| Basic Information | |
|---|---|
| Family ID | F016861 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 244 |
| Average Sequence Length | 41 residues |
| Representative Sequence | RKADMVESADERAALLKQADDLVDKVKEIKQKRAEQPQPAS |
| Number of Associated Samples | 187 |
| Number of Associated Scaffolds | 244 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 1.64 % |
| % of genes near scaffold ends (potentially truncated) | 97.13 % |
| % of genes from short scaffolds (< 2000 bps) | 87.30 % |
| Associated GOLD sequencing projects | 176 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.55 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (89.754 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (27.459 % of family members) |
| Environment Ontology (ENVO) | Unclassified (32.377 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (46.311 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 39.13% β-sheet: 0.00% Coil/Unstructured: 60.87% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.55 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 244 Family Scaffolds |
|---|---|---|
| PF13328 | HD_4 | 42.21 |
| PF13087 | AAA_12 | 2.87 |
| PF07228 | SpoIIE | 2.05 |
| PF07978 | NIPSNAP | 2.05 |
| PF02601 | Exonuc_VII_L | 1.64 |
| PF00144 | Beta-lactamase | 1.64 |
| PF12840 | HTH_20 | 1.64 |
| PF01042 | Ribonuc_L-PSP | 1.23 |
| PF09907 | HigB_toxin | 1.23 |
| PF03544 | TonB_C | 1.23 |
| PF04951 | Peptidase_M55 | 1.23 |
| PF01381 | HTH_3 | 1.23 |
| PF07687 | M20_dimer | 1.23 |
| PF09413 | DUF2007 | 0.82 |
| PF12704 | MacB_PCD | 0.82 |
| PF07969 | Amidohydro_3 | 0.82 |
| PF13470 | PIN_3 | 0.82 |
| PF13407 | Peripla_BP_4 | 0.41 |
| PF03466 | LysR_substrate | 0.41 |
| PF00171 | Aldedh | 0.41 |
| PF07730 | HisKA_3 | 0.41 |
| PF00753 | Lactamase_B | 0.41 |
| PF02518 | HATPase_c | 0.41 |
| PF08541 | ACP_syn_III_C | 0.41 |
| PF07676 | PD40 | 0.41 |
| PF13181 | TPR_8 | 0.41 |
| PF06745 | ATPase | 0.41 |
| PF03631 | Virul_fac_BrkB | 0.41 |
| PF13742 | tRNA_anti_2 | 0.41 |
| PF01850 | PIN | 0.41 |
| PF03176 | MMPL | 0.41 |
| PF08388 | GIIM | 0.41 |
| PF14384 | BrnA_antitoxin | 0.41 |
| PF13594 | Obsolete Pfam Family | 0.41 |
| PF13620 | CarboxypepD_reg | 0.41 |
| PF13545 | HTH_Crp_2 | 0.41 |
| PF15919 | HicB_lk_antitox | 0.41 |
| PF00440 | TetR_N | 0.41 |
| PF06202 | GDE_C | 0.41 |
| PF04607 | RelA_SpoT | 0.41 |
| PF02358 | Trehalose_PPase | 0.41 |
| COG ID | Name | Functional Category | % Frequency in 244 Family Scaffolds |
|---|---|---|---|
| COG1570 | Exonuclease VII, large subunit | Replication, recombination and repair [L] | 1.64 |
| COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 1.64 |
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 1.64 |
| COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 1.64 |
| COG0251 | Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 family | Defense mechanisms [V] | 1.23 |
| COG0810 | Periplasmic protein TonB, links inner and outer membranes | Cell wall/membrane/envelope biogenesis [M] | 1.23 |
| COG4585 | Signal transduction histidine kinase ComP | Signal transduction mechanisms [T] | 0.41 |
| COG0014 | Gamma-glutamyl phosphate reductase | Amino acid transport and metabolism [E] | 0.41 |
| COG4564 | Signal transduction histidine kinase | Signal transduction mechanisms [T] | 0.41 |
| COG4230 | Delta 1-pyrroline-5-carboxylate dehydrogenase | Amino acid transport and metabolism [E] | 0.41 |
| COG3851 | Signal transduction histidine kinase UhpB, glucose-6-phosphate specific | Signal transduction mechanisms [T] | 0.41 |
| COG3850 | Signal transduction histidine kinase NarQ, nitrate/nitrite-specific | Signal transduction mechanisms [T] | 0.41 |
| COG3408 | Glycogen debranching enzyme (alpha-1,6-glucosidase) | Carbohydrate transport and metabolism [G] | 0.41 |
| COG2409 | Predicted lipid transporter YdfJ, MMPL/SSD domain, RND superfamily | General function prediction only [R] | 0.41 |
| COG1877 | Trehalose-6-phosphate phosphatase | Carbohydrate transport and metabolism [G] | 0.41 |
| COG1295 | Uncharacterized membrane protein, BrkB/YihY/UPF0761 family (not an RNase) | Function unknown [S] | 0.41 |
| COG1033 | Predicted exporter protein, RND superfamily | General function prediction only [R] | 0.41 |
| COG1012 | Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenase | Lipid transport and metabolism [I] | 0.41 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 89.75 % |
| Unclassified | root | N/A | 10.25 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001081|JGI12662J13196_1019561 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 561 | Open in IMG/M |
| 3300001137|JGI12637J13337_1006686 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 966 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101208175 | All Organisms → cellular organisms → Bacteria | 645 | Open in IMG/M |
| 3300002908|JGI25382J43887_10086208 | All Organisms → cellular organisms → Bacteria | 1680 | Open in IMG/M |
| 3300004080|Ga0062385_10320366 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium ADurb.Bin478 | 897 | Open in IMG/M |
| 3300004092|Ga0062389_104822615 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 508 | Open in IMG/M |
| 3300005167|Ga0066672_10318125 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_57_17 | 1014 | Open in IMG/M |
| 3300005439|Ga0070711_101495128 | Not Available | 589 | Open in IMG/M |
| 3300005454|Ga0066687_10726542 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
| 3300005586|Ga0066691_10381613 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 836 | Open in IMG/M |
| 3300005586|Ga0066691_10923046 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 513 | Open in IMG/M |
| 3300005764|Ga0066903_101761828 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces fradiae → Streptomyces fradiae ATCC 10745 = DSM 40063 | 1182 | Open in IMG/M |
| 3300005764|Ga0066903_101896098 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 1141 | Open in IMG/M |
| 3300005764|Ga0066903_107627692 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 557 | Open in IMG/M |
| 3300005841|Ga0068863_100872740 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 899 | Open in IMG/M |
| 3300005883|Ga0075299_1025907 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 608 | Open in IMG/M |
| 3300005921|Ga0070766_10622762 | Not Available | 726 | Open in IMG/M |
| 3300005921|Ga0070766_10661487 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 705 | Open in IMG/M |
| 3300005944|Ga0066788_10092906 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 742 | Open in IMG/M |
| 3300006041|Ga0075023_100259279 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 698 | Open in IMG/M |
| 3300006173|Ga0070716_100245034 | All Organisms → cellular organisms → Bacteria | 1217 | Open in IMG/M |
| 3300006176|Ga0070765_101294280 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 688 | Open in IMG/M |
| 3300006176|Ga0070765_101862374 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Occallatibacter → Occallatibacter riparius | 564 | Open in IMG/M |
| 3300006358|Ga0068871_102305493 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 513 | Open in IMG/M |
| 3300006755|Ga0079222_10178813 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1247 | Open in IMG/M |
| 3300006797|Ga0066659_10944691 | Not Available | 721 | Open in IMG/M |
| 3300006804|Ga0079221_10142968 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1241 | Open in IMG/M |
| 3300007258|Ga0099793_10018850 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2805 | Open in IMG/M |
| 3300007265|Ga0099794_10028289 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2606 | Open in IMG/M |
| 3300009012|Ga0066710_102436671 | All Organisms → cellular organisms → Bacteria | 758 | Open in IMG/M |
| 3300009088|Ga0099830_10775229 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 791 | Open in IMG/M |
| 3300009089|Ga0099828_10468337 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1136 | Open in IMG/M |
| 3300009089|Ga0099828_11191128 | Not Available | 676 | Open in IMG/M |
| 3300009090|Ga0099827_10119168 | All Organisms → cellular organisms → Bacteria | 2123 | Open in IMG/M |
| 3300009090|Ga0099827_11404716 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 608 | Open in IMG/M |
| 3300009525|Ga0116220_10469427 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 568 | Open in IMG/M |
| 3300009545|Ga0105237_11354267 | Not Available | 718 | Open in IMG/M |
| 3300009621|Ga0116116_1159872 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 589 | Open in IMG/M |
| 3300009634|Ga0116124_1075355 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 969 | Open in IMG/M |
| 3300009792|Ga0126374_10216416 | All Organisms → cellular organisms → Bacteria | 1225 | Open in IMG/M |
| 3300009792|Ga0126374_11719292 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 522 | Open in IMG/M |
| 3300010043|Ga0126380_11675790 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 570 | Open in IMG/M |
| 3300010047|Ga0126382_11242006 | Not Available | 670 | Open in IMG/M |
| 3300010048|Ga0126373_12617275 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 563 | Open in IMG/M |
| 3300010321|Ga0134067_10221526 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 703 | Open in IMG/M |
| 3300010358|Ga0126370_11044020 | All Organisms → cellular organisms → Bacteria | 749 | Open in IMG/M |
| 3300010359|Ga0126376_11580871 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 687 | Open in IMG/M |
| 3300010359|Ga0126376_12921380 | Not Available | 527 | Open in IMG/M |
| 3300010361|Ga0126378_10563434 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1254 | Open in IMG/M |
| 3300010361|Ga0126378_12925255 | Not Available | 545 | Open in IMG/M |
| 3300010364|Ga0134066_10013541 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1692 | Open in IMG/M |
| 3300010366|Ga0126379_10206086 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1896 | Open in IMG/M |
| 3300010366|Ga0126379_12490545 | All Organisms → cellular organisms → Bacteria | 616 | Open in IMG/M |
| 3300010379|Ga0136449_101265066 | Not Available | 1154 | Open in IMG/M |
| 3300010398|Ga0126383_13477505 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 514 | Open in IMG/M |
| 3300011269|Ga0137392_10584344 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 927 | Open in IMG/M |
| 3300011269|Ga0137392_11050025 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 669 | Open in IMG/M |
| 3300011269|Ga0137392_11262237 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
| 3300011269|Ga0137392_11416901 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 554 | Open in IMG/M |
| 3300011271|Ga0137393_10746771 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 837 | Open in IMG/M |
| 3300011271|Ga0137393_11170863 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 653 | Open in IMG/M |
| 3300012096|Ga0137389_10293380 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1375 | Open in IMG/M |
| 3300012096|Ga0137389_10682578 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 882 | Open in IMG/M |
| 3300012096|Ga0137389_11196362 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 651 | Open in IMG/M |
| 3300012189|Ga0137388_10304334 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1462 | Open in IMG/M |
| 3300012189|Ga0137388_10333275 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1396 | Open in IMG/M |
| 3300012189|Ga0137388_11581348 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 592 | Open in IMG/M |
| 3300012200|Ga0137382_10283308 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1153 | Open in IMG/M |
| 3300012202|Ga0137363_10018072 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4680 | Open in IMG/M |
| 3300012202|Ga0137363_11444671 | Not Available | 578 | Open in IMG/M |
| 3300012203|Ga0137399_11417038 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
| 3300012205|Ga0137362_10021485 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 4983 | Open in IMG/M |
| 3300012205|Ga0137362_10066502 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 2974 | Open in IMG/M |
| 3300012207|Ga0137381_10065536 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3028 | Open in IMG/M |
| 3300012207|Ga0137381_10242137 | All Organisms → cellular organisms → Bacteria | 1567 | Open in IMG/M |
| 3300012209|Ga0137379_10028464 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium | 5378 | Open in IMG/M |
| 3300012209|Ga0137379_10134962 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2371 | Open in IMG/M |
| 3300012209|Ga0137379_10696035 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 922 | Open in IMG/M |
| 3300012210|Ga0137378_10513358 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1106 | Open in IMG/M |
| 3300012285|Ga0137370_10439838 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 793 | Open in IMG/M |
| 3300012349|Ga0137387_10793559 | All Organisms → cellular organisms → Bacteria | 685 | Open in IMG/M |
| 3300012351|Ga0137386_10443338 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 935 | Open in IMG/M |
| 3300012361|Ga0137360_10020713 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4390 | Open in IMG/M |
| 3300012361|Ga0137360_10047078 | All Organisms → cellular organisms → Bacteria | 3088 | Open in IMG/M |
| 3300012361|Ga0137360_10617796 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 928 | Open in IMG/M |
| 3300012363|Ga0137390_10082475 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3162 | Open in IMG/M |
| 3300012363|Ga0137390_11727351 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 559 | Open in IMG/M |
| 3300012363|Ga0137390_11963461 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 512 | Open in IMG/M |
| 3300012582|Ga0137358_10050419 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2772 | Open in IMG/M |
| 3300012582|Ga0137358_10413736 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 911 | Open in IMG/M |
| 3300012683|Ga0137398_10344685 | All Organisms → cellular organisms → Bacteria | 1008 | Open in IMG/M |
| 3300012922|Ga0137394_10204942 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1685 | Open in IMG/M |
| 3300012923|Ga0137359_11763232 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300012925|Ga0137419_10232806 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1380 | Open in IMG/M |
| 3300012925|Ga0137419_10657511 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 846 | Open in IMG/M |
| 3300012927|Ga0137416_10763224 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 853 | Open in IMG/M |
| 3300012927|Ga0137416_11365689 | Not Available | 641 | Open in IMG/M |
| 3300012930|Ga0137407_10368161 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1326 | Open in IMG/M |
| 3300012931|Ga0153915_10439204 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1483 | Open in IMG/M |
| 3300012931|Ga0153915_13604567 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 500 | Open in IMG/M |
| 3300012957|Ga0164303_10077376 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1575 | Open in IMG/M |
| 3300012957|Ga0164303_10569302 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 739 | Open in IMG/M |
| 3300012971|Ga0126369_11267213 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 827 | Open in IMG/M |
| 3300012975|Ga0134110_10117991 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1081 | Open in IMG/M |
| 3300012989|Ga0164305_11752183 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 559 | Open in IMG/M |
| 3300013297|Ga0157378_11423008 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 737 | Open in IMG/M |
| 3300014159|Ga0181530_10618201 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 529 | Open in IMG/M |
| 3300014166|Ga0134079_10096584 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1122 | Open in IMG/M |
| 3300014201|Ga0181537_10965171 | Not Available | 577 | Open in IMG/M |
| 3300014498|Ga0182019_11027488 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 599 | Open in IMG/M |
| 3300015053|Ga0137405_1407287 | All Organisms → cellular organisms → Bacteria | 2520 | Open in IMG/M |
| 3300015054|Ga0137420_1205454 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1495 | Open in IMG/M |
| 3300015054|Ga0137420_1478576 | Not Available | 2543 | Open in IMG/M |
| 3300015082|Ga0167662_1007812 | All Organisms → cellular organisms → Bacteria | 1303 | Open in IMG/M |
| 3300015241|Ga0137418_10047541 | All Organisms → cellular organisms → Bacteria | 3947 | Open in IMG/M |
| 3300015241|Ga0137418_10060183 | All Organisms → cellular organisms → Bacteria | 3478 | Open in IMG/M |
| 3300015241|Ga0137418_10444444 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1049 | Open in IMG/M |
| 3300015242|Ga0137412_11205629 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 531 | Open in IMG/M |
| 3300015264|Ga0137403_10300969 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium nebraskense | 1499 | Open in IMG/M |
| 3300015264|Ga0137403_10883823 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 744 | Open in IMG/M |
| 3300015371|Ga0132258_10308153 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3897 | Open in IMG/M |
| 3300015373|Ga0132257_100010311 | All Organisms → cellular organisms → Bacteria | 9333 | Open in IMG/M |
| 3300016404|Ga0182037_11499086 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 598 | Open in IMG/M |
| 3300017943|Ga0187819_10591778 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 629 | Open in IMG/M |
| 3300017944|Ga0187786_10158455 | All Organisms → cellular organisms → Bacteria | 824 | Open in IMG/M |
| 3300018038|Ga0187855_10452938 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 748 | Open in IMG/M |
| 3300018085|Ga0187772_10829242 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 669 | Open in IMG/M |
| 3300018086|Ga0187769_11170748 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 582 | Open in IMG/M |
| 3300018090|Ga0187770_10282941 | All Organisms → cellular organisms → Bacteria | 1288 | Open in IMG/M |
| 3300019789|Ga0137408_1255009 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 908 | Open in IMG/M |
| 3300020062|Ga0193724_1082342 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 666 | Open in IMG/M |
| 3300020170|Ga0179594_10367904 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 545 | Open in IMG/M |
| 3300020199|Ga0179592_10272316 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 756 | Open in IMG/M |
| 3300020579|Ga0210407_10811840 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 721 | Open in IMG/M |
| 3300020581|Ga0210399_11147364 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 620 | Open in IMG/M |
| 3300020581|Ga0210399_11431239 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 539 | Open in IMG/M |
| 3300021046|Ga0215015_10437602 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 606 | Open in IMG/M |
| 3300021168|Ga0210406_10198553 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1664 | Open in IMG/M |
| 3300021170|Ga0210400_10115592 | All Organisms → cellular organisms → Bacteria | 2137 | Open in IMG/M |
| 3300021170|Ga0210400_10115971 | All Organisms → cellular organisms → Bacteria | 2133 | Open in IMG/M |
| 3300021178|Ga0210408_10770426 | Not Available | 755 | Open in IMG/M |
| 3300021180|Ga0210396_10094645 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2705 | Open in IMG/M |
| 3300021180|Ga0210396_10821883 | All Organisms → cellular organisms → Bacteria | 796 | Open in IMG/M |
| 3300021181|Ga0210388_11762107 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 511 | Open in IMG/M |
| 3300021377|Ga0213874_10085780 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1027 | Open in IMG/M |
| 3300021403|Ga0210397_10830919 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 714 | Open in IMG/M |
| 3300021404|Ga0210389_11237751 | Not Available | 573 | Open in IMG/M |
| 3300021405|Ga0210387_10583295 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 994 | Open in IMG/M |
| 3300021407|Ga0210383_10728747 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 851 | Open in IMG/M |
| 3300021420|Ga0210394_11404504 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 593 | Open in IMG/M |
| 3300021420|Ga0210394_11713948 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 526 | Open in IMG/M |
| 3300021432|Ga0210384_10192839 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1831 | Open in IMG/M |
| 3300021474|Ga0210390_10280275 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1412 | Open in IMG/M |
| 3300021478|Ga0210402_11196365 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 687 | Open in IMG/M |
| 3300021559|Ga0210409_10027622 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 5473 | Open in IMG/M |
| 3300021559|Ga0210409_10407875 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1215 | Open in IMG/M |
| 3300021559|Ga0210409_10454220 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1142 | Open in IMG/M |
| 3300021560|Ga0126371_10247525 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1895 | Open in IMG/M |
| 3300021560|Ga0126371_13577135 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
| 3300021560|Ga0126371_13790329 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 510 | Open in IMG/M |
| 3300022533|Ga0242662_10330354 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Propionibacteriaceae → Tessaracoccus → Tessaracoccus flavescens | 515 | Open in IMG/M |
| 3300024178|Ga0247694_1031585 | Not Available | 594 | Open in IMG/M |
| 3300024225|Ga0224572_1098409 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 540 | Open in IMG/M |
| 3300024283|Ga0247670_1036163 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 888 | Open in IMG/M |
| 3300024288|Ga0179589_10554351 | Not Available | 536 | Open in IMG/M |
| 3300024290|Ga0247667_1052453 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 758 | Open in IMG/M |
| 3300025474|Ga0208479_1004842 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2845 | Open in IMG/M |
| 3300025910|Ga0207684_10452857 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1102 | Open in IMG/M |
| 3300025916|Ga0207663_10796662 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 752 | Open in IMG/M |
| 3300025922|Ga0207646_11620607 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 558 | Open in IMG/M |
| 3300026088|Ga0207641_10857669 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 900 | Open in IMG/M |
| 3300026277|Ga0209350_1104981 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 672 | Open in IMG/M |
| 3300026296|Ga0209235_1276163 | Not Available | 514 | Open in IMG/M |
| 3300026310|Ga0209239_1035822 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2324 | Open in IMG/M |
| 3300026314|Ga0209268_1141766 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 591 | Open in IMG/M |
| 3300026343|Ga0209159_1276391 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 512 | Open in IMG/M |
| 3300026514|Ga0257168_1122510 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 580 | Open in IMG/M |
| 3300026515|Ga0257158_1091943 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 594 | Open in IMG/M |
| 3300026523|Ga0209808_1259725 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 555 | Open in IMG/M |
| 3300026532|Ga0209160_1271005 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 576 | Open in IMG/M |
| 3300026538|Ga0209056_10655212 | Not Available | 529 | Open in IMG/M |
| 3300026823|Ga0207759_102916 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1482 | Open in IMG/M |
| 3300027063|Ga0207762_1056908 | Not Available | 569 | Open in IMG/M |
| 3300027288|Ga0208525_1036014 | Not Available | 608 | Open in IMG/M |
| 3300027528|Ga0208985_1073634 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 658 | Open in IMG/M |
| 3300027645|Ga0209117_1113688 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella rosea | 729 | Open in IMG/M |
| 3300027651|Ga0209217_1028264 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1765 | Open in IMG/M |
| 3300027651|Ga0209217_1120775 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 738 | Open in IMG/M |
| 3300027654|Ga0209799_1058532 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 864 | Open in IMG/M |
| 3300027674|Ga0209118_1069811 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1014 | Open in IMG/M |
| 3300027678|Ga0209011_1172971 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 599 | Open in IMG/M |
| 3300027681|Ga0208991_1177615 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 623 | Open in IMG/M |
| 3300027729|Ga0209248_10093443 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 908 | Open in IMG/M |
| 3300027765|Ga0209073_10308057 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_59_13 | 629 | Open in IMG/M |
| 3300027787|Ga0209074_10099868 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella rosea | 979 | Open in IMG/M |
| 3300027846|Ga0209180_10086255 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1777 | Open in IMG/M |
| 3300027875|Ga0209283_10263295 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1142 | Open in IMG/M |
| 3300027875|Ga0209283_10266320 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1134 | Open in IMG/M |
| 3300027911|Ga0209698_10576100 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 867 | Open in IMG/M |
| 3300028047|Ga0209526_10810375 | Not Available | 579 | Open in IMG/M |
| 3300028047|Ga0209526_10933043 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300028536|Ga0137415_10050720 | All Organisms → cellular organisms → Bacteria | 4026 | Open in IMG/M |
| 3300028906|Ga0308309_11041869 | Not Available | 708 | Open in IMG/M |
| 3300029636|Ga0222749_10688152 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 560 | Open in IMG/M |
| 3300030706|Ga0310039_10014394 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4013 | Open in IMG/M |
| 3300030906|Ga0302314_10865406 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 893 | Open in IMG/M |
| 3300031543|Ga0318516_10372950 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 823 | Open in IMG/M |
| 3300031543|Ga0318516_10497397 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 700 | Open in IMG/M |
| 3300031545|Ga0318541_10073149 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1802 | Open in IMG/M |
| 3300031573|Ga0310915_10194326 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1417 | Open in IMG/M |
| 3300031679|Ga0318561_10517644 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 657 | Open in IMG/M |
| 3300031680|Ga0318574_10483654 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 725 | Open in IMG/M |
| 3300031715|Ga0307476_10025752 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3868 | Open in IMG/M |
| 3300031715|Ga0307476_10034533 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3382 | Open in IMG/M |
| 3300031715|Ga0307476_10242021 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1316 | Open in IMG/M |
| 3300031718|Ga0307474_10203771 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1506 | Open in IMG/M |
| 3300031718|Ga0307474_11037802 | All Organisms → cellular organisms → Bacteria | 649 | Open in IMG/M |
| 3300031720|Ga0307469_10543357 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1028 | Open in IMG/M |
| 3300031736|Ga0318501_10028121 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2456 | Open in IMG/M |
| 3300031753|Ga0307477_10072454 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2382 | Open in IMG/M |
| 3300031754|Ga0307475_11456719 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 526 | Open in IMG/M |
| 3300031820|Ga0307473_10321061 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 983 | Open in IMG/M |
| 3300031823|Ga0307478_10604685 | Not Available | 917 | Open in IMG/M |
| 3300031823|Ga0307478_10718823 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 837 | Open in IMG/M |
| 3300031833|Ga0310917_11214797 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 501 | Open in IMG/M |
| 3300031859|Ga0318527_10473309 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 534 | Open in IMG/M |
| 3300031896|Ga0318551_10175630 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1178 | Open in IMG/M |
| 3300031897|Ga0318520_11065027 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 512 | Open in IMG/M |
| 3300031912|Ga0306921_12618155 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 520 | Open in IMG/M |
| 3300031945|Ga0310913_10441041 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 924 | Open in IMG/M |
| 3300031945|Ga0310913_10778613 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 675 | Open in IMG/M |
| 3300031959|Ga0318530_10248357 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 733 | Open in IMG/M |
| 3300031962|Ga0307479_11027742 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 792 | Open in IMG/M |
| 3300031962|Ga0307479_11983877 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 531 | Open in IMG/M |
| 3300032180|Ga0307471_103095861 | Not Available | 590 | Open in IMG/M |
| 3300032205|Ga0307472_100682637 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 921 | Open in IMG/M |
| 3300032205|Ga0307472_101423440 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 673 | Open in IMG/M |
| 3300032828|Ga0335080_10677153 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1077 | Open in IMG/M |
| 3300032828|Ga0335080_11712076 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 616 | Open in IMG/M |
| 3300032892|Ga0335081_11010076 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 968 | Open in IMG/M |
| 3300032898|Ga0335072_10322561 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1713 | Open in IMG/M |
| 3300033475|Ga0310811_10452814 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1372 | Open in IMG/M |
| 3300033561|Ga0371490_1159238 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 553 | Open in IMG/M |
| 3300034125|Ga0370484_0232408 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 509 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 27.46% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 17.62% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 6.97% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 6.56% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.92% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.10% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.46% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.46% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.05% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.05% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.05% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.64% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.64% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.64% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.64% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.23% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.23% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.82% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.82% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.82% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.82% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.82% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.82% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.82% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.41% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.41% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.41% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.41% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.41% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.41% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.41% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 0.41% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.41% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.41% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.41% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.41% |
| Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 0.41% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.41% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.41% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.41% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001081 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M3 | Environmental | Open in IMG/M |
| 3300001137 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M3 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300002908 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
| 3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005883 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_80N_302 | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300005944 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-048 | Environmental | Open in IMG/M |
| 3300006041 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009525 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG | Environmental | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009621 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_150 | Environmental | Open in IMG/M |
| 3300009634 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_150 | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010321 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010364 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014159 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_60_metaG | Environmental | Open in IMG/M |
| 3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
| 3300014201 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaG | Environmental | Open in IMG/M |
| 3300014498 | Permafrost microbial communities from Stordalen Mire, Sweden - 812E2M metaG | Environmental | Open in IMG/M |
| 3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015082 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-11c, vegetated hydrological feature) | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017944 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_10_20_MG | Environmental | Open in IMG/M |
| 3300018038 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10 | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300020062 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a1 | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021046 | Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depth | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Host-Associated | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022533 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300024178 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK35 | Environmental | Open in IMG/M |
| 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZU5 | Host-Associated | Open in IMG/M |
| 3300024283 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK11 | Environmental | Open in IMG/M |
| 3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300024290 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK08 | Environmental | Open in IMG/M |
| 3300025474 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-3 deep-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026277 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026296 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026314 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 (SPAdes) | Environmental | Open in IMG/M |
| 3300026343 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 (SPAdes) | Environmental | Open in IMG/M |
| 3300026514 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-13-B | Environmental | Open in IMG/M |
| 3300026515 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-03-A | Environmental | Open in IMG/M |
| 3300026523 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 (SPAdes) | Environmental | Open in IMG/M |
| 3300026532 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 (SPAdes) | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300026823 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 19 (SPAdes) | Environmental | Open in IMG/M |
| 3300027063 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 37 (SPAdes) | Environmental | Open in IMG/M |
| 3300027288 | Soil and rhizosphere microbial communities from Laval, Canada - mgHMC (SPAdes) | Environmental | Open in IMG/M |
| 3300027528 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027645 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027651 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027654 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027674 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027678 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027681 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027729 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027765 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes) | Environmental | Open in IMG/M |
| 3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030706 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG (v2) | Environmental | Open in IMG/M |
| 3300030906 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N2_3 | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031859 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25 | Environmental | Open in IMG/M |
| 3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031959 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
| 3300033475 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC | Environmental | Open in IMG/M |
| 3300033561 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB28FN SIP fraction | Environmental | Open in IMG/M |
| 3300034125 | Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_tus_01_15 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12662J13196_10195611 | 3300001081 | Forest Soil | NLLYRRKADMVESKEEREALLKQADDLVDKVKEIKQKRSEQPQPS* |
| JGI12637J13337_10066862 | 3300001137 | Forest Soil | ESNDERASLKKQADDLLEKIKEIKQKRAEQPPPQAS* |
| JGIcombinedJ26739_1012081752 | 3300002245 | Forest Soil | VESADERANLKKQADELIDKVKEIKQKRAEQPQQPS* |
| JGI25382J43887_100862082 | 3300002908 | Grasslands Soil | KADMVESADERASLLKQADDLVDKVKEIKQKRAEQPQPAN* |
| Ga0062385_103203662 | 3300004080 | Bog Forest Soil | LYRRKADTVESADERDALIKQAEDLIDQVKEIKQKRADQPQPAGG* |
| Ga0062389_1048226152 | 3300004092 | Bog Forest Soil | LYRRKADMVESADERASLQKQADDLLDKIKEIKQKRLDQQQQLN* |
| Ga0066672_103181251 | 3300005167 | Soil | YRRKADMVESAEERASLKKQADDLVDKVKEIKQKRAEQPQQTS* |
| Ga0070711_1014951281 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | NLLYRRKADLVETPDERANLLKQADDLVDKVKEIKQKRADQPTQPS* |
| Ga0066687_107265422 | 3300005454 | Soil | MAYLSLLYRRKADMVESAQERDDLEKQADVLLDKVKEIKQKRAEQPHPAS* |
| Ga0066691_103816132 | 3300005586 | Soil | ADMVESAEERASLIKQADDLLDKVKEIKQQKANQPQKS* |
| Ga0066691_109230461 | 3300005586 | Soil | RRKADMVESADERSALLKQADDLVDKVKEIKQKRAEQPQPAN* |
| Ga0066903_1017618282 | 3300005764 | Tropical Forest Soil | LYRRKADMVESTAERDQLTKEADDLLDKVKEIKQKRAEQPTPAT* |
| Ga0066903_1018960982 | 3300005764 | Tropical Forest Soil | MSLPAGYRYRRKADTVNYQDERDGLLKMADELVDKVKEIKQKRAEQ* |
| Ga0066903_1076276922 | 3300005764 | Tropical Forest Soil | LLRRKADMVESAAERDALTKQADDLLDKVKELKQKRAEQPTPAA* |
| Ga0068863_1008727401 | 3300005841 | Switchgrass Rhizosphere | RRKADTVESSAERANYQKQADDLVDKVKEVKQKRASQPAPTT* |
| Ga0075299_10259072 | 3300005883 | Rice Paddy Soil | RRKADVVETEQERDDLLKQADDLVDKVKEIKQRKLDQQSQQSPAS* |
| Ga0070766_106227621 | 3300005921 | Soil | RKADMVESADERAALQKQADELIDKVKEIKQKRSEQPTAPSS* |
| Ga0070766_106614871 | 3300005921 | Soil | ADERAALVKQADDLIEQVKEIKQKRADQPQPAGG* |
| Ga0066788_100929061 | 3300005944 | Soil | YLNLLYRRKADMVEGKDQREALKKQADDLVEKVKEIKQRRADQPQAIS* |
| Ga0075023_1002592792 | 3300006041 | Watersheds | ADMVESASERDALTKQADDLLDKVKEIKQKRAAEPEKPA* |
| Ga0070716_1002450341 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | KADMVESADERASYQKQADDLVEKVKEIKQKRAEQPQQTS* |
| Ga0070765_1012942802 | 3300006176 | Soil | LYRRKADMVESADERVALEKQADDLLEKIKEIKQKRLDQQQQTP* |
| Ga0070765_1018623742 | 3300006176 | Soil | LLYRRKADMVESADERASLQKQADDLLDKIKEIKQKRLDQQQQVS* |
| Ga0068871_1023054931 | 3300006358 | Miscanthus Rhizosphere | DTVESAEERSTLVKQADDLVDKVKEVKQKRASQPQPTN* |
| Ga0079222_101788134 | 3300006755 | Agricultural Soil | YRRKADMVESADERASLKKQADELIDKIKEIKQHRAEQPQQPS* |
| Ga0066659_109446912 | 3300006797 | Soil | MVESAEERASLKKQADDLVDKVKEIKQKRAEQPQQTS* |
| Ga0079221_101429681 | 3300006804 | Agricultural Soil | ESADERASLQKQADDLLDKIKEIKQKRLEQQQSS* |
| Ga0099793_100188501 | 3300007258 | Vadose Zone Soil | RKADMVESTAERDALTKQADDLLDHVKEIKQKRADAPEQKPAS* |
| Ga0099794_100282891 | 3300007265 | Vadose Zone Soil | MVESAEERASLIKQADDLLDKVKEIKQQKANQPQRS* |
| Ga0066710_1024366711 | 3300009012 | Grasslands Soil | ESAQERDDLEKQADVLLDKVKEIKQKRAEQPHPAS |
| Ga0099830_107752292 | 3300009088 | Vadose Zone Soil | RKADMVESADERAALLKQADDLVDKVKEIKQKRAEQPQPAS* |
| Ga0099828_104683371 | 3300009089 | Vadose Zone Soil | MVESADERAALLKQADDLVDKVKEIKQKRAEQPQQPS* |
| Ga0099828_111911281 | 3300009089 | Vadose Zone Soil | ESADERAALLKQADDLVDKVKEIKQKRSEQPQQPS* |
| Ga0099827_101191681 | 3300009090 | Vadose Zone Soil | RRKADMVESAEERANLQNQADALLDKVKEIKQKRAERPQPGS* |
| Ga0099827_114047162 | 3300009090 | Vadose Zone Soil | NLLYRRKADMVESKEEREALLKQADDLVDKVKEIKQKRSEQPQTS* |
| Ga0116220_104694272 | 3300009525 | Peatlands Soil | YRRKTDTVASPTEREQLNKMADDLLDKVKEIKQGRALAAPQQPN* |
| Ga0105237_113542671 | 3300009545 | Corn Rhizosphere | KADLVETPDERANLLKQADDLVDKVKEIKQKRADQPTQPS* |
| Ga0116116_11598721 | 3300009621 | Peatland | LYRRKADIVESAGERDALTKQADDLLDKVKEIKQKKAEEAERKSAQ* |
| Ga0116124_10753551 | 3300009634 | Peatland | VESAGERDALTKQADDLLDKVKEIKQKKAEEAERKSAQ* |
| Ga0126374_102164162 | 3300009792 | Tropical Forest Soil | MVESASERDALTKQADDLLDKVKEIKQKRAEQPSSGVAQ* |
| Ga0126374_117192921 | 3300009792 | Tropical Forest Soil | LLYRRKADMVESANQRDELLKQADGLVDKVKEIKQKRAEQPQPAN* |
| Ga0126380_116757902 | 3300010043 | Tropical Forest Soil | DMVDSTAERDALTKQADDLLDKVKEIKQKRAEQPEQKPAS* |
| Ga0126382_112420061 | 3300010047 | Tropical Forest Soil | ADTVESSSERAELQKQADDLVDKVKEVKQKRASQPTPTT* |
| Ga0126373_126172752 | 3300010048 | Tropical Forest Soil | LLLRRKADMVESAAERDALTKQADDLLDKVKELKQKRAEQPTPAA* |
| Ga0134067_102215262 | 3300010321 | Grasslands Soil | MAYLSLLYRRKADIVANEAQREEYIKMADDFIDQVKEIKQKRAEQRSQP* |
| Ga0126370_110440201 | 3300010358 | Tropical Forest Soil | ADMVESADERDNFLKQADDLVDKVKEIKQRRAEQPQPAN* |
| Ga0126376_115808711 | 3300010359 | Tropical Forest Soil | DMVASTDERNQLLKQADDLVDKVKEIKQKRAEQPQNAGS* |
| Ga0126376_129213801 | 3300010359 | Tropical Forest Soil | SNDERASLQKQADDLLDKIKEIKQKRAEQPQQPS* |
| Ga0126378_105634342 | 3300010361 | Tropical Forest Soil | LNLMYRRKADMVESANERDNLLRQADALVDKVKEIKQKRAEQPQPAN* |
| Ga0126378_129252552 | 3300010361 | Tropical Forest Soil | VDSADERGNYLKQADDLVDKIKEIKQKRAEQPQPAS* |
| Ga0134066_100135411 | 3300010364 | Grasslands Soil | ESAQERDDLEKRADVLLDRVKEVKQKRAEQPQPTS* |
| Ga0126379_102060863 | 3300010366 | Tropical Forest Soil | ESQDERTSYLKQADDLVDKVKEIKQSRASQPQPG* |
| Ga0126379_124905452 | 3300010366 | Tropical Forest Soil | SSAERDSYTKMADDLLDKVKEIKQKRAEQPEQKPAS* |
| Ga0136449_1012650661 | 3300010379 | Peatlands Soil | KADMVESADERSALLKQADDLVDKVKEIKQKRAEAPPPAS* |
| Ga0126383_134775051 | 3300010398 | Tropical Forest Soil | RRKADLVQSAEERDNYLKQADDLVDKVKEVKQKRAEQPQPAS* |
| Ga0137392_105843443 | 3300011269 | Vadose Zone Soil | ESSAERDALTKQADDLLDKVKEIKQKRAEQPEQKPAS* |
| Ga0137392_110500251 | 3300011269 | Vadose Zone Soil | ADMVESAAERDTLKKQADDLVEKVKEIKQRRSEQPQQAS* |
| Ga0137392_112622372 | 3300011269 | Vadose Zone Soil | YRRKADMVESAEERASLRKQADDLLDKVKEIKQKRAEQPQQPS* |
| Ga0137392_114169011 | 3300011269 | Vadose Zone Soil | DSADQRADLQKQADDLVDKVKEVKQKRASQPVPAAS* |
| Ga0137393_107467711 | 3300011271 | Vadose Zone Soil | DMVESADERAALLKQADDLVDKVKEIKQKRAEQPQQPAN* |
| Ga0137393_111708631 | 3300011271 | Vadose Zone Soil | LYRRKADMVESAAERDTLKKQADDLVEKVKEIKQRRSEQPQQAS* |
| Ga0137389_102933801 | 3300012096 | Vadose Zone Soil | TADERASLEKQADDLLDKIKEIKQKRAEQPQSST* |
| Ga0137389_106825784 | 3300012096 | Vadose Zone Soil | VESADERAALLKQADDLVDKVKEIKQKRSEQPQQPS* |
| Ga0137389_111963622 | 3300012096 | Vadose Zone Soil | ESADERAALLKQADDLVDKVKEIKQKRAEQPQPAN* |
| Ga0137388_103043341 | 3300012189 | Vadose Zone Soil | MVESAEERAKLQKEADDLIDRVKEIKQKRAEQVQPGS* |
| Ga0137388_103332752 | 3300012189 | Vadose Zone Soil | YRRKADMVESADERAALLKQADDLVDKVKEIKQKRAEQPQQPS* |
| Ga0137388_115813481 | 3300012189 | Vadose Zone Soil | LLYRRKADMVESKEEREALLKQADDLVDKVKEIKQKRSEQPQTS* |
| Ga0137382_102833083 | 3300012200 | Vadose Zone Soil | LYRRKADMVESADERANLKKQADELIDKVKEIKQKRAEQPQSPS* |
| Ga0137363_100180721 | 3300012202 | Vadose Zone Soil | NLLYRRKADMVDSKEEREALLKQADDLVDKVKEIKQKRSEQPQAS* |
| Ga0137363_114446711 | 3300012202 | Vadose Zone Soil | NLLYRRKADMVESTAERDALTKQADDLLDHVKEIKQKRAEAPEQKPAS* |
| Ga0137399_114170382 | 3300012203 | Vadose Zone Soil | RRKADMVESADERAALLKQADDLVDKVKEIKQKRAEQPQQIG* |
| Ga0137362_100214851 | 3300012205 | Vadose Zone Soil | ADMVESADERASLLKQADDLVDKVKEIKQKRAEQPQQSS* |
| Ga0137362_100665021 | 3300012205 | Vadose Zone Soil | LDRRKADMVESAEERSNLQNQADALLDKVKEIKQKRAEQPQPGS* |
| Ga0137381_100655361 | 3300012207 | Vadose Zone Soil | RRKADMVESANERASLKKQADDLVDKVKEIKQKRAEQPQQAS* |
| Ga0137381_102421373 | 3300012207 | Vadose Zone Soil | RRKADTVETAEERDALLKQADDLVDKVKEVKQKRAEQPQPAS* |
| Ga0137379_100284641 | 3300012209 | Vadose Zone Soil | SAEERASLQKQADDLIDKVKEIKQKRAEQPQPGS* |
| Ga0137379_101349624 | 3300012209 | Vadose Zone Soil | DMVESAEERASLQKQADDLIDKVKEIKQKRAEQPQPGS* |
| Ga0137379_106960352 | 3300012209 | Vadose Zone Soil | MVESADERASLLKQADDLVDKVKEIKQKRAEQPQQSS* |
| Ga0137378_105133583 | 3300012210 | Vadose Zone Soil | YRRKADMVESAEERASLQKQADDLIDKVKEIKQKRAEQPQPGS* |
| Ga0137370_104398382 | 3300012285 | Vadose Zone Soil | ESANERASLKKQADDLVDKVKEIKQKRAEQPQQAS* |
| Ga0137387_107935591 | 3300012349 | Vadose Zone Soil | SAEERASLKKQADDLVDKVKEIKQKRAEQPQQTSSN* |
| Ga0137386_104433382 | 3300012351 | Vadose Zone Soil | VESADQRDDLLKQADALVDKVKEVKQKRAEQPQPAN* |
| Ga0137360_100207131 | 3300012361 | Vadose Zone Soil | DMVDSKEEREALLKQADDLVDKVKEIKQKRSEQPQAS* |
| Ga0137360_100470781 | 3300012361 | Vadose Zone Soil | LYRRKADMVESVEEREALKKQADDLLDKVKEIKQKRAEQPQSTS* |
| Ga0137360_106177962 | 3300012361 | Vadose Zone Soil | ADMVESAEERSNLQNQADALLDKVKEIKQKRAEQPQPGS* |
| Ga0137390_100824751 | 3300012363 | Vadose Zone Soil | DMVESADERAALLKQADDLVDKVKEIKQKRAEQPQQAS* |
| Ga0137390_117273512 | 3300012363 | Vadose Zone Soil | DMVESADERASLLKQADDLVDKVKEIKQKRAEQPQQAS* |
| Ga0137390_119634612 | 3300012363 | Vadose Zone Soil | LYRRKADMVESADERNNYTKQADDLLDKVKEIKQKRAEQPPPA* |
| Ga0137358_100504196 | 3300012582 | Vadose Zone Soil | ESADERANLKKQADELIDKVKEIKQKRAEQPQQAN* |
| Ga0137358_104137362 | 3300012582 | Vadose Zone Soil | VQSKEEREALLKQAEDLVDKVKEIKQKRSEQPQSS* |
| Ga0137398_103446851 | 3300012683 | Vadose Zone Soil | YRRKADMVESADERASLKKQADELIDKVKEIKQKRSEQPQQAS* |
| Ga0137394_102049422 | 3300012922 | Vadose Zone Soil | LLYRRKADMVESAEERARLQKEADDLIDKVKEIKQKRAEQVQPGS* |
| Ga0137359_117632322 | 3300012923 | Vadose Zone Soil | ESADERAALLKQADDLVDKVKEIKQKRAEQPQQIG* |
| Ga0137419_102328061 | 3300012925 | Vadose Zone Soil | LYRRKADTVESADERASLQKQADDLVDKVKEVKQRRASQPAPTT* |
| Ga0137419_106575111 | 3300012925 | Vadose Zone Soil | LYRRKADMVESADERAALLKQADDLVDKVKEIKQKRAEQPQQIS* |
| Ga0137416_107632242 | 3300012927 | Vadose Zone Soil | LYRRKADMVESAEERAALLKQADDLVDKVKEIKQKRAEQPQPGS* |
| Ga0137416_113656891 | 3300012927 | Vadose Zone Soil | RKADMVESTAERDALTKQADDLLDHVKEIKQKRAEAPEQKPAS* |
| Ga0137407_103681612 | 3300012930 | Vadose Zone Soil | ADMVESAEERANLQKQADDLIDKVKEIKQKRAEQVQPNS* |
| Ga0153915_104392042 | 3300012931 | Freshwater Wetlands | ADLVETEQERDDLLKQADDLVDKVKEIKQRKLDQQSRQPAS* |
| Ga0153915_136045671 | 3300012931 | Freshwater Wetlands | LVETEQERDDLLKQADDLVDKVKEIKQRKLDQQSQQAPAS* |
| Ga0164303_100773762 | 3300012957 | Soil | ESADERASLQKQADDLIDKVKEIKQKRAEQPQSIS* |
| Ga0164303_105693021 | 3300012957 | Soil | NLLYRRKADMVESADERNNFLKQADDLVDKVKEIKQRRSEQPQTTS* |
| Ga0126369_112672131 | 3300012971 | Tropical Forest Soil | MVESAAERDALTKQADDLLDKVKELKQKRAEQPTPAA* |
| Ga0134110_101179912 | 3300012975 | Grasslands Soil | YRRKADTVASESAREQLIEMADDLVDKVKEIKQKRAEASRQP* |
| Ga0164305_117521831 | 3300012989 | Soil | RRKADMVESADERASLLKQADDLVDKVKEIKQRRADQPQQTS* |
| Ga0157378_114230082 | 3300013297 | Miscanthus Rhizosphere | KADTVESSSERADLQKQADDLVDKVKEVKQKRASQAPPTT* |
| Ga0181530_106182011 | 3300014159 | Bog | LLLRRKADMVASADDRDDLIKQANDLVDKVKEIKERKAATPAQP* |
| Ga0134079_100965843 | 3300014166 | Grasslands Soil | YLNLLYRRKADMVESANERASLKKQADDLVDKVKEIKQKRAEQPQQAS* |
| Ga0181537_109651711 | 3300014201 | Bog | NLLYRRKADMVESTDERNALKKQADDLVEQVKEIKQKKADQPQPAGG* |
| Ga0182019_110274882 | 3300014498 | Fen | ESAQERDSLTKQADDLLDKVKEIKQKRSEQPQPPTT* |
| Ga0137405_14072877 | 3300015053 | Vadose Zone Soil | DMVESVEEREALKKQADDLLDKVKEIKQKRAEQPQSTS* |
| Ga0137420_12054541 | 3300015054 | Vadose Zone Soil | ESADERAALLKQADDLVDKVKEIKQKRAEQPQQIS* |
| Ga0137420_14785762 | 3300015054 | Vadose Zone Soil | MVESKEEREALLKQAEDLVDKVKEIKQKRSEQPQPS* |
| Ga0167662_10078122 | 3300015082 | Glacier Forefield Soil | MVESADERASYQKQADALVDKVKEIKQKRAEQPQQAT* |
| Ga0137418_100475413 | 3300015241 | Vadose Zone Soil | RKADMVESADERAALLKQADDLVDKVKEIKQKRAEQPQQPS* |
| Ga0137418_100601831 | 3300015241 | Vadose Zone Soil | RKADMVESADERAALLKQADDLVDKVKEIKQKRAEQPQQIG* |
| Ga0137418_104444442 | 3300015241 | Vadose Zone Soil | RKADMVESADERAALLKQADDLVDKVKEIKQKRAEQPQQIS* |
| Ga0137412_112056291 | 3300015242 | Vadose Zone Soil | TLLYRRKADMVESANERASLKKQADELVDKVKEIKQKRAEQPQQAS* |
| Ga0137403_103009693 | 3300015264 | Vadose Zone Soil | RRKADMVESSAERDTLTKQADDLLDKVKEIKQKRAEQADQKPAA* |
| Ga0137403_108838232 | 3300015264 | Vadose Zone Soil | ADERASLQKQADELVDKVKEVKQKRASQPAPTTSN* |
| Ga0132258_103081534 | 3300015371 | Arabidopsis Rhizosphere | YRRKADMVESADERASLLKQADDLVDKVKEIKQRRADQPQQTS* |
| Ga0132257_1000103118 | 3300015373 | Arabidopsis Rhizosphere | DAVESASERADLQKQADDLGDKVKEVKQKRASQPQPVT* |
| Ga0182037_114990861 | 3300016404 | Soil | KADMVEAASERDALTKQADDLLDKVKEIKQKRAEQPTSGVAQ |
| Ga0187819_105917781 | 3300017943 | Freshwater Sediment | MVESTAERDDYTKQADDLLDKVKEIKQKRSEQPQPAS |
| Ga0187786_101584551 | 3300017944 | Tropical Peatland | NLLYRRKADMVESSAERDSYTKMADDLLDKVKEIKQKRAEQPEQKPAS |
| Ga0187855_104529382 | 3300018038 | Peatland | LLRRKADMVASADDRDDLIKQANDLVDKVKEIKERKATATAQP |
| Ga0187772_108292421 | 3300018085 | Tropical Peatland | YLNLLYRRKADMVESAEERENLKKQAEDLVEKVKEIKQKRLDQAQPS |
| Ga0187769_111707482 | 3300018086 | Tropical Peatland | RKADMVESTAERDNYTKMADDLLDKVKEIKQKRAEQPTPAS |
| Ga0187770_102829412 | 3300018090 | Tropical Peatland | YLNLLYRRKADMVDSADERNNLLTQADALVDKVKEIKQKRAEQPQPQAG |
| Ga0137408_12550091 | 3300019789 | Vadose Zone Soil | MVESNDERAGLKKQADDLLEKIKEIKQKRAEQPQPQSS |
| Ga0193724_10823422 | 3300020062 | Soil | DTVESADERASLQKQADDLVDKVKEVKQRRASQPAPTT |
| Ga0179594_103679041 | 3300020170 | Vadose Zone Soil | NLLYRRKADTVESADERASLQKQADDLVDKVKEVKQRRASQPAPTT |
| Ga0179592_102723162 | 3300020199 | Vadose Zone Soil | RKADMVESADERAALLKQADDLVDKVKEIKQKRAEQPQQTS |
| Ga0210407_108118402 | 3300020579 | Soil | LYRRKADMVESNDERASLKKQADDLLEKIKEIKQKRAEQPQPAS |
| Ga0210399_111473642 | 3300020581 | Soil | DMVESASERDALTKQADDLLDKVKEIKQKRAAEPEKPA |
| Ga0210399_114312391 | 3300020581 | Soil | TADERAALVKQADDLIEQVKEIKQKRADQPQPAGG |
| Ga0215015_104376021 | 3300021046 | Soil | ADMVETADERASLERQADDLLDKIKEIKQKRAEQPQSST |
| Ga0210406_101985531 | 3300021168 | Soil | RKADTVETADERAALVKQADDLIEQVKEIKQKRADQPQPAGG |
| Ga0210400_101155921 | 3300021170 | Soil | RKADMVESNDERASLKKQADDLLEKIKEIKQKRAEQPQPQSS |
| Ga0210400_101159715 | 3300021170 | Soil | DMVESADERANLKKQADELIDKVKEIKQKRAEQPQQPS |
| Ga0210408_107704262 | 3300021178 | Soil | LYRRKADMVESSAERDGLTKQADDLLDKVKEIKQKRSEQTEQKPAT |
| Ga0210396_100946451 | 3300021180 | Soil | MAYLGLLYRRKADMVESADERAALEKQADDLLEKIKEIKQKRLDQQQQMP |
| Ga0210396_108218832 | 3300021180 | Soil | YRRKADMVESAEERASYQKQADDLVEKVKEIKQKRADQPQQTS |
| Ga0210388_117621072 | 3300021181 | Soil | GLLYRRKADMVDSMDERASLQKQADDLLDKIKEIKQKRLDQQQQLS |
| Ga0213874_100857802 | 3300021377 | Plant Roots | RKADMVESQAERDQLTKQADDLLDKVKEIKQKRAEQPTPPQT |
| Ga0210397_108309192 | 3300021403 | Soil | DMVETPDERASLLKQADDLVDKVKEIKQKRADQPQTPS |
| Ga0210389_112377511 | 3300021404 | Soil | YRRKADLVETPDERANLLKQADDLVDKVKEIKQKRADQPTQPS |
| Ga0210387_105832952 | 3300021405 | Soil | SLLYRRKADMVESADERASLEKQADELLEKIKEIKQKRLDQQQQTP |
| Ga0210383_107287472 | 3300021407 | Soil | ADMVESASERDTLTKQADDLLDKVKEIKQKRSEQPTPAVS |
| Ga0210394_114045041 | 3300021420 | Soil | RRKADMVESAGERESLRKQADELLDKVKEIKQKRSEQPQSPS |
| Ga0210394_117139481 | 3300021420 | Soil | KADMVESASERDTLTKQADDLLDKVKEIKQKRSEQPTPAVS |
| Ga0210384_101928393 | 3300021432 | Soil | LYRRKADMVESAEERAALQKQADELIDKVKEIKQKRAEQPQPPAP |
| Ga0210390_102802752 | 3300021474 | Soil | VDSMDERASLQKQADDLLDKIKEIKQKRLDQQQQLS |
| Ga0210402_111963652 | 3300021478 | Soil | ESETERAALVKQADDLIDKVKDIKQKRADQPTPAGG |
| Ga0210409_100276221 | 3300021559 | Soil | MAYLGLLYRRKADMVESADERASLQKQADDLLDKIKEIKQKRLDLQQQLS |
| Ga0210409_104078751 | 3300021559 | Soil | ESSAERDALTKQADDLLDKVKEIKQKRAEQPEQKPAS |
| Ga0210409_104542201 | 3300021559 | Soil | RKADMVESSAERDTLTKQADDLLDKVKEIKQKRAEQPEQKPAS |
| Ga0126371_102475251 | 3300021560 | Tropical Forest Soil | MSLPAGYRYRRKADTVNYQDERDGLLKMADELVDKVKEIKQKRAEQ |
| Ga0126371_135771352 | 3300021560 | Tropical Forest Soil | FRRKADMVGSADERDNYLKQADDLVDKVKEIKQKRAEQPQPAN |
| Ga0126371_137903291 | 3300021560 | Tropical Forest Soil | LLLRRKADMVESAAERDALTKQADDLLDKVKELKQKRAEQPTPAA |
| Ga0242662_103303541 | 3300022533 | Soil | LSLLYRCKADMVESADERASLQKQADDLLDKIKEIKQKRLDQQQQTP |
| Ga0247694_10315851 | 3300024178 | Soil | SSAERDTLTKQADDLLDKVKEIKQKRAEQADQKPAS |
| Ga0224572_10984092 | 3300024225 | Rhizosphere | RRKADMVESADERASLEKQADDLLEKIKEIKQKRIDQQQQTP |
| Ga0247670_10361631 | 3300024283 | Soil | TYLNLLYRRKADMVESSAERDTLTKQADDLLDKVKEIKQKRAEQADQKPAS |
| Ga0179589_105543512 | 3300024288 | Vadose Zone Soil | KADMVESADERANLKKQADELIDKVKEIKQKRAEQPQQAN |
| Ga0247667_10524531 | 3300024290 | Soil | YRRKADAVDSADQRAELQKQADDLVDKVKEVKQKRASQPAPAAS |
| Ga0208479_10048421 | 3300025474 | Arctic Peat Soil | KADMVDSTAERDSYTKQADDLLDKVKEIKQKRAEEAEKAPPV |
| Ga0207684_104528572 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | TVASADERAALLKQADDLVDRVKEVKQKRASQPTPST |
| Ga0207663_107966622 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | DMVESSTERDALTKQADELLDKVKEIKQKKAEQPSPTPGS |
| Ga0207646_116206072 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | TVESATERASYQKQADDLVDKVKEVKQKRASQPQPTT |
| Ga0207641_108576691 | 3300026088 | Switchgrass Rhizosphere | YRRKADTVESSAERANYQKQADDLVDKVKEVKQKRASQPAPTT |
| Ga0209350_11049812 | 3300026277 | Grasslands Soil | NLLYRRKADMVESANERASLKKQADDLVDKVKEIKQKRAEQPQSPS |
| Ga0209235_12761631 | 3300026296 | Grasslands Soil | LLYRRKADMVESAEERANLQKQADDLIDKVKEIKQKRAEQVQPSS |
| Ga0209239_10358223 | 3300026310 | Grasslands Soil | KADMVESADERANLKKQADELIDKVKEIKQKRAEQPPPP |
| Ga0209268_11417663 | 3300026314 | Soil | NLLYRRKADMVESADERANLKKQADELIDKVKEIKQKRAEQPQQAS |
| Ga0209159_12763911 | 3300026343 | Soil | DMVESANERARLKKQAHDLVDKVKEIKQKRAEQPQQAS |
| Ga0257168_11225102 | 3300026514 | Soil | NLLYRRKADMVESKEEREALLKQADDLVDKVKEIKQKRSEQPQPS |
| Ga0257158_10919431 | 3300026515 | Soil | ADIVESAEERDALKKQADDLLDKVKEIKQRRAEQPQPAG |
| Ga0209808_12597251 | 3300026523 | Soil | LDLLLYRRKADMVESADERANLKKQADELIDKVKEIKQKRAEQPQSPS |
| Ga0209160_12710051 | 3300026532 | Soil | KADTVASADERAALLKQADDLVDRVKEVKQKRASQPTPST |
| Ga0209056_106552122 | 3300026538 | Soil | YRRKADMVESADERANLKKQADELIDKVKEIKQKRAEQPQSPS |
| Ga0207759_1029162 | 3300026823 | Tropical Forest Soil | LRRKADMVESAAERDALTKQADDLLDKVKELKQKRAEQPTPAA |
| Ga0207762_10569082 | 3300027063 | Tropical Forest Soil | YRRKADMVESTAERDSFTKQADDLLDKVKEIKQKKMEAPAKP |
| Ga0208525_10360142 | 3300027288 | Soil | LYRRKADTVESADERTSLLKQADDLVDKVKEVKQKRASQPQPAVSN |
| Ga0208985_10736341 | 3300027528 | Forest Soil | NLLYRRKADMVETPDERANLLKQADDLVDKVKEIKQKRADQPQQPS |
| Ga0209117_11136881 | 3300027645 | Forest Soil | LLYRRKADMVESADERAALLKQADDLVDKVKEIKQKRAEQPQQIAN |
| Ga0209217_10282641 | 3300027651 | Forest Soil | YRRKADMVESADERASLQKQADELIDKVKEIKQKRAEQPQPQAS |
| Ga0209217_11207751 | 3300027651 | Forest Soil | ADMVESAEERASLIKQAEDLSDKVKEIKQKKMNAPATTS |
| Ga0209799_10585321 | 3300027654 | Tropical Forest Soil | LLYRRKADMAASQEERAGLIKQADELVDKVKEIKQKRAEQPQQTS |
| Ga0209118_10698112 | 3300027674 | Forest Soil | RRKADMVESKEEREALLKQADDLVDKVKEIKQKRSEQPQAT |
| Ga0209011_11729711 | 3300027678 | Forest Soil | MVESQDERAALLKQADDLVDKVKEIKQKRSEQPQPGS |
| Ga0208991_11776151 | 3300027681 | Forest Soil | VESKEEREALLKQADDLVDKVKEIKQKRSEQPQPS |
| Ga0209248_100934432 | 3300027729 | Bog Forest Soil | AMAYLGLLYRRKADMVESADERASLEKQADDLLEKIKEIKQKRLDQQQQTP |
| Ga0209073_103080571 | 3300027765 | Agricultural Soil | RKADMVDSAEERDKLEQQADDLLDKVKEIKQKRASQAPPTA |
| Ga0209074_100998681 | 3300027787 | Agricultural Soil | YRRKADMVESADERASLKKQADELIDKIKEIKQHRAEQPQQPS |
| Ga0209180_100862553 | 3300027846 | Vadose Zone Soil | LNLLYRRKADMVESADERASLKKQADDLIDKVKEIKQKRAEQPQQPS |
| Ga0209283_102632954 | 3300027875 | Vadose Zone Soil | YRRKADMVESADERAALLKQADDLVDKVKEIKQKRAEQPQQPAN |
| Ga0209283_102663202 | 3300027875 | Vadose Zone Soil | LLYRRKADMVESADERAALLKQADDLVDKVKEIKQKRAEQPQQPS |
| Ga0209698_105761002 | 3300027911 | Watersheds | GYLSLLYRRKADMVETADERASLEKQADDLLDKIKEIKQKRAEQPQSST |
| Ga0209526_108103752 | 3300028047 | Forest Soil | DSMDERASLQKQADDLLDKIKEIKQKRLDQQQQQIS |
| Ga0209526_109330432 | 3300028047 | Forest Soil | DMVESAEERASYQKQADDLVEKVKEIKQKRADQPQQTS |
| Ga0137415_100507205 | 3300028536 | Vadose Zone Soil | VESADERAALLKQADDLVDKVKEIKQKRAEQPQQIG |
| Ga0308309_110418691 | 3300028906 | Soil | VETLPERDALRKQADDLVDKVKEIKQKRADQPTQPS |
| Ga0222749_106881521 | 3300029636 | Soil | LLYRRKADMAASQEERASLIKQADDLVEKVKEIKQKRAEQPQQTS |
| Ga0310039_100143945 | 3300030706 | Peatlands Soil | NLLYRRKADIVESAGERDALLKQADDLLDKVKEVKQKKADEAERKSAQ |
| Ga0302314_108654061 | 3300030906 | Palsa | RRKADMATSQEERASLIKQADDLVDKVKEIKQKRADQPQQAS |
| Ga0318516_103729501 | 3300031543 | Soil | ADTVESASERADYQKQADDLVDKVKEVKQKRAAQPTPTT |
| Ga0318516_104973971 | 3300031543 | Soil | RKADTASYQDERDGLLKLADDLVDKVKEIKKKGAEQPTRP |
| Ga0318541_100731491 | 3300031545 | Soil | YRRKADAVESANERNDLLKQADDLVDKVKEVKQKRASQPQPTT |
| Ga0310915_101943261 | 3300031573 | Soil | DTVESASERADYQKQADDLVDKVKEVKQKRAAQPTPTT |
| Ga0318561_105176442 | 3300031679 | Soil | LNLLYRRKADMVESTAERDALTKQADDLLDKVKEIKQKRAAEPEKPAS |
| Ga0318574_104836542 | 3300031680 | Soil | ADMVESAAERDALTKQADDLLDKVKELKQKRAEQPTPAA |
| Ga0307476_100257524 | 3300031715 | Hardwood Forest Soil | MVEKPDERASLLKQADDLVDKVKEIKQKRADQPQTAS |
| Ga0307476_100345333 | 3300031715 | Hardwood Forest Soil | YRRKADMVETPAERDALRKQADDLVDKVKEIKQKRADQPTQPS |
| Ga0307476_102420211 | 3300031715 | Hardwood Forest Soil | ADTVESETERAALVKQADDLIDKVKDIKQKRADQPTPAGG |
| Ga0307474_102037712 | 3300031718 | Hardwood Forest Soil | DIVETKAQREELGKMADDLLDKVKEIKQKRLEAAPQPPN |
| Ga0307474_110378021 | 3300031718 | Hardwood Forest Soil | KADTADSASARADLIKQADDLVDKVKEIKQKRASQPAPAA |
| Ga0307469_105433572 | 3300031720 | Hardwood Forest Soil | LLYRRKADMVESNDERASLQKQADDLLDKIKEIKQKRAEQPQQPS |
| Ga0318501_100281212 | 3300031736 | Soil | KADTVESASERADYQKQADDLVDKVKEVKQKRAAQPTPTT |
| Ga0307477_100724541 | 3300031753 | Hardwood Forest Soil | NLLYRRKADMVESADERASLLKQADDLVDKVKEIKQRRAEQPQQTS |
| Ga0307475_114567191 | 3300031754 | Hardwood Forest Soil | LYRRKADMVESKEEREALLKQADDLVDKVKEIKQKRSEQPQAS |
| Ga0307473_103210612 | 3300031820 | Hardwood Forest Soil | RRKADMVESADERASLKKQADDLVDKVKEIKQKRAEQLQQPS |
| Ga0307478_106046851 | 3300031823 | Hardwood Forest Soil | MVDSADERASLQKQADDLLDKIKEIKQKRLEAQQQAS |
| Ga0307478_107188231 | 3300031823 | Hardwood Forest Soil | RRKADTVESADERASLQKQADDLVDKVKEVKQRRASQPAPTT |
| Ga0310917_112147971 | 3300031833 | Soil | RKADMVESAAERDALTKQADDLLDKVKELKQKRAEQPSPSA |
| Ga0318527_104733091 | 3300031859 | Soil | LNLLLRRKADMVESAAERDALTKQADDLLDKVKELKQKRAEQPTPAA |
| Ga0318551_101756302 | 3300031896 | Soil | AYLNLMYRRKADMVESANQRDELLKQADALVDKVKEIKQKRAEQPQPAN |
| Ga0318520_110650272 | 3300031897 | Soil | MVESAAERDALTKQADDLLDKVKELKQKRAEQPTPAA |
| Ga0306921_126181551 | 3300031912 | Soil | LLRRKADMVESAAERDALTKQADDLLDKVKELKQKRAEQPTPAA |
| Ga0310913_104410411 | 3300031945 | Soil | NLLLRRKADMVESAAERDALTKQADDLLDKVKELKQKRAEQPTPAA |
| Ga0310913_107786131 | 3300031945 | Soil | ESANERNDLLKQADDLVDKVKEVKQKRASQPQPTT |
| Ga0318530_102483572 | 3300031959 | Soil | KADTASYQDERDGLLKLADDLVDKVKEIKKