| Basic Information | |
|---|---|
| Family ID | F016930 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 243 |
| Average Sequence Length | 41 residues |
| Representative Sequence | MRPSRGMGDINPSKMPGKKTIKRKDDPNKVAMYAEGGK |
| Number of Associated Samples | 167 |
| Number of Associated Scaffolds | 243 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 95.00 % |
| % of genes near scaffold ends (potentially truncated) | 87.24 % |
| % of genes from short scaffolds (< 2000 bps) | 86.42 % |
| Associated GOLD sequencing projects | 154 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.20 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (56.790 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (26.749 % of family members) |
| Environment Ontology (ENVO) | Unclassified (77.366 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (72.428 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 4.55% β-sheet: 0.00% Coil/Unstructured: 95.45% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.20 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 243 Family Scaffolds |
|---|---|---|
| PF10124 | Mu-like_gpT | 2.47 |
| PF12218 | End_N_terminal | 0.82 |
| PF00205 | TPP_enzyme_M | 0.41 |
| PF13715 | CarbopepD_reg_2 | 0.41 |
| PF00004 | AAA | 0.41 |
| PF13884 | Peptidase_S74 | 0.41 |
| PF13392 | HNH_3 | 0.41 |
| PF00583 | Acetyltransf_1 | 0.41 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 56.79 % |
| All Organisms | root | All Organisms | 43.21 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000405|LV_Brine_h2_0102DRAFT_1065807 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 587 | Open in IMG/M |
| 3300001282|B570J14230_10059054 | All Organisms → Viruses → Predicted Viral | 1246 | Open in IMG/M |
| 3300001605|Draft_10171144 | Not Available | 1360 | Open in IMG/M |
| 3300001850|RCM37_1074836 | Not Available | 1154 | Open in IMG/M |
| 3300001850|RCM37_1225011 | Not Available | 634 | Open in IMG/M |
| 3300001968|GOS2236_1008371 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1593 | Open in IMG/M |
| 3300002195|metazooDRAFT_1219166 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 630 | Open in IMG/M |
| 3300002212|metazooDRAFT_1352637 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 563 | Open in IMG/M |
| 3300002303|B570J29644_1007027 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 726 | Open in IMG/M |
| 3300002835|B570J40625_101020319 | Not Available | 705 | Open in IMG/M |
| 3300003375|JGI26470J50227_1000684 | Not Available | 13285 | Open in IMG/M |
| 3300003375|JGI26470J50227_1025347 | Not Available | 1242 | Open in IMG/M |
| 3300003375|JGI26470J50227_1065151 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 595 | Open in IMG/M |
| 3300003411|JGI25911J50253_10179313 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 594 | Open in IMG/M |
| 3300003412|JGI25912J50252_10038951 | All Organisms → Viruses → Predicted Viral | 1374 | Open in IMG/M |
| 3300003789|Ga0007835_1006839 | Not Available | 1096 | Open in IMG/M |
| 3300003804|Ga0007817_1010311 | Not Available | 637 | Open in IMG/M |
| 3300003805|Ga0007838_1010601 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
| 3300003809|Ga0007869_1004530 | Not Available | 1668 | Open in IMG/M |
| 3300003809|Ga0007869_1016218 | All Organisms → cellular organisms → Bacteria | 686 | Open in IMG/M |
| 3300003813|Ga0007879_1019622 | Not Available | 697 | Open in IMG/M |
| 3300003814|Ga0007877_1034651 | Not Available | 529 | Open in IMG/M |
| 3300003815|Ga0007856_1011540 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 587 | Open in IMG/M |
| 3300003820|Ga0007863_1006997 | Not Available | 1154 | Open in IMG/M |
| 3300004095|Ga0007829_10020183 | All Organisms → Viruses → Predicted Viral | 1280 | Open in IMG/M |
| 3300004095|Ga0007829_10115998 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 552 | Open in IMG/M |
| 3300004686|Ga0065173_1084729 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 570 | Open in IMG/M |
| 3300004777|Ga0007827_10122425 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 582 | Open in IMG/M |
| 3300004807|Ga0007809_10019826 | All Organisms → Viruses → Predicted Viral | 2369 | Open in IMG/M |
| 3300005581|Ga0049081_10067775 | All Organisms → Viruses → Predicted Viral | 1342 | Open in IMG/M |
| 3300005582|Ga0049080_10225367 | Not Available | 616 | Open in IMG/M |
| 3300006030|Ga0075470_10001147 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8264 | Open in IMG/M |
| 3300006030|Ga0075470_10001256 | Not Available | 7922 | Open in IMG/M |
| 3300006071|Ga0007876_1029921 | Not Available | 1507 | Open in IMG/M |
| 3300006072|Ga0007881_1066083 | Not Available | 924 | Open in IMG/M |
| 3300006100|Ga0007806_1002551 | Not Available | 5223 | Open in IMG/M |
| 3300006100|Ga0007806_1008405 | All Organisms → Viruses → Predicted Viral | 2512 | Open in IMG/M |
| 3300006100|Ga0007806_1037019 | Not Available | 962 | Open in IMG/M |
| 3300006113|Ga0007858_1060597 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 801 | Open in IMG/M |
| 3300006114|Ga0007815_1117208 | Not Available | 507 | Open in IMG/M |
| 3300006115|Ga0007816_1069693 | Not Available | 782 | Open in IMG/M |
| 3300006118|Ga0007859_1022573 | Not Available | 1379 | Open in IMG/M |
| 3300006118|Ga0007859_1108303 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 551 | Open in IMG/M |
| 3300006119|Ga0007866_1061962 | Not Available | 701 | Open in IMG/M |
| 3300006127|Ga0007805_1032136 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1189 | Open in IMG/M |
| 3300006127|Ga0007805_1127553 | Not Available | 544 | Open in IMG/M |
| 3300006875|Ga0075473_10037130 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 1876 | Open in IMG/M |
| 3300007363|Ga0075458_10267870 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 519 | Open in IMG/M |
| 3300008117|Ga0114351_1174856 | Not Available | 1152 | Open in IMG/M |
| 3300008120|Ga0114355_1023893 | All Organisms → Viruses → Predicted Viral | 3157 | Open in IMG/M |
| 3300008267|Ga0114364_1065761 | All Organisms → Viruses → Predicted Viral | 1239 | Open in IMG/M |
| 3300008267|Ga0114364_1111992 | Not Available | 828 | Open in IMG/M |
| 3300009068|Ga0114973_10738233 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 500 | Open in IMG/M |
| 3300009081|Ga0105098_10540293 | Not Available | 599 | Open in IMG/M |
| 3300009154|Ga0114963_10235124 | All Organisms → Viruses → Predicted Viral | 1045 | Open in IMG/M |
| 3300009155|Ga0114968_10583484 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 593 | Open in IMG/M |
| 3300009160|Ga0114981_10507847 | Not Available | 644 | Open in IMG/M |
| 3300009164|Ga0114975_10290883 | Not Available | 906 | Open in IMG/M |
| 3300009181|Ga0114969_10370615 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 827 | Open in IMG/M |
| 3300009183|Ga0114974_10418200 | Not Available | 764 | Open in IMG/M |
| 3300009184|Ga0114976_10592436 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 563 | Open in IMG/M |
| 3300009419|Ga0114982_1151226 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium GWB2_41_8 | 717 | Open in IMG/M |
| 3300009502|Ga0114951_10099798 | Not Available | 1653 | Open in IMG/M |
| 3300012691|Ga0157569_1034854 | All Organisms → Viruses → Predicted Viral | 1356 | Open in IMG/M |
| 3300012747|Ga0157564_1032503 | Not Available | 626 | Open in IMG/M |
| 3300012778|Ga0138269_1122438 | All Organisms → Viruses → Predicted Viral | 4134 | Open in IMG/M |
| 3300013004|Ga0164293_10208702 | Not Available | 1405 | Open in IMG/M |
| 3300013093|Ga0164296_1001295 | Not Available | 27017 | Open in IMG/M |
| 3300013093|Ga0164296_1292569 | Not Available | 611 | Open in IMG/M |
| 3300013372|Ga0177922_10511069 | Not Available | 507 | Open in IMG/M |
| 3300015050|Ga0181338_1035621 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 750 | Open in IMG/M |
| 3300017716|Ga0181350_1029450 | Not Available | 1516 | Open in IMG/M |
| 3300017716|Ga0181350_1061667 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 977 | Open in IMG/M |
| 3300017716|Ga0181350_1085691 | Not Available | 792 | Open in IMG/M |
| 3300017716|Ga0181350_1104402 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 693 | Open in IMG/M |
| 3300017716|Ga0181350_1117133 | Not Available | 642 | Open in IMG/M |
| 3300017722|Ga0181347_1040832 | Not Available | 1422 | Open in IMG/M |
| 3300017722|Ga0181347_1085844 | Not Available | 912 | Open in IMG/M |
| 3300017722|Ga0181347_1176422 | Not Available | 572 | Open in IMG/M |
| 3300017736|Ga0181365_1025194 | Not Available | 1500 | Open in IMG/M |
| 3300017736|Ga0181365_1034508 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1277 | Open in IMG/M |
| 3300017736|Ga0181365_1103456 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 688 | Open in IMG/M |
| 3300017736|Ga0181365_1164817 | Not Available | 521 | Open in IMG/M |
| 3300017736|Ga0181365_1175782 | Not Available | 501 | Open in IMG/M |
| 3300017747|Ga0181352_1007045 | Not Available | 3736 | Open in IMG/M |
| 3300017747|Ga0181352_1016866 | All Organisms → Viruses → Predicted Viral | 2294 | Open in IMG/M |
| 3300017747|Ga0181352_1037488 | All Organisms → Viruses → Predicted Viral | 1444 | Open in IMG/M |
| 3300017747|Ga0181352_1047802 | All Organisms → Viruses → Predicted Viral | 1251 | Open in IMG/M |
| 3300017747|Ga0181352_1055863 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1139 | Open in IMG/M |
| 3300017747|Ga0181352_1072631 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 971 | Open in IMG/M |
| 3300017747|Ga0181352_1127431 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 683 | Open in IMG/M |
| 3300017747|Ga0181352_1127624 | Not Available | 683 | Open in IMG/M |
| 3300017747|Ga0181352_1146510 | Not Available | 627 | Open in IMG/M |
| 3300017754|Ga0181344_1091506 | Not Available | 888 | Open in IMG/M |
| 3300017754|Ga0181344_1093692 | Not Available | 875 | Open in IMG/M |
| 3300017754|Ga0181344_1123261 | Not Available | 746 | Open in IMG/M |
| 3300017761|Ga0181356_1042902 | Not Available | 1583 | Open in IMG/M |
| 3300017761|Ga0181356_1146908 | Not Available | 733 | Open in IMG/M |
| 3300017761|Ga0181356_1166169 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 674 | Open in IMG/M |
| 3300017761|Ga0181356_1166531 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 673 | Open in IMG/M |
| 3300017761|Ga0181356_1253300 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 501 | Open in IMG/M |
| 3300017766|Ga0181343_1092114 | Not Available | 864 | Open in IMG/M |
| 3300017766|Ga0181343_1163274 | Not Available | 618 | Open in IMG/M |
| 3300017766|Ga0181343_1214062 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 525 | Open in IMG/M |
| 3300017777|Ga0181357_1067877 | Not Available | 1374 | Open in IMG/M |
| 3300017777|Ga0181357_1072187 | Not Available | 1327 | Open in IMG/M |
| 3300017777|Ga0181357_1156424 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 837 | Open in IMG/M |
| 3300017777|Ga0181357_1214276 | Not Available | 682 | Open in IMG/M |
| 3300017777|Ga0181357_1259737 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 601 | Open in IMG/M |
| 3300017778|Ga0181349_1076356 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1280 | Open in IMG/M |
| 3300017778|Ga0181349_1168118 | Not Available | 777 | Open in IMG/M |
| 3300017780|Ga0181346_1092891 | Not Available | 1178 | Open in IMG/M |
| 3300017780|Ga0181346_1148990 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 877 | Open in IMG/M |
| 3300017780|Ga0181346_1197344 | Not Available | 728 | Open in IMG/M |
| 3300017780|Ga0181346_1241987 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 634 | Open in IMG/M |
| 3300017784|Ga0181348_1117603 | All Organisms → Viruses → Predicted Viral | 1024 | Open in IMG/M |
| 3300017784|Ga0181348_1161320 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 831 | Open in IMG/M |
| 3300017784|Ga0181348_1229385 | Not Available | 652 | Open in IMG/M |
| 3300017785|Ga0181355_1141361 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 976 | Open in IMG/M |
| 3300020048|Ga0207193_1004309 | Not Available | 23347 | Open in IMG/M |
| 3300020074|Ga0194113_10027753 | Not Available | 6004 | Open in IMG/M |
| 3300020220|Ga0194119_10269276 | All Organisms → Viruses → Predicted Viral | 1158 | Open in IMG/M |
| 3300020220|Ga0194119_10799376 | Not Available | 558 | Open in IMG/M |
| 3300020221|Ga0194127_10749415 | Not Available | 607 | Open in IMG/M |
| 3300020519|Ga0208223_1021120 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 902 | Open in IMG/M |
| 3300020560|Ga0208852_1055899 | Not Available | 646 | Open in IMG/M |
| 3300020711|Ga0214237_1025361 | Not Available | 690 | Open in IMG/M |
| 3300020721|Ga0214236_1011610 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1350 | Open in IMG/M |
| 3300020727|Ga0214246_1015171 | Not Available | 1352 | Open in IMG/M |
| 3300021091|Ga0194133_10084382 | Not Available | 2510 | Open in IMG/M |
| 3300021124|Ga0214199_1016583 | Not Available | 823 | Open in IMG/M |
| 3300021131|Ga0214206_1010100 | Not Available | 1362 | Open in IMG/M |
| 3300021141|Ga0214163_1005972 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 4398 | Open in IMG/M |
| 3300021142|Ga0214192_1008708 | Not Available | 4261 | Open in IMG/M |
| 3300021519|Ga0194048_10121290 | Not Available | 996 | Open in IMG/M |
| 3300021952|Ga0213921_1028462 | Not Available | 901 | Open in IMG/M |
| 3300021961|Ga0222714_10050285 | All Organisms → Viruses → Predicted Viral | 2893 | Open in IMG/M |
| 3300021962|Ga0222713_10379369 | Not Available | 876 | Open in IMG/M |
| 3300021963|Ga0222712_10193689 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1337 | Open in IMG/M |
| 3300022179|Ga0181353_1099813 | Not Available | 715 | Open in IMG/M |
| 3300022190|Ga0181354_1058675 | All Organisms → Viruses → Predicted Viral | 1280 | Open in IMG/M |
| 3300022190|Ga0181354_1105593 | Not Available | 915 | Open in IMG/M |
| 3300022190|Ga0181354_1171756 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 665 | Open in IMG/M |
| 3300022190|Ga0181354_1183697 | Not Available | 634 | Open in IMG/M |
| 3300022190|Ga0181354_1190427 | Not Available | 618 | Open in IMG/M |
| 3300022190|Ga0181354_1206000 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 583 | Open in IMG/M |
| 3300022407|Ga0181351_1149185 | Not Available | 843 | Open in IMG/M |
| 3300022407|Ga0181351_1181635 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 723 | Open in IMG/M |
| 3300022407|Ga0181351_1198740 | Not Available | 672 | Open in IMG/M |
| 3300022748|Ga0228702_1119263 | Not Available | 601 | Open in IMG/M |
| 3300024495|Ga0255164_1003617 | All Organisms → Viruses → Predicted Viral | 2897 | Open in IMG/M |
| 3300025357|Ga0208383_1022320 | Not Available | 749 | Open in IMG/M |
| 3300025369|Ga0208382_1031988 | Not Available | 654 | Open in IMG/M |
| 3300025382|Ga0208256_1031442 | Not Available | 762 | Open in IMG/M |
| 3300025383|Ga0208250_1018207 | Not Available | 1210 | Open in IMG/M |
| 3300025383|Ga0208250_1020820 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1104 | Open in IMG/M |
| 3300025389|Ga0208257_1000870 | Not Available | 7868 | Open in IMG/M |
| 3300025390|Ga0208743_1056010 | Not Available | 544 | Open in IMG/M |
| 3300025396|Ga0208874_1044466 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 634 | Open in IMG/M |
| 3300025401|Ga0207955_1038712 | Not Available | 806 | Open in IMG/M |
| 3300025407|Ga0208378_1017236 | Not Available | 1377 | Open in IMG/M |
| 3300025417|Ga0208616_1040347 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 687 | Open in IMG/M |
| 3300025418|Ga0208253_1044052 | Not Available | 776 | Open in IMG/M |
| 3300025421|Ga0207958_1061425 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 529 | Open in IMG/M |
| 3300025426|Ga0208739_1062469 | Not Available | 592 | Open in IMG/M |
| 3300025429|Ga0208500_1036735 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 591 | Open in IMG/M |
| 3300025487|Ga0208105_1063734 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 635 | Open in IMG/M |
| 3300025585|Ga0208546_1000713 | Not Available | 11333 | Open in IMG/M |
| 3300025585|Ga0208546_1004092 | Not Available | 4171 | Open in IMG/M |
| 3300025723|Ga0208741_10080250 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 737 | Open in IMG/M |
| 3300025781|Ga0208386_1020708 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1006 | Open in IMG/M |
| 3300025785|Ga0208498_1005034 | Not Available | 3168 | Open in IMG/M |
| 3300025789|Ga0208499_1028170 | Not Available | 982 | Open in IMG/M |
| 3300025889|Ga0208644_1176595 | Not Available | 952 | Open in IMG/M |
| 3300026573|Ga0255269_1105835 | Not Available | 765 | Open in IMG/M |
| 3300027503|Ga0255182_1038622 | Not Available | 1295 | Open in IMG/M |
| 3300027659|Ga0208975_1120796 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 748 | Open in IMG/M |
| 3300027659|Ga0208975_1161943 | Not Available | 618 | Open in IMG/M |
| 3300027697|Ga0209033_1178795 | Not Available | 645 | Open in IMG/M |
| 3300027708|Ga0209188_1065478 | All Organisms → Viruses → Predicted Viral | 1556 | Open in IMG/M |
| 3300027734|Ga0209087_1272838 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 615 | Open in IMG/M |
| 3300027743|Ga0209593_10231506 | Not Available | 645 | Open in IMG/M |
| 3300027749|Ga0209084_1076904 | Not Available | 1521 | Open in IMG/M |
| 3300027777|Ga0209829_10262113 | Not Available | 722 | Open in IMG/M |
| 3300027785|Ga0209246_10131998 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 981 | Open in IMG/M |
| 3300027805|Ga0209229_10508744 | Not Available | 513 | Open in IMG/M |
| 3300027896|Ga0209777_10298285 | Not Available | 1247 | Open in IMG/M |
| 3300027896|Ga0209777_11048765 | Not Available | 554 | Open in IMG/M |
| 3300028108|Ga0256305_1095295 | Not Available | 720 | Open in IMG/M |
| 3300028392|Ga0304729_1026167 | All Organisms → Viruses → Predicted Viral | 2413 | Open in IMG/M |
| 3300028393|Ga0304728_1095662 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1144 | Open in IMG/M |
| 3300031707|Ga0315291_10877453 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 770 | Open in IMG/M |
| 3300031707|Ga0315291_10942858 | Not Available | 733 | Open in IMG/M |
| 3300031707|Ga0315291_11467301 | Not Available | 539 | Open in IMG/M |
| 3300031772|Ga0315288_11297123 | Not Available | 619 | Open in IMG/M |
| 3300031834|Ga0315290_10506726 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1053 | Open in IMG/M |
| 3300031951|Ga0315904_11225639 | Not Available | 574 | Open in IMG/M |
| 3300031999|Ga0315274_11484014 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 646 | Open in IMG/M |
| 3300032046|Ga0315289_10709106 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 909 | Open in IMG/M |
| 3300032050|Ga0315906_10253333 | All Organisms → Viruses → Predicted Viral | 1616 | Open in IMG/M |
| 3300032053|Ga0315284_10161227 | All Organisms → Viruses | 2941 | Open in IMG/M |
| 3300032092|Ga0315905_10047892 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4340 | Open in IMG/M |
| 3300032092|Ga0315905_10078716 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3335 | Open in IMG/M |
| 3300032092|Ga0315905_10298992 | All Organisms → Viruses → Predicted Viral | 1545 | Open in IMG/M |
| 3300032116|Ga0315903_10280153 | All Organisms → Viruses → Predicted Viral | 1421 | Open in IMG/M |
| 3300032116|Ga0315903_10370935 | All Organisms → Viruses → Predicted Viral | 1177 | Open in IMG/M |
| 3300032116|Ga0315903_10634595 | Not Available | 813 | Open in IMG/M |
| 3300032117|Ga0316218_1287298 | Not Available | 559 | Open in IMG/M |
| 3300032117|Ga0316218_1300295 | Not Available | 543 | Open in IMG/M |
| 3300032156|Ga0315295_12049880 | Not Available | 536 | Open in IMG/M |
| 3300032173|Ga0315268_12194744 | Not Available | 566 | Open in IMG/M |
| 3300032177|Ga0315276_12373816 | Not Available | 533 | Open in IMG/M |
| 3300032177|Ga0315276_12631373 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 501 | Open in IMG/M |
| 3300032562|Ga0316226_1071369 | Not Available | 1713 | Open in IMG/M |
| 3300032579|Ga0316228_1113299 | Not Available | 958 | Open in IMG/M |
| 3300032665|Ga0316221_1031632 | All Organisms → Viruses → Predicted Viral | 2335 | Open in IMG/M |
| 3300032665|Ga0316221_1232337 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
| 3300032676|Ga0316229_1044350 | All Organisms → Viruses → Predicted Viral | 2091 | Open in IMG/M |
| 3300032677|Ga0316227_1132878 | Not Available | 929 | Open in IMG/M |
| 3300032677|Ga0316227_1222763 | Not Available | 651 | Open in IMG/M |
| 3300033482|Ga0316627_101843115 | Not Available | 623 | Open in IMG/M |
| 3300033979|Ga0334978_0281776 | Not Available | 799 | Open in IMG/M |
| 3300033996|Ga0334979_0386520 | Not Available | 776 | Open in IMG/M |
| 3300033997|Ga0310131_098479 | Not Available | 504 | Open in IMG/M |
| 3300034019|Ga0334998_0730268 | Not Available | 525 | Open in IMG/M |
| 3300034060|Ga0334983_0436545 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 747 | Open in IMG/M |
| 3300034061|Ga0334987_0688722 | Not Available | 588 | Open in IMG/M |
| 3300034062|Ga0334995_0074301 | Not Available | 2663 | Open in IMG/M |
| 3300034062|Ga0334995_0628653 | Not Available | 618 | Open in IMG/M |
| 3300034068|Ga0334990_0428338 | Not Available | 710 | Open in IMG/M |
| 3300034071|Ga0335028_0392288 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 795 | Open in IMG/M |
| 3300034092|Ga0335010_0358624 | Not Available | 813 | Open in IMG/M |
| 3300034093|Ga0335012_0241883 | Not Available | 939 | Open in IMG/M |
| 3300034104|Ga0335031_0048690 | All Organisms → Viruses → Predicted Viral | 3058 | Open in IMG/M |
| 3300034104|Ga0335031_0217109 | All Organisms → Viruses → Predicted Viral | 1286 | Open in IMG/M |
| 3300034104|Ga0335031_0605270 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 646 | Open in IMG/M |
| 3300034104|Ga0335031_0633119 | Not Available | 626 | Open in IMG/M |
| 3300034112|Ga0335066_0105095 | All Organisms → Viruses → Predicted Viral | 1779 | Open in IMG/M |
| 3300034120|Ga0335056_0367021 | Not Available | 782 | Open in IMG/M |
| 3300034121|Ga0335058_0077594 | All Organisms → Viruses → Predicted Viral | 1937 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 26.75% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 20.99% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 9.46% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 6.17% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater | 4.94% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 4.94% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 3.70% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 3.29% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 2.88% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 2.06% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 1.65% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 1.65% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 1.65% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 1.23% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 0.41% |
| Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 0.41% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment | 0.41% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 0.41% |
| Hypersaline | Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Unclassified → Hypersaline | 0.41% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.41% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 0.41% |
| Fracking Water | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water | 0.41% |
| Hydrocarbon Resource Environments | Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Hydrocarbon Resource Environments | 0.41% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.82% |
| Lake | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Lake | 0.82% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 0.82% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 0.82% |
| Marine Plankton | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton | 0.82% |
| Freshwater | Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater | 0.82% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000405 | Hypersaline microbial communities from Lake Vida, Antarctica - sample: Brine Hole Two 0.1-0.2 micron | Environmental | Open in IMG/M |
| 3300001282 | Freshwater microbial communities from Lake Mendota, WI - Practice 20APR2010 epilimnion | Environmental | Open in IMG/M |
| 3300001605 | Tailings pond microbial communities from Northern Alberta - Syncrude Mildred Lake Settling Basin | Engineered | Open in IMG/M |
| 3300001850 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM37, ROCA_DNA234_0.2um_Ob_C_2a | Environmental | Open in IMG/M |
| 3300001968 | Marine microbial communities from Lake Gatun, Panama - GS020 | Environmental | Open in IMG/M |
| 3300002195 | Freshwater microbial communities from San Paulo Zoo lake, Brazil - AUG 2013 | Environmental | Open in IMG/M |
| 3300002212 | Freshwater microbial communities from San Paulo Zoo lake, Brazil - JAN 2013 | Environmental | Open in IMG/M |
| 3300002303 | Freshwater microbial communities from Lake Mendota, WI - 07OCT2009 deep hole epilimnion ns | Environmental | Open in IMG/M |
| 3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
| 3300003375 | Freshwater actinobacteria microbial communities from Trout Bog Lake, Wisconsin, USA - enrichment TB-E6 | Environmental | Open in IMG/M |
| 3300003411 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SD | Environmental | Open in IMG/M |
| 3300003412 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DD | Environmental | Open in IMG/M |
| 3300003789 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE28Sep08 | Environmental | Open in IMG/M |
| 3300003804 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE29May09 | Environmental | Open in IMG/M |
| 3300003805 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE27Jun08 | Environmental | Open in IMG/M |
| 3300003809 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH03Jun09 | Environmental | Open in IMG/M |
| 3300003813 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH15Jun09 | Environmental | Open in IMG/M |
| 3300003814 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH12Jul09 | Environmental | Open in IMG/M |
| 3300003815 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH27Jun07 | Environmental | Open in IMG/M |
| 3300003820 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH10Sep07 | Environmental | Open in IMG/M |
| 3300004095 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE03Jun09 | Environmental | Open in IMG/M |
| 3300004686 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE10Oct08 (version 2) | Environmental | Open in IMG/M |
| 3300004777 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE16Jul07 | Environmental | Open in IMG/M |
| 3300004807 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE02Aug07 | Environmental | Open in IMG/M |
| 3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
| 3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
| 3300006030 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006071 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH24Aug09 | Environmental | Open in IMG/M |
| 3300006072 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH12Aug09 | Environmental | Open in IMG/M |
| 3300006100 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE18Aug09 | Environmental | Open in IMG/M |
| 3300006113 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH08Aug08 | Environmental | Open in IMG/M |
| 3300006114 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE02Aug09 | Environmental | Open in IMG/M |
| 3300006115 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE27Jul09 | Environmental | Open in IMG/M |
| 3300006118 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH27Jul07 | Environmental | Open in IMG/M |
| 3300006119 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH18Jul07 | Environmental | Open in IMG/M |
| 3300006127 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE24Aug09 | Environmental | Open in IMG/M |
| 3300006875 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA | Environmental | Open in IMG/M |
| 3300007363 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNA | Environmental | Open in IMG/M |
| 3300008117 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300008120 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-3-NA | Environmental | Open in IMG/M |
| 3300008267 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-100-LTR | Environmental | Open in IMG/M |
| 3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009081 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
| 3300009154 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG | Environmental | Open in IMG/M |
| 3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
| 3300009160 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG | Environmental | Open in IMG/M |
| 3300009164 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG | Environmental | Open in IMG/M |
| 3300009181 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
| 3300009184 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG | Environmental | Open in IMG/M |
| 3300009419 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT | Environmental | Open in IMG/M |
| 3300009502 | Freshwater microbial communities from Finland to study Microbial Dark Matter (Phase II) - AM7a DNA metaG | Environmental | Open in IMG/M |
| 3300012691 | Dystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA - GEODES070 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012747 | Dystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA - GEODES063 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012778 | Freshwater microbial communities from Lake Croche, Canada - C_130208_E_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
| 3300013093 | Dystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA - GEODES057 metaG | Environmental | Open in IMG/M |
| 3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
| 3300015050 | Freshwater viral communities from Lake Michigan, USA - Sp13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017716 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.DCM.D | Environmental | Open in IMG/M |
| 3300017722 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017736 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N | Environmental | Open in IMG/M |
| 3300017747 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.S.N | Environmental | Open in IMG/M |
| 3300017754 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.D | Environmental | Open in IMG/M |
| 3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017766 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D | Environmental | Open in IMG/M |
| 3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017778 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300020048 | Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915 | Environmental | Open in IMG/M |
| 3300020074 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015017 Mahale Deep Cast 200m | Environmental | Open in IMG/M |
| 3300020220 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015018 Mahale Deep Cast 100m | Environmental | Open in IMG/M |
| 3300020221 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015036 Kigoma Deep Cast 100m | Environmental | Open in IMG/M |
| 3300020519 | Freshwater microbial communities from Lake Mendota, WI - 07OCT2009 deep hole epilimnion ns (SPAdes) | Environmental | Open in IMG/M |
| 3300020560 | Freshwater microbial communities from Lake Mendota, WI - 18JUN2009 deep hole epilimnion ns (SPAdes) | Environmental | Open in IMG/M |
| 3300020711 | Freshwater microbial communities from Trout Bog Lake, WI - 29JUL2008 hypolimnion | Environmental | Open in IMG/M |
| 3300020721 | Freshwater microbial communities from Trout Bog Lake, WI - 28JUL2008 hypolimnion | Environmental | Open in IMG/M |
| 3300020727 | Freshwater microbial communities from Trout Bog Lake, WI - 29MAY2009 hypolimnion | Environmental | Open in IMG/M |
| 3300021091 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015055 Kigoma Offshore 40m | Environmental | Open in IMG/M |
| 3300021124 | Freshwater microbial communities from Trout Bog Lake, WI - 04OCT2008 epilimnion | Environmental | Open in IMG/M |
| 3300021131 | Freshwater microbial communities from Trout Bog Lake, WI - 07JUL2009 epilimnion | Environmental | Open in IMG/M |
| 3300021141 | Freshwater microbial communities from Lake Mendota, WI - Practice 15JUN2010 epilimnion | Environmental | Open in IMG/M |
| 3300021142 | Freshwater microbial communities from Trout Bog Lake, WI - 29JUL2008 epilimnion | Environmental | Open in IMG/M |
| 3300021519 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L222-5m | Environmental | Open in IMG/M |
| 3300021952 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 20-17 MG | Environmental | Open in IMG/M |
| 3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
| 3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
| 3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
| 3300022179 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.N | Environmental | Open in IMG/M |
| 3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
| 3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300022748 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 20-17_Aug_MG | Environmental | Open in IMG/M |
| 3300024495 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepA_8d | Environmental | Open in IMG/M |
| 3300025357 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE10Sep07 (SPAdes) | Environmental | Open in IMG/M |
| 3300025369 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE28Sep08 (SPAdes) | Environmental | Open in IMG/M |
| 3300025382 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH22Jun08 (SPAdes) | Environmental | Open in IMG/M |
| 3300025383 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE18Aug09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025389 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH10Sep07 (SPAdes) | Environmental | Open in IMG/M |
| 3300025390 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH04Jul08 (SPAdes) | Environmental | Open in IMG/M |
| 3300025396 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH10Oct08 (SPAdes) | Environmental | Open in IMG/M |
| 3300025401 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE29Jun09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025407 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE24Aug09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025417 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE16Oct07 (SPAdes) | Environmental | Open in IMG/M |
| 3300025418 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE10Oct08 (SPAdes) | Environmental | Open in IMG/M |
| 3300025421 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH27Jul07 (SPAdes) | Environmental | Open in IMG/M |
| 3300025426 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE27Jul09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025429 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE17Sep08 (SPAdes) | Environmental | Open in IMG/M |
| 3300025487 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE16Jul07 (SPAdes) | Environmental | Open in IMG/M |
| 3300025585 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025723 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE03Jun09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025781 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH16Oct07 (SPAdes) | Environmental | Open in IMG/M |
| 3300025785 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE12Aug09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025789 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE07Jul09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025889 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes) | Environmental | Open in IMG/M |
| 3300026573 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepC_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300027503 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_UVDOM_RepA_8d | Environmental | Open in IMG/M |
| 3300027659 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027697 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.DN (SPAdes) | Environmental | Open in IMG/M |
| 3300027708 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027734 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027743 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027749 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027777 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_140205_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027785 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027805 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes) | Environmental | Open in IMG/M |
| 3300027896 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies -HBP12 HB (SPAdes) | Environmental | Open in IMG/M |
| 3300028108 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepB_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300028392 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaG (v2) | Environmental | Open in IMG/M |
| 3300028393 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_MF_MetaG (v2) | Environmental | Open in IMG/M |
| 3300031707 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_20 | Environmental | Open in IMG/M |
| 3300031772 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_20 | Environmental | Open in IMG/M |
| 3300031834 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_0 | Environmental | Open in IMG/M |
| 3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
| 3300031999 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20 | Environmental | Open in IMG/M |
| 3300032046 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_40 | Environmental | Open in IMG/M |
| 3300032050 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122 | Environmental | Open in IMG/M |
| 3300032053 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_16 | Environmental | Open in IMG/M |
| 3300032092 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121 | Environmental | Open in IMG/M |
| 3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
| 3300032117 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18003 | Environmental | Open in IMG/M |
| 3300032156 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G14_0 | Environmental | Open in IMG/M |
| 3300032173 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_top | Environmental | Open in IMG/M |
| 3300032177 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_0 | Environmental | Open in IMG/M |
| 3300032562 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18017 | Environmental | Open in IMG/M |
| 3300032579 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18021 | Environmental | Open in IMG/M |
| 3300032665 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18007 | Environmental | Open in IMG/M |
| 3300032676 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18023 | Environmental | Open in IMG/M |
| 3300032677 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18019 | Environmental | Open in IMG/M |
| 3300033482 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D1_C | Environmental | Open in IMG/M |
| 3300033979 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME30Aug2017-rr0003 | Environmental | Open in IMG/M |
| 3300033996 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004 | Environmental | Open in IMG/M |
| 3300033997 | Fracking water microbial communities from deep shales in Oklahoma, United States - MC-FT7-sol | Environmental | Open in IMG/M |
| 3300034019 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Sep2014-rr0049 | Environmental | Open in IMG/M |
| 3300034060 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16May2013-rr0016 | Environmental | Open in IMG/M |
| 3300034061 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028 | Environmental | Open in IMG/M |
| 3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
| 3300034068 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Apr2016-rr0031 | Environmental | Open in IMG/M |
| 3300034071 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Oct2008D10-rr0110 | Environmental | Open in IMG/M |
| 3300034092 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2012-rr0069 | Environmental | Open in IMG/M |
| 3300034093 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jun2014-rr0072 | Environmental | Open in IMG/M |
| 3300034104 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120 | Environmental | Open in IMG/M |
| 3300034112 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Aug2014-rr0191 | Environmental | Open in IMG/M |
| 3300034120 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2014-rr0172 | Environmental | Open in IMG/M |
| 3300034121 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19May2015-rr0174 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| LV_Brine_h2_0102DRAFT_10658072 | 3300000405 | Hypersaline | MRASRGMGDILPSKMPGKKAVKRKDKPEDVDMYAEGGKVKSKVNEAGNYTKPS |
| B570J14230_100590545 | 3300001282 | Freshwater | MGAIAPSKMPKKKVIRRKDDPNDVDMYAEGGTTKS |
| Draft_101711441 | 3300001605 | Hydrocarbon Resource Environments | VRASRGMGDINPKKRPGAKQIKRKDKPQFVDMYKE |
| RCM37_10748361 | 3300001850 | Marine Plankton | MRSSRGMGDISPSKMPTKKIIHRKDDPNRVDFYKEGGKVGL |
| RCM37_12250114 | 3300001850 | Marine Plankton | MRASRGMGDIIPSKMPGKKIIHRKDKPEDVEMYKEGGMAGGKWIQ* |
| GOS2236_10083714 | 3300001968 | Marine | MMPSRGMGAIAPSKMPKKKVIHRKDDPNDVDMYAEV |
| metazooDRAFT_12191661 | 3300002195 | Lake | MRPSRGMGDINPSKMPKAKKVVRKDNPNDVEVYKKGG |
| metazooDRAFT_13526372 | 3300002212 | Lake | MGAIAPSKMPKGKVIHRKDKPDLVDMYKKGGKVSKVNQAGNYTK |
| B570J29644_10070271 | 3300002303 | Freshwater | MMESRGMGDINPSKMPGKKTIKRKDNPQDVEMYKKGGKVKRKTK* |
| B570J40625_1010203191 | 3300002835 | Freshwater | MRGSRGMGAIMPSKMPGKKVITRKDNPDAVDMYAKGGKTSSVNKAGNYT |
| JGI26470J50227_100068410 | 3300003375 | Freshwater | VRASRGMGAINPSKMPGKKIIHRKDKPQDVEFYRKGGKVKLKKVKK* |
| JGI26470J50227_10253471 | 3300003375 | Freshwater | MMASRGMGAIKPSKMPGKKTIHRKDHPQDVSLYKKGGEVWNT |
| JGI26470J50227_10651513 | 3300003375 | Freshwater | MIASRGMGDISPSKMPGKKTIHRKDNPNDVDVYAKGGAVWNTPNP |
| JGI25911J50253_101793131 | 3300003411 | Freshwater Lake | MRPSRGMGDINPSKMPGKKTIKRKDDPNKVAMYAEGGKTKS |
| JGI25912J50252_100389511 | 3300003412 | Freshwater Lake | MLASRGMGNINPSKMPKGKTITRKDDPNKVEMYAEGGKVKSKVNAAGNYT |
| Ga0007835_10068391 | 3300003789 | Freshwater | MMASRGMGDINPSKMPGKKIIHRKDNPNDVEVYKEGGAVWD |
| Ga0007817_10103111 | 3300003804 | Freshwater | MWRGKNVMMASRGMGVMNPSKMPGKKIIHRKDHPNDVSLYKH |
| Ga0007838_10106011 | 3300003805 | Freshwater | MASRGMGAIAPSKMPGKKTIIRKDDPNRVEVYAKGGEIWDKAR |
| Ga0007869_10045301 | 3300003809 | Freshwater | MMASRGMGDINPSKMPGKKVIHRKDKPNDVDVYAKGGAVWDTPS |
| Ga0007869_10162181 | 3300003809 | Freshwater | MMASRGMGVMNPSKMPGKKIIHRKDHPNDVSLYKHGGEVWDT |
| Ga0007879_10196221 | 3300003813 | Freshwater | MRASRGMGDINPSKMPGKKIIHRKDHPEDVEVYKKGGKVGKKNWIGDAIRKPG |
| Ga0007879_10290321 | 3300003813 | Freshwater | MRASRGMGDIAPSKMPKKKIIHRTDNPNDVEVYAKGGTIKHS |
| Ga0007877_10346513 | 3300003814 | Freshwater | MMASRGMGDINPSKMPGKKVIHRKDKPNDVDVYAKGGKVW |
| Ga0007856_10115401 | 3300003815 | Freshwater | MRASRGMGVINPSKMPGKKIIHRKDDPNTVDMYKRGGKVWDTPN |
| Ga0007863_10069974 | 3300003820 | Freshwater | MIASRGMGDINPSKMPGKKIIKRKDNPNDVAMYKKGGKVKS |
| Ga0007829_100201831 | 3300004095 | Freshwater | MRASRGMGDIAPSKMPKKKIIHRTDNPNDVEVYAKGGTIK |
| Ga0007829_101159981 | 3300004095 | Freshwater | MMASRGMGDIKPSKMPAKKVIHRKDHPNDVSLYKHGGEVW |
| Ga0065173_10847291 | 3300004686 | Freshwater | MMSSRGMGDINPSKMPGKKIIKRKDNPNDVAMYKKGGKVKSKVNEAN |
| Ga0007827_101224252 | 3300004777 | Freshwater | MRASRGMGVINPSKMPGKKIIHRKDDPNTVDMYKRGGKVW |
| Ga0007809_100198261 | 3300004807 | Freshwater | MRASRGMGAMNPSKMPHKKVIHRKDDPNAVDMYAKGGEVW |
| Ga0049081_100677751 | 3300005581 | Freshwater Lentic | MRPSRGMGDINPSKMPGKKMIKRKDNPEDVEMFAGGGLYANI |
| Ga0049080_102253673 | 3300005582 | Freshwater Lentic | MRPSRGMGDINPSKMPGKKTIKRKDDPDKVEMYAGG |
| Ga0075470_100011479 | 3300006030 | Aqueous | MMPSRGMGAINPSKMPGKKTIKRKDSPQNVGLYKKGGSVKGSRGLNK* |
| Ga0075470_1000125612 | 3300006030 | Aqueous | MMPSRGMGAINPSKMPGKKTIKRKDSPQNVELYKKGGKVKRKTK* |
| Ga0007876_10299211 | 3300006071 | Freshwater | MIASRGMGDIAPSKMPGKKIIKRKDNPNDVAMYKKGGETKSKVN |
| Ga0007881_10660831 | 3300006072 | Freshwater | MMASRGMGDINPSKMPGKKVIHRKDKPNDVDVYAKGG |
| Ga0007806_10025511 | 3300006100 | Freshwater | MIASRGMGDIAPSKMPGKKIIKRKDNPNDVAMYKKGGETKSKVNQ |
| Ga0007806_10084056 | 3300006100 | Freshwater | MRASRGMGDINPSKMPGKKIIHRKDHPEDVEVYKKG |
| Ga0007806_10370193 | 3300006100 | Freshwater | MMASRGMGDIKPSKMPAKKVIHRKDHPNDVSLYKK |
| Ga0007858_10605971 | 3300006113 | Freshwater | MRSSRGMGDISPSKMPGKKVIHRKDKPQDVDMYAEGGETKSKSKSKAGPKS |
| Ga0007815_11172083 | 3300006114 | Freshwater | MLASRGMGDINPSKMPGKKTIHRKDHPQDVSLYKRGGEVW |
| Ga0007816_10696934 | 3300006115 | Freshwater | MMASRGMGVMNPSKMPGKKIIHRKDHPNDVSLYKHGGEVW |
| Ga0007859_10225731 | 3300006118 | Freshwater | MLASRGMGDINPSKMPGKKTIHRKDHPQDVSLYKRGGEVWDTPNPA |
| Ga0007859_11083033 | 3300006118 | Freshwater | MRSSRGMGDISPSKMPGKKVIHRKDKPQDVDMYAEGGETKSKSK |
| Ga0007866_10619624 | 3300006119 | Freshwater | MMASRGMGDINPTKMPGKKIIKRKDNPNDVAVYKKGGEVWNT |
| Ga0007805_10321365 | 3300006127 | Freshwater | MIASRGMGDIAPSKMPGKKIIKRKDNPNDVAMYKKGGETKSKVNQAN |
| Ga0007805_11275532 | 3300006127 | Freshwater | MMASRGMGDINPSKMPNKKKIIRKDDPNDVDVYKKGG |
| Ga0075473_100371306 | 3300006875 | Aqueous | MMPSRGMGAINPSKMPGKKTIKRKDSPQNVELYKKGGSVKGSRGLNK* |
| Ga0075458_102678701 | 3300007363 | Aqueous | MMTSRGMGDINPSKMPGKKTIRRKDKPQDVAMYKDGGKVNAA |
| Ga0114351_11748563 | 3300008117 | Freshwater, Plankton | MMASRGMGAINSKKMPGKKAVRRKDKPQDVDMYAEGGG |
| Ga0114355_10238935 | 3300008120 | Freshwater, Plankton | MRACRGMGAINPSKMPGAKTIRRKDNPDEVKVYAKGGKLDI* |
| Ga0114364_10657613 | 3300008267 | Freshwater, Plankton | MGAISSSKMPKAKTITRKDDPNKVKAYKEGGETKSKVNEAGNYTKPDLRK |
| Ga0114364_11119922 | 3300008267 | Freshwater, Plankton | MRPSRGMGDINPSKMPGKKIIKRKDNPEDVEMFAGG |
| Ga0114973_107382331 | 3300009068 | Freshwater Lake | MLSSRGMGKIDPSKMPGKKTITRKDDPNQVAMYAEG |
| Ga0105098_105402932 | 3300009081 | Freshwater Sediment | MGAVMPSKMPGKKIIKRKDNPNDVELYAEGGKVKS |
| Ga0114963_102351243 | 3300009154 | Freshwater Lake | MMASRGMGAINPSKMPGKKEIIRKDDPNKVAMYKRGGQ |
| Ga0114968_105834843 | 3300009155 | Freshwater Lake | MRASRGMGEIAPSKMPKGKIIHRKDKPQDVEMFAKGGKVGLYENIH |
| Ga0114981_105078471 | 3300009160 | Freshwater Lake | MMSSRGMGAMNPSKMPKKKVIHRKDKPQDVDMYAEGGK |
| Ga0114975_102908833 | 3300009164 | Freshwater Lake | MRPSRGMGDMKASKMPGKKIIKRKDKPQDVEMYAKGGSTKFIQK |
| Ga0114969_103706152 | 3300009181 | Freshwater Lake | MMSSRGMGAISPSKMPKAETITRKDDPNKVKVYKEGGETKSKVNEAGNYT |
| Ga0114974_104182001 | 3300009183 | Freshwater Lake | MGDISPAKKIAPTKIRRKDNPDVVDLYAKGGKVNAAG |
| Ga0114976_105924362 | 3300009184 | Freshwater Lake | MLSSRGMGKIDPSKMPGKKTITRKDDPNQVAMYAEGGHVNEAG |
| Ga0114982_11512261 | 3300009419 | Deep Subsurface | MMASRGMGDISPSKMPKDKTIKRKDDPDKVAMFKRGGKVKTKRY |
| Ga0114951_100997981 | 3300009502 | Freshwater | MMASRGMGIMNPSKMPGKKTIHRKDKPQDVSLYKKGG |
| Ga0157569_10348544 | 3300012691 | Freshwater | MRPSRGMGDISPSKMPGKKVIHRKDHPNNVSLYKDG |
| Ga0157564_10325034 | 3300012747 | Freshwater | MMASRGMGAIKPSKMPGKKTIHRKDHPQDVSLYKKGGQAKSKVNE |
| Ga0138269_11224381 | 3300012778 | Freshwater Lake | MMPSRGMGAINPSKMPNKKTIHRQDNPDDVSMYKKG |
| Ga0164293_102087021 | 3300013004 | Freshwater | MGDINPSKMPNKKIVQKDNQNVPLYKQGGKVKRKQK* |
| Ga0164296_100129510 | 3300013093 | Freshwater | MGAINPSKMPGKKIIHRKDKPQDVEFYRKGGKVKLKKVKK* |
| Ga0164296_12925693 | 3300013093 | Freshwater | MMASRGMGAIKPSKMPGKKTIHRKDHPQDVSLYKKGGEVWNTPNPA |
| Ga0177922_105110691 | 3300013372 | Freshwater | MRPSRGMGDINPSKMPGKKIIKRKDNPEDVEMFAGGGLY |
| Ga0181338_10356213 | 3300015050 | Freshwater Lake | MRPSRGMGDINPSKMPGKKTIKRKDDPNKVAMYAEGGKTKSKVNEAGNYTKPDLR |
| Ga0181350_10294501 | 3300017716 | Freshwater Lake | MMSSRGMGAINRSKMPKGKTIERTDEPQDVEMYAGGGL |
| Ga0181350_10616675 | 3300017716 | Freshwater Lake | MRPSRGMGAISPSKMPKKKTIKRKDNPENVEMYAGGGLYAN |
| Ga0181350_10856911 | 3300017716 | Freshwater Lake | MMASRGMGAMLPSKMSKSKTIKRKDNPDEVQMFAGGGLYA |
| Ga0181350_11044021 | 3300017716 | Freshwater Lake | MRPSRGMGDINPSKMPGKKTIKRKDDPNKVAMYAEGGKTKSKVNEAGN |
| Ga0181350_11171333 | 3300017716 | Freshwater Lake | MMASRGMGKINPSKMPGKKVIHRKDKPQNVDMYAEGGKTK |
| Ga0181347_10408321 | 3300017722 | Freshwater Lake | MMSSRGMGAINPKKMPGKKVIHRKDKPQDVNMYAE |
| Ga0181347_10858441 | 3300017722 | Freshwater Lake | MRPSRGMGDINPSKMPGKKMIKRKDNPEDVEMYAG |
| Ga0181347_11764223 | 3300017722 | Freshwater Lake | MRPSRGMGAISSSKMPGKKIIKRKDDPDKVEMYAGGGGLY |
| Ga0181365_10251945 | 3300017736 | Freshwater Lake | MRPSRGMGAINPSKMPGKKTIKRKDNPEDVEMFAGGGLY |
| Ga0181365_10345081 | 3300017736 | Freshwater Lake | MRPSRGMGDINPSKMPGKKTIKRKDDPDKVEMYAGGGLY |
| Ga0181365_11034561 | 3300017736 | Freshwater Lake | MMSSRGMGAISPSKMPKDKTITRKDDPNKVKVYKEGGETKSKVNEAGNYTK |
| Ga0181365_11648172 | 3300017736 | Freshwater Lake | MRPSRGMGDINPSKMPGKKTIKRKDDPNKVAMYAEG |
| Ga0181365_11757823 | 3300017736 | Freshwater Lake | MMSSRGMGDINPKKMPGKKVIHRKDKPQDVDMYAEGGKTKSKV |
| Ga0181352_10070457 | 3300017747 | Freshwater Lake | MMASRGMGAINPDKMPGKKTIKRKDKPQDVSMYKKGGCVCTKKKKVK |
| Ga0181352_10168662 | 3300017747 | Freshwater Lake | MRPSRGMGAILPSKMPTKKIIKRKDKPQDVAVYSQGGAVSKEIK |
| Ga0181352_10374881 | 3300017747 | Freshwater Lake | MGAIAPSKMPKKKVIRRKDDPNDVDMYAEGGTTKSK |
| Ga0181352_10478025 | 3300017747 | Freshwater Lake | MMASRGMGDINPSKMPGKKTIKRKDNPQDVEMYKKGGKVKRKTK |
| Ga0181352_10558634 | 3300017747 | Freshwater Lake | MMASRGMGAILPSKMPDKKVIHRKDDPNDVAMYAEGGKV |
| Ga0181352_10726313 | 3300017747 | Freshwater Lake | MRASRGMGAIAPSKMPKKKVITRRDNPDAVDMYAKGGATKSKVNEAGNY |
| Ga0181352_11274312 | 3300017747 | Freshwater Lake | MRASRGMGAIAPSKMPKKKVITRRDNPDAVDMYAKGGTTKSKVNEAGNYTK |
| Ga0181352_11276243 | 3300017747 | Freshwater Lake | MRASRGMGAVMPSKMPGKKIIKRKDNPNDVEMYAKGGKVGKSVT |
| Ga0181352_11465102 | 3300017747 | Freshwater Lake | MRESRGMGIIRSGKMPGKKVIRRKDNPDKVDVYAKGGKSK |
| Ga0181344_10915064 | 3300017754 | Freshwater Lake | MRASRGMGAVMPSKMPGKKVIRRKDNPDDVDMYAKGGKVGKSVTT |
| Ga0181344_10936923 | 3300017754 | Freshwater Lake | MMASRGMGAMNPAKMPGKKTIHRKDKPQDVDMYADGGKVNAAGNYTKP |
| Ga0181344_11232612 | 3300017754 | Freshwater Lake | MMSSRGMGKINPSKMPGKKVIHRKDKPQNVDMYAEGGKTKSKV |
| Ga0181356_10429025 | 3300017761 | Freshwater Lake | MRPSRGMGDINPSKMPGKKIIKRKDNPEDVEMFAGGGLYANI |
| Ga0181356_11469081 | 3300017761 | Freshwater Lake | MRPSRGMGDINPSKMPGKKMIKRKDNPEDVEMFAGGGLYAN |
| Ga0181356_11661691 | 3300017761 | Freshwater Lake | MRPSRGMGDINPSKMPGKKTIKRKDDPNKVAMYAEGGKTK |
| Ga0181356_11665313 | 3300017761 | Freshwater Lake | MRPSRGMGDINPSKMPGKKTIKRKDDPNKVAMYAEGGKTKSKVNEA |
| Ga0181356_12533001 | 3300017761 | Freshwater Lake | MRPSRGMGDINPSKMPGKKMIKRKDNPEDVEMYAGGGLYAN |
| Ga0181343_10921144 | 3300017766 | Freshwater Lake | MRASRGMGAVMPSKMPDKKVIRRKDNPDDVDRYAKGG |
| Ga0181343_11632741 | 3300017766 | Freshwater Lake | MRACRGMGAINPSKMPGAKTIRRKDNPDDVTMYAKGGEAKLDI |
| Ga0181343_12140622 | 3300017766 | Freshwater Lake | MRPSRGMGDISPSKMPGKKVIKRKDKPQDVDMYAKGGK |
| Ga0181358_12788962 | 3300017774 | Freshwater Lake | MMPSRGMGDIASSKMPKGKKTARKDDTDFTRYAEGGKTKSKVNEAGNYTK |
| Ga0181357_10678773 | 3300017777 | Freshwater Lake | MMSSRGMGKINPSKMPGKKVIHRKDKPQNVDMYAEGGK |
| Ga0181357_10721875 | 3300017777 | Freshwater Lake | MRPSRGMGNINPSKMPGKKVIHRKDNPNDVEMFAG |
| Ga0181357_11564243 | 3300017777 | Freshwater Lake | MRSSRGMGDINPSKMPGKKTIKRKDDPNKVAMYAEGGKTKSKVNEAGNYT |
| Ga0181357_12142762 | 3300017777 | Freshwater Lake | MMASRGMGAMNPKKMPGKKEITRTDDPNKVAMYKRGGKVKRMDK |
| Ga0181357_12597371 | 3300017777 | Freshwater Lake | MGAIAPSKMPKKHTIKRKDDPNDVAMYAEGGETKSKVNEAGNYTKPGM |
| Ga0181349_10763561 | 3300017778 | Freshwater Lake | MRSSRGMGDINPSKMPGKKTIKRKDDPNKVAMYAEGGKTKSKVNE |
| Ga0181349_11681183 | 3300017778 | Freshwater Lake | MMASRGMGKINPSKMPGKKVIHRKDKPQNVDMYAEGG |
| Ga0181346_10928911 | 3300017780 | Freshwater Lake | MMSSRGMGAMNPKKMPGKKVIHRKDKPQDVDMYAEG |
| Ga0181346_11489903 | 3300017780 | Freshwater Lake | MIASRGMGDISPSKMPKGKKVVRKDNPNDVEVYKAGGKVKSKVNAAGNYTK |
| Ga0181346_11973443 | 3300017780 | Freshwater Lake | MRPSRGMGDINPSKMPGKKMIKRKDNPEDVEMFAGGGLYA |
| Ga0181346_12419873 | 3300017780 | Freshwater Lake | MRPSRGMGDINPSKMPGKKTIKRKDDPNKVAMYAEGGKTKSKVN |
| Ga0181346_13133212 | 3300017780 | Freshwater Lake | MMASRGMGDISPSKMPKGKKVVRKDNPNDVEVYKAGG |
| Ga0181348_11176033 | 3300017784 | Freshwater Lake | MMSSRGMGAMNPKKMPGKKVIHRKDKPQDVDMYAEGGKT |
| Ga0181348_11613201 | 3300017784 | Freshwater Lake | MRSSRGMGDINPSKMPGKKTIKRKDDPNKVAMYAEGGKTKSKVNEAGN |
| Ga0181348_12293853 | 3300017784 | Freshwater Lake | MSSRGMGAINPKKMPGKKVIHRKDKPQDVNMYAEGGKTKSKVNEAGNYTKPDLRKR |
| Ga0181355_11413613 | 3300017785 | Freshwater Lake | MRPSRGMGDINPSKMPGKKMIKRKDNPEDVEMYAGGGLYANI |
| Ga0207193_100430915 | 3300020048 | Freshwater Lake Sediment | MRACRGMGDVNPSKMPDRKTVKRKDNPQDVAMYRRGGKTKGKCK |
| Ga0194113_100277538 | 3300020074 | Freshwater Lake | MMASRGMGDINPSKMPGKKVIKRKDKPEDVDVYKKGGRIKGKGK |
| Ga0194119_102692763 | 3300020220 | Freshwater Lake | MMPSRGMGDINPSKMPGRKVIKRKDDPEKVSLFKKGGESRVN |
| Ga0194119_107993761 | 3300020220 | Freshwater Lake | MGAVSPSKMPKAKTIKRKDKPQDVEMFAGGGLYAN |
| Ga0194127_107494151 | 3300020221 | Freshwater Lake | MMASRGMGDINPNKMPGKKVVKRKDKPEDVDVYKKGGRIKGKGK |
| Ga0208223_10211203 | 3300020519 | Freshwater | MMESRGMGDINPSKMPGKKTIKRKDNPQDVEMYKKGGKVKRKTK |
| Ga0208852_10558991 | 3300020560 | Freshwater | MRGSRGMGAIMPSKMPGKKVITRKDNPDAVDMYAKGGKTSSVNKAGNYTKPSMR |
| Ga0214237_10253614 | 3300020711 | Freshwater | MRASRGMGDINPSKMPGKKTIKRKDNPDSVDMYKKGGWIKGAIKK |
| Ga0214236_10116105 | 3300020721 | Freshwater | MMASRGMGDINPSKMPNKKKIIRKDDPNDADMYKKGGV |
| Ga0214246_10151711 | 3300020727 | Freshwater | MMASRGMGAIKPSKMPKGKTIHRKDNPNDVSLYKK |
| Ga0194133_100843826 | 3300021091 | Freshwater Lake | MKPSRGMGAISPSKMPKAKTIKRKDGDNVETFAGGGL |
| Ga0214199_10165834 | 3300021124 | Freshwater | MLASRGMGDINPSKMPGRKTIHRKDKPQDVSLYKKG |
| Ga0214206_10101005 | 3300021131 | Freshwater | MIASRGMGDIAPSKMPGKKIIKRKDNPNDVAMYKKGGE |
| Ga0214163_10059721 | 3300021141 | Freshwater | MRACRGMGAMNPSKMPGKKTIKRKDNPDDVSMYAKGGKA |
| Ga0214192_10087081 | 3300021142 | Freshwater | MMASRGMGAISPDKMPSRKTIRRKDNPDDVSLYAEG |
| Ga0194048_101212902 | 3300021519 | Anoxic Zone Freshwater | MGAVRPSKMPGRKIIVRKDNPNDVALYAKGGEVKRKRQKKAKR |
| Ga0213921_10284623 | 3300021952 | Freshwater | MMASRGMGDINPSKMPGKKTIKRKDNPQDVELFKKGGRTKKKAK |
| Ga0222714_100502857 | 3300021961 | Estuarine Water | MIASRGMGDINPSKMPKGKKVVRKDNPNDVEVYKEG |
| Ga0222713_103793693 | 3300021962 | Estuarine Water | MMASRGMGAMNPKKMPGKKEITRKDDPNKVAMYAEGGKTK |
| Ga0222712_101936896 | 3300021963 | Estuarine Water | MRPSRGMGDINPSKMPGKKTIKRKDDPNKVAMYAEGGEV |
| Ga0181353_10998131 | 3300022179 | Freshwater Lake | MRASRGMGAVMPSKMPGKKIIKRKDNPNDVDLYAEGGKVKSKVNAA |
| Ga0181354_10586754 | 3300022190 | Freshwater Lake | MRASRGMGDINPSKMPGKKIIKRKDNPDDVEMYAGGGLY |
| Ga0181354_11055931 | 3300022190 | Freshwater Lake | MMSSRGMGKINPSKMPGKKVIHRKDKPQDVDMYAE |
| Ga0181354_11717561 | 3300022190 | Freshwater Lake | MRPSRGMGDINPSKMPGKKMIKRKDNPEDVEMYAGGGLY |
| Ga0181354_11836973 | 3300022190 | Freshwater Lake | MMASRGMGKINPSKMPGKKVIHRKDKPQNVDMYAEG |
| Ga0181354_11904273 | 3300022190 | Freshwater Lake | MMASRGMGAINPRKMPTKKVIHRTDNPNDVDMYKEGG |
| Ga0181354_12060002 | 3300022190 | Freshwater Lake | MRPSRGMGDINPSKMPGKKTIKRKDDPNKVAMYAEGGK |
| Ga0181351_11491853 | 3300022407 | Freshwater Lake | MRSSRGMGDINPSKMPKPKVIKRKDNPDSVDLYAKG |
| Ga0181351_11816351 | 3300022407 | Freshwater Lake | MRPSRGMGDINPSKMPGKKMIKRKDNPEDVEMYAGGV |
| Ga0181351_11987402 | 3300022407 | Freshwater Lake | MRPSRGMGDINPSKMPGKKTIKRKDNPEDVEMFAGG |
| Ga0228702_11192632 | 3300022748 | Freshwater | MISSRGMGCISTSKMPGKKTIKRKDNPQDVELFKKGGRTKKKAK |
| Ga0255164_10036178 | 3300024495 | Freshwater | MGAIMPSKMPGKKVIHRKDNPNDVEMYADGGEVWDK |
| Ga0208383_10223202 | 3300025357 | Freshwater | MGAINPSKMPGKKIIHRKDKPQDVEFYRKGGKVKLKKVKK |
| Ga0208382_10319881 | 3300025369 | Freshwater | MMASRGMGDINPSKMPGKKVIHRKDKPNDVDVYAKG |
| Ga0208256_10314423 | 3300025382 | Freshwater | MMASRGMGIMNPSKMPGKKIIHRKDKPQDVELYKKGGEV |
| Ga0208250_10182071 | 3300025383 | Freshwater | MRASRGMGDINPSKMPGKKIIHRKDHPEDVEVYKKGGK |
| Ga0208250_10208203 | 3300025383 | Freshwater | MIASRGMGDIAPSKMPGKKIIKRKDNPNDVAMYKKGGETKSKVNQANAYTKPGMR |
| Ga0208257_100087012 | 3300025389 | Freshwater | MMASRGMGVMNPSKMPGKKIIHRKDHPNDVSLYKHGG |
| Ga0208743_10560101 | 3300025390 | Freshwater | MMPSRGMGDINPSKMPKKKIIERTDNPDAVDMYATG |
| Ga0208874_10444663 | 3300025396 | Freshwater | MMSSRGMGDINPSKMPGKKVIKRKDNPNDVAMYKKGGKVKSKVNEANAYTKP |
| Ga0207955_10387123 | 3300025401 | Freshwater | MMASRGMGDINPSKMPKKKVIERTDNPDSVDMYKKGGEVWNK |
| Ga0208378_10172361 | 3300025407 | Freshwater | MPSRGMGAMSPSKMPKRKTIHRKDHPDDVSLYKKGGEVWD |
| Ga0208616_10403472 | 3300025417 | Freshwater | MIASRGMGDISPSKMPGKKTITRKDDPNHVEVYAKGSGV |
| Ga0208253_10440523 | 3300025418 | Freshwater | MGVMNPSKMPGKKIIHRKDHPNDVSLYKHGGEVWDT |
| Ga0207958_10614251 | 3300025421 | Freshwater | MRSSRGMGDISPSKMPGKKVIHRKDKPQDVDMYAEGG |
| Ga0208739_10624693 | 3300025426 | Freshwater | MMASRGMGDVNPDKMPKKKTIVRKDKPQDVSMYKKGGKVK |
| Ga0208500_10367352 | 3300025429 | Freshwater | MRASRGMGVINPSKMPGKKIIHRKDDPNTVDMYKRGGK |
| Ga0208105_10637341 | 3300025487 | Freshwater | MMASRGMGDIRPSKMPAKKVIHRKDNPNDVSLYKKGGKTKSKVNEANAYTKPS |
| Ga0208546_100071314 | 3300025585 | Aqueous | MMPSRGMGAINPSKMPGKKTIKRKDSPQNVGLYKKGGSVKGSRGLNK |
| Ga0208546_10040927 | 3300025585 | Aqueous | MMPSRGMGAINPSKMPGKKTIKRKDSPQNVELYKKGGKVKRKTK |
| Ga0208741_100802503 | 3300025723 | Freshwater | MMASRGMGDINPSKMPKKKVIERTDNPDSVDMYKKGGEV |
| Ga0208386_10207081 | 3300025781 | Freshwater | MRASRGMGVINPSKMPGKKIIHRKDDPNTVDMYKRGGKVWDT |
| Ga0208498_10050341 | 3300025785 | Freshwater | MIASRGMGDIAPSKMPGKKIIKRKDNPNDVAMYKKGGETKSKVNQANA |
| Ga0208499_10281701 | 3300025789 | Freshwater | MMASRGMGDINPSKMPGKKVIHRKDKPNDVDVYAKGGKVWETPN |
| Ga0208644_11765953 | 3300025889 | Aqueous | MMASRGMGAINPKKMPGKKVVRRKDQPQNVDMYAEGGGVNAAGNY |
| Ga0255269_11058351 | 3300026573 | Freshwater | MMASRGMGAIRSSKMPKKKVIERKDDPNDVDMYAEGGKV |
| Ga0255182_10386221 | 3300027503 | Freshwater | MMASRGMGAIRSSKMPKKKVIHRTDEPQDVDMYAEGGKTKSKVNEAGVYT |
| Ga0208975_11207963 | 3300027659 | Freshwater Lentic | MRPSRGMGDISPSKMPGKKTIKRKDDPDKVEMYAG |
| Ga0208975_11619431 | 3300027659 | Freshwater Lentic | MRPSRGMGSISPSKMPGKKTIKRKDNPEDVEMFAGGG |
| Ga0209033_11787951 | 3300027697 | Freshwater Lake | MMASRGMGAIRASKMPGKKVVRRKDTPQDVDMYAEG |
| Ga0209188_10654781 | 3300027708 | Freshwater Lake | MMASRGMGAINPSKMPGKKEIIRKDDPNKVAMYKRGGQV |
| Ga0209087_12728381 | 3300027734 | Freshwater Lake | MRPSRGMGDINPSKMPGKKTIKRKDDPNKVAMYAEGGKVNAA |
| Ga0209593_102315063 | 3300027743 | Freshwater Sediment | MGAINPKKMPKPKKIVRKDHPQDVDMYAAGGRVSKV |
| Ga0209084_10769041 | 3300027749 | Freshwater Lake | MRPSRGMGDINPKKIPKKVIRKDNPNSVDLYKKGG |
| Ga0209829_102621131 | 3300027777 | Freshwater Lake | MRPSRGMGAINPSKMPGKRVVKRKDNPDDVDMYSEGGD |
| Ga0209246_101319983 | 3300027785 | Freshwater Lake | MRPSRGMGDINPSKMPGKKTIKRKDDPNKVAMYAEGGKTKSKVNEAGNYT |
| Ga0209229_105087443 | 3300027805 | Freshwater And Sediment | MMSSRGMGAINPSKMPKKKVIHRKDNPNTVDMYAAGGKTK |
| Ga0209777_102982853 | 3300027896 | Freshwater Lake Sediment | MGDINPSKMPKRKKIVRKDDPNDVALYKRGGKVKRKKK |
| Ga0209777_110487653 | 3300027896 | Freshwater Lake Sediment | MRASRGMGDINPSKMPGKKVIKRKDNPQDVSVYKEGGHVNAAGNYTK |
| Ga0256305_10952953 | 3300028108 | Freshwater | MRASRGMGAILPSKMPGKKVIHRKDNPNDVDLYADGGAVKSKVNAAGNYTK |
| Ga0304729_10261678 | 3300028392 | Freshwater Lake | MIASRGMGDINPSKMPGKKTIRRKDKPQDVDMYAEGGKVNAAGNY |
| Ga0304728_10956624 | 3300028393 | Freshwater Lake | MRPSRGMGDINPSKMPGKKTIKRKDDPNKVAMYKRGGKVKKFDEG |
| Ga0315291_108774531 | 3300031707 | Sediment | MRPSRGMGDINPSKMPGKKTIKRKDDPNKVAMYAEGV |
| Ga0315291_109428583 | 3300031707 | Sediment | MRPSRGMGDINPSKMPGKKMIKRKDNPEDVEMFAGGG |
| Ga0315291_114673011 | 3300031707 | Sediment | MRASRGMGDINPSKMPGKKKITRKDNPNEVETFAGG |
| Ga0315288_112971232 | 3300031772 | Sediment | MMSSRGMGAMNPKKMPGRKVVRRKDKPQDVDMYAEGGKTKSKVNE |
| Ga0315290_105067264 | 3300031834 | Sediment | MRASRGMGDIAPSKMPKGKKIIRKDDPNAVEMYKKGGVA |
| Ga0315904_112256391 | 3300031951 | Freshwater | MMSSRGMGAMNPAKMPKKKVIHRKDKPQDVDMYAEGGKTKSKVNEAGN |
| Ga0315274_114840141 | 3300031999 | Sediment | MRPSRGMGAIAPSKMPKKRTIKRKDDPNDVAMYAEGGETKSKVNEAGNYTKP |
| Ga0315289_107091061 | 3300032046 | Sediment | MRASRGMGDINPSKMPGKKIIKRKDNPDDVEMYAGGGLYA |
| Ga0315906_102533333 | 3300032050 | Freshwater | MMASRGMGAINPKKMPGKRTVRRKDKPQSVDMYAE |
| Ga0315284_101612271 | 3300032053 | Sediment | MRPSRGMGDINPSKMPGKKTIKRKDDPNKVAMYAEGGKTKSK |
| Ga0315905_100478925 | 3300032092 | Freshwater | MMPSRGMGAINPSKMPGKKTIKRKDSPQNVELYKKGGSVKGSRGLNK |
| Ga0315905_100787168 | 3300032092 | Freshwater | MLPSRGMGAINPDKMPSRKKMKRKDNPDIVDVYKEG |
| Ga0315905_102989921 | 3300032092 | Freshwater | MRPSRGMGDINPSKMPGKKTIKRKDDPDKVEMYAGGGL |
| Ga0315903_102801535 | 3300032116 | Freshwater | MGAIAPSKMPKKKVIRRKDDPNDVDMYAEGGTTKSKVNEA |
| Ga0315903_103709354 | 3300032116 | Freshwater | MMASRGMGAINPKKMPTKKVIHRTDNPDDVDMYKEG |
| Ga0315903_106345951 | 3300032116 | Freshwater | MRPSRGMGAINPSKMPKKKTIKRKDNPEDVEMFAGGGLY |
| Ga0316218_12872981 | 3300032117 | Freshwater | MIASRGMGDINPSKMPGKKVVHRKDNPNDVDVYAK |
| Ga0316218_13002952 | 3300032117 | Freshwater | MMASRGMGDIKPSKMPAKKVIHRKDNPNDVSLYKKG |
| Ga0315295_120498801 | 3300032156 | Sediment | MMASRGMGAMNPKKMPGKKTITRKDDPNKVAMYAEGGKTKSKVNEAGN |
| Ga0315268_121947442 | 3300032173 | Sediment | MMASRGMGAMNPKKMPGKKTITRKDDPNKVAMYAEGGKTKSKVNEAGNYTKP |
| Ga0315276_123738161 | 3300032177 | Sediment | MRPSRGMGDINPSKMPGKKTIKRKDDPNKVAMYAE |
| Ga0315276_126313732 | 3300032177 | Sediment | MRPSRGMGDINPSKMPGKKTIKRKDDPNKVAMYAEGGKTKSKVNE |
| Ga0316226_10713696 | 3300032562 | Freshwater | MMASRGMGDINPSKMPGKKIIKRKDNPNDVAMYKKGGKVKSKVN |
| Ga0316228_11132994 | 3300032579 | Freshwater | MMASRGMGDINPSKMPGKKVIHRKDKPNDVDVYAKGGAVW |
| Ga0316221_10316321 | 3300032665 | Freshwater | MMASRGMGAIAPSKMPGKKTIIRKDDPNRVEVYAKGGEI |
| Ga0316221_12323371 | 3300032665 | Freshwater | MLASRGMGDINPSKMPGRKTIHRKDKPQDVSLYKKGGEVW |
| Ga0316229_10443507 | 3300032676 | Freshwater | MRPSRGMGDINPSKMPGKKVIHRKDHPNDVSLYKDGGKVWD |
| Ga0316227_11328781 | 3300032677 | Freshwater | MIASRGMGDINPSKMPGKKIIKRKDNPNDVDVYAK |
| Ga0316227_12227631 | 3300032677 | Freshwater | MRPSRGMGDINPSKMPGKKVIHRKDHPNDVSLYKDGG |
| Ga0316627_1018431151 | 3300033482 | Soil | MMASRGMGDINPSKMPGKKTIKRKDNPQDVEMYKKGGWIK |
| Ga0334978_0281776_1_108 | 3300033979 | Freshwater | MMPSRGMGAIAPSKMPKKKVIRRKDDPNDVDMYAEG |
| Ga0334979_0386520_315_425 | 3300033996 | Freshwater | MGDINPSKMPNKKIVQKDNQNVPLYKQGGKVKRKQK |
| Ga0310131_098479_2_145 | 3300033997 | Fracking Water | MGAINPSKMPGKPKKIIRKDNPDVVDMYKEGGKTSSVNKAGNYTKPGM |
| Ga0334998_0730268_1_129 | 3300034019 | Freshwater | MMPSRGMGAIASSKMPKKKVIRRKDDPNDVDMYAEGGTTKSKV |
| Ga0334983_0436545_1_120 | 3300034060 | Freshwater | MRACRGMGAINPSKMPGAKTIRRKDNPDEVTMYAKGGKLD |
| Ga0334987_0688722_461_586 | 3300034061 | Freshwater | MRASRGMGAMKASKMPGKKTIKRKDNPDDVSVYAKGGKAKLD |
| Ga0334995_0074301_3_131 | 3300034062 | Freshwater | MRPSRGMGAINPSKMPGKKVIKRKDNPNDVDMYAEGGKVSKVN |
| Ga0334995_0628653_1_105 | 3300034062 | Freshwater | MRASRGMGAVMPSKMPGKKIIKRKDNPNDVELYAE |
| Ga0334990_0428338_3_137 | 3300034068 | Freshwater | MMASRGMGDINPSKMPKGKKIIRKDDPNKVDLFAKGGKVKSKVNE |
| Ga0335028_0392288_669_785 | 3300034071 | Freshwater | MGDINPSKMPGKKTIKRKDNPQDVEMYKKGGKVKRKTK |
| Ga0335010_0358624_708_812 | 3300034092 | Freshwater | MRACRGMGAINPSKMPGAKTIRRKDNPDEVTMYAA |
| Ga0335012_0241883_261_389 | 3300034093 | Freshwater | VRASRGMGDINPSKMPNKKIVQKDNQNVPLYKQGGKVKRKQK |
| Ga0335031_0048690_2_118 | 3300034104 | Freshwater | MGAIAPSKMPKKKVIRRKDDPNDVDMYAEGGTTKSKVNE |
| Ga0335031_0217109_2_124 | 3300034104 | Freshwater | MRACRGMGAINPSKMPGKKTIRRKDNPDEVAVYAKGGKAKL |
| Ga0335031_0605270_3_134 | 3300034104 | Freshwater | MRASRGMGAIAPSKMPKKKVITRRDNPDAVDMYKEGGQTKSKVN |
| Ga0335031_0633119_3_113 | 3300034104 | Freshwater | MRACRGMGAINPSKMPGAKTILRKDNPDEVTMYAKGG |
| Ga0335066_0105095_2_154 | 3300034112 | Freshwater | MRASRGMGAIAPSKMPKKKVITRRDNPDAVDMYKEGGQTKSKVNEAGNYTK |
| Ga0335056_0367021_1_105 | 3300034120 | Freshwater | MMASRGMGDINPSKMPGKKTIKRKDNPQDVEMYKK |
| Ga0335058_0077594_3_134 | 3300034121 | Freshwater | MGDISPSKMPKAKTIRRKDNPNDVTMYAEGGDVKSKVNEAGNYT |
| ⦗Top⦘ |