Ga0214917_100132279 | 3300022752 | Freshwater | VIEILPDQTTHEQILNRVRSLARELAEAKAALAAAETRENDLIDRIRAGL |
| Ga0214917_100196082 | 3300022752 | Freshwater | VIELLPEQSTHEQLLNRVQSLARQLAEAKAALAASEARENDLIDRIRSGL |
| Ga0214917_100222726 | 3300022752 | Freshwater | MIQILPEQTTQEQLLNRVRSLARELAEAKAALAAAETRENDLIDRIRAGL |
| Ga0214917_100264779 | 3300022752 | Freshwater | VIEILPEQSTHEQLLNRVRSLARELAEAKAALAAAEGRENDLIERMRPGL |
| Ga0214917_100351202 | 3300022752 | Freshwater | VIEILPDETTHEQLLNRVKTLIRELAEAKAALAAAETRENDLIHRIRSGL |
| Ga0214917_100490197 | 3300022752 | Freshwater | MIEILPEQSTYQQLLDRVRSLARQLAEARAALAASEARENDLIDRMREGL |
| Ga0214917_100555901 | 3300022752 | Freshwater | RGRCAVIEILPEQSTHEQLLNRVRSLARELAEAKAALAAAEGRENDLIERMRPGL |
| Ga0214917_100812933 | 3300022752 | Freshwater | VIEILPDETTHEQLLNRVKTLTRELAEAKAALAAAETRENDLIYRIRSGL |
| Ga0214917_100976472 | 3300022752 | Freshwater | VIEIFPEQSTHEQLLNRVRSLARELAEAKAALAAAEGRENDLIDRIRAGL |
| Ga0214917_101157604 | 3300022752 | Freshwater | VIEVLPEQSTHEQLLNRVRSLARELAEAKAALAAAEGRENDLIDRKGAGL |
| Ga0214917_101170225 | 3300022752 | Freshwater | MIEILPEHSTYQQLLDRVRSLARQLAEARAALAASEARENDLIDRMREGL |
| Ga0214917_101978832 | 3300022752 | Freshwater | MIEVLPEETTHEQLLNRVRSLARELAEAKAALAAAEGRENDLIDRIRSGL |
| Ga0214917_102005323 | 3300022752 | Freshwater | VIEILPEQSTYQQLLDRVRSLARQLAEARAALAASEARENDLIDRLREGL |
| Ga0214917_102421802 | 3300022752 | Freshwater | VIEILPEQSAHEQLLNRVRSLARVLAEAKAALAAAEGRENDLIDRIRAGL |
| Ga0214917_102945681 | 3300022752 | Freshwater | EQLLNRVRSLARQLAEAKAALAASEARENDLIDRIRAGL |
| Ga0214917_104257942 | 3300022752 | Freshwater | VIEILPEQSTHEQLLNRVRSLARELAEAKAALAASEARENDLIDRIRSGL |
| Ga0214921_100101462 | 3300023174 | Freshwater | MIEVLPDETTHDQLLNRVRSLARELAEAKAALAASEARENDLIDRIRSGL |
| Ga0214921_100181342 | 3300023174 | Freshwater | VIEILPEQSTHEQLLNRVRSLARQLAEAKAALAASEARENDLIDRIRGGL |
| Ga0214921_1002328013 | 3300023174 | Freshwater | MIEILPEQSTYQQLLDRVRSLARQLAEARAALAASEARENDLIDRMRDGL |
| Ga0214921_100362312 | 3300023174 | Freshwater | MIEVLPEETTHEQLLNRVRSLARQLAEAKAALAASEARENDLIDRIRSGL |
| Ga0214921_100430072 | 3300023174 | Freshwater | VIEILPEQSTHEQLLNRVRSLARELAEAKAALAAAEGRENDLIDRMRPGL |
| Ga0214921_100895923 | 3300023174 | Freshwater | MIEVLPEETTHDQLLNRVRSLARQLAEAKAALAAAEGRENDLIDRIRGGL |
| Ga0214921_101228142 | 3300023174 | Freshwater | VIEVLPEETTHDQLLNRVRSLARELAEAKAALAAAEGRENDLIDRIRAGL |
| Ga0214921_102372783 | 3300023174 | Freshwater | MIEILPEQSTHEQLLNRVRSLARELAEAKAALAAAEGRENDLIERMRPGL |
| Ga0214923_100363189 | 3300023179 | Freshwater | VIEILPDETTHEQLLNRVKTLTRELAEAKAALAAAETRENDLIHRIRSGL |
| Ga0214923_102009991 | 3300023179 | Freshwater | VIEVLPEQSTHEQLLNRVRSLARELAEAKAALAAAEGRENDLIDRMRP |
| Ga0208916_100072909 | 3300025896 | Aqueous | MIEVLPDETTHDQLLNRVRSLARQLAEAKAALAASEARENDLIDRIRSGL |
| Ga0208009_10011826 | 3300027114 | Deep Subsurface | VIEILPEQSTQEQLLNRVRSLARELAEAKAALAAAEGRENDLIDRIRSGL |
| Ga0209867_10468162 | 3300027393 | Sand | VIEILPEQSTHDQLLNRVRSLARQLAEAKAALAASEARENDLIDRIRSGL |
| Ga0209867_10801402 | 3300027393 | Sand | LNRVRSLARQLAEAKAALAASEARENDLIDRIRSGL |
| Ga0208974_100014014 | 3300027608 | Freshwater Lentic | VIEILPEQSTQEQLLNRVRSLARELAEAKAALAAAEGRENDLIDRIRAGL |
| Ga0209357_10840641 | 3300027656 | Freshwater Lake | MIEVLPDETTHDQLLNRVRSLARQLAEAKAALAASEAREN |
| Ga0209357_10904311 | 3300027656 | Freshwater Lake | ETTHDQLLNRVRSLARQLAEAKAALAASEARENDLIDRIRGGL |
| Ga0209499_10274205 | 3300027712 | Freshwater Lake | MIEILPEQTTYQQLLDRVRSLARQLAEARAALAASEARENDLIDRMREGL |
| Ga0209499_12915162 | 3300027712 | Freshwater Lake | VIEILPEQSTHEQLLNRVRSLARELAEAKAALAAAEGRENNLIERIRAGL |
| (restricted) Ga0247833_10446791 | 3300027730 | Freshwater | DQLIERVRSLSSQLAEAKAALAASENRENTLMDRMRSGL |
| Ga0209297_10062873 | 3300027733 | Freshwater Lake | VIEILPDQTTHEQLLNRVRSLARELAEAKAALAAAETRENVLIDRIREGL |
| Ga0209297_12442892 | 3300027733 | Freshwater Lake | MIEVLPEETTHDQLLNRVRSLARQLAEAKAALAASEARENDLMD |
| Ga0209087_100311311 | 3300027734 | Freshwater Lake | MIEVLPEETTHDQLLNRVRSLARQLAEAKAALAASEARENDLMDRIRSGL |
| Ga0209087_100356412 | 3300027734 | Freshwater Lake | RCVVIEILPDQTTHEQLLNRVRSLARELAEAKAALAAAETRENNLIDRIRAGL |
| Ga0209087_10190583 | 3300027734 | Freshwater Lake | VIEILPQQSTQEQLLNRVRSLARELAEAKAALAAAEGRENDLIERMRPGL |
| Ga0209087_12026732 | 3300027734 | Freshwater Lake | VIEVLAEQSTHEQLLNRVRSLARELAEAKAALAAAEGRENDLIDRIRAGL |
| Ga0209190_12123921 | 3300027736 | Freshwater Lake | VIEILPEQSTHEQLLNRVRSLARELAEAKAALAASEARENDLIDRIRGGL |
| Ga0209190_13884511 | 3300027736 | Freshwater Lake | PEQSTHEQLLNRVRSLARELAEAKAALAAAEGRENDLIERIRSGL |
| Ga0209085_10110518 | 3300027741 | Freshwater Lake | MIEILPDQTTHEQLLNRVRSLARELAEAKAALTAAETRENVLIDRIREGL |
| Ga0209085_10256885 | 3300027741 | Freshwater Lake | MIEILPDQTTHEQLINRVRSLARELAEAKAALAAAETRENVLIDRIREGL |
| Ga0209085_10325542 | 3300027741 | Freshwater Lake | MIEILPDQTTHEQLLNRVRSLARELAEAKAALAAAETRENNLIDRIRAGL |
| Ga0209085_11367723 | 3300027741 | Freshwater Lake | STTRVRCRMIEVLPEETTQDQLLNRVRSLARQLAEAKAALAASEARENDLIDRIRGGL |
| Ga0209085_12753592 | 3300027741 | Freshwater Lake | MIEVLPEQSTYQQLLDRVRSLARQLAEARAALAASEARENDLIDRMREGL |
| Ga0209596_10884511 | 3300027754 | Freshwater Lake | MIEILPEQSTHEQLLNRVRSLARELAEAKAALAAAEGRENDLIDRMRPGL |
| Ga0209296_10785593 | 3300027759 | Freshwater Lake | MIEILPEQSTHEQLLNRVRSLARQLAEAKAALAASEARENDLIDRIRSGL |
| Ga0209296_13581101 | 3300027759 | Freshwater Lake | VLAEQSTHEQLLNRVRSLARELAEAKAALAAAEGRENDLIDRIRAGL |
| Ga0209598_100147342 | 3300027760 | Freshwater Lake | VIEILPEQSTQEQLLNRVRSLARELAEAKAALAASEARENDLIDRIRAGL |
| Ga0209598_100284512 | 3300027760 | Freshwater Lake | VIEVLPEQSTHEQLLNRVRSLARELAEAKAALAAAEGRENNLIERIRAGL |
| Ga0209598_100621383 | 3300027760 | Freshwater Lake | MIEILPEQSTNEQLLNRVRSLARELAEAKAALAAAEGRENDLIERMRPGL |
| Ga0209598_100861183 | 3300027760 | Freshwater Lake | MVEEVRPAGGCVVIEILPDQTTHEQLLNRVRSLARELAEAKAALAAAETRENVLIDRIREGL |
| Ga0209598_101053972 | 3300027760 | Freshwater Lake | VIEILPEQSTHEQLLNRVRSLARQLAEAKAALAAAEGRENDLIERIRAGL |
| Ga0209088_1000252720 | 3300027763 | Freshwater Lake | VIEILAEQSTHEQLLNRVRSLARELAEAKAALAAAEGRENDLIERMRPGL |
| Ga0209088_100515181 | 3300027763 | Freshwater Lake | VIEILPEESIHEQLLNRVRSLARQLAEAKAALAASEAREND |
| Ga0209086_100681461 | 3300027770 | Freshwater Lake | VVIEILPEQSTHEQLLNRVRSLARELAEAKAALAAAEGRENDLIDRIRSGL |
| Ga0209086_103494612 | 3300027770 | Freshwater Lake | VIEILPEQSTNEQLLNRVRSLARELAEAKAALAAAEGRENDLIDRMRPGL |
| Ga0209500_100850972 | 3300027782 | Freshwater Lake | VIEILPEQSTHEQLLNRVRSLARELAEAKAALAAAEGRENDLMDRIRAGL |
| Ga0209246_101560452 | 3300027785 | Freshwater Lake | MIEVVPEETTHDQLLNRVRSLARQLAEAKAALAASEARENDLINRIRSGL |
| Ga0209400_100617410 | 3300027963 | Freshwater Lake | MIEILPEQSTNEQLLNRVRSLARELAEAKAALAAAEGRENDLIDRIRGGL |
| Ga0209400_10076419 | 3300027963 | Freshwater Lake | MIEVLPEETTQDQLLNRVRSLARQLAEAKAALAASEARENDLMDRIRSGL |
| Ga0209400_11815863 | 3300027963 | Freshwater Lake | STTRERCVVIEILPDQTTHEQLLNRVRSLARELAEAKAALAAAETRENVLIDRIREGL |
| Ga0209401_100029747 | 3300027971 | Freshwater Lake | VIEVLPEESIHEQLLNRVRSLARQLAEAKAALAASEARENDLIDRIRGGL |
| Ga0209401_100032010 | 3300027971 | Freshwater Lake | VIEILPEQSTHEQLLNRVRSLARELAEAKSALAAAEGRENNLIERIRAGL |
| Ga0209401_100034443 | 3300027971 | Freshwater Lake | VIEVLPEQSTHEQLLNRVRSLARELAEAKAALVAAEGRENDLIDRIRAGL |
| Ga0209401_100337910 | 3300027971 | Freshwater Lake | MIEILPEQSTHEQLLDRVRSLARQLAEARAALAASEARENDLIDRMREGL |
| Ga0209401_100393512 | 3300027971 | Freshwater Lake | VIEILPDQTTHEQLLNRVRSLARELAEAKAALAVAETRENVLIDRIREGL |
| Ga0209401_10071218 | 3300027971 | Freshwater Lake | VIEILPEQTTHEQLLNRVRSLARELAEAKAALAAAETRENVLIDRIREGL |
| Ga0209298_1000191011 | 3300027973 | Freshwater Lake | VIELLPEQSTHEQLLNRVRSLARELAEAKAALAAAEGRENDLIDRIRAGL |
| Ga0209298_1000359914 | 3300027973 | Freshwater Lake | MIEILPEQSTHEQLLNRVRSLARELAEAKAALAAAEVRENDLIERMRPGL |
| Ga0209298_101164212 | 3300027973 | Freshwater Lake | VIEILPEQTTHEQLLNRVRSLARELAEAKAALAAAEGRENDLIDRIRAGL |
| Ga0209298_101334883 | 3300027973 | Freshwater Lake | HDQLLNRVRSLARQLAEAKAALAASEARENDLIDRIRAGL |
| Ga0209299_10261626 | 3300027974 | Freshwater Lake | VIDILPEETTHDQLLNRVRSLARQLAEAKAALAASEARENDLIDRIRAGL |
| (restricted) Ga0247832_11000701 | 3300028557 | Freshwater | DSLVIDQLIERVRSLSSQLAEAKAALAASENRENTLMDRMRSGL |
| Ga0315291_102370972 | 3300031707 | Sediment | MIELLPEETTHEQLLNRVRSLARELAEAKAALAAAEGRENDLIDRIRGGL |
| Ga0315291_103682832 | 3300031707 | Sediment | MIEVLPEETTHEQLLNRVRSLARELAEAKAALAASESRENDLIDRIRGGL |
| Ga0315291_105207892 | 3300031707 | Sediment | MIEVLPEETTYEQLLNRVRSLARQLAEAKAALAASESRENDLIDRIRGGL |
| Ga0315291_106847474 | 3300031707 | Sediment | HEQLLNRVRSLARQLAEAKAALAASESRENDLIDRIRGGL |
| Ga0315293_108525202 | 3300031746 | Sediment | MIEVLPEETTHEQLLNRVRSLARELAEAKAALAAAEGRENDLIDRIRGGL |
| Ga0315294_104264783 | 3300031952 | Sediment | MIELLPEETTHEQLLNRVRSLARQLAEAKAALAASESRENDLIDRIRGGL |
| Ga0315278_108025523 | 3300031997 | Sediment | LPEETTHEQLLNRVRSLARQLAEAKAALAASESRENDLIDRIRGGL |
| Ga0315274_114327502 | 3300031999 | Sediment | MIEVLPEETTHDQLLNRVRSLARQLAEAKAALAASESRENDLIDRIRGGL |
| Ga0315284_104621757 | 3300032053 | Sediment | ALPEETTHEQLLNRVRSLARELAEAKAALAAAEGRENDLIDRIRGGL |
| Ga0315271_109038382 | 3300032256 | Sediment | MIELLPEETTREQLLNRVRSLARQLAEAKAALAASESRENDLIDRIRGGL |
| ⦗Top⦘ |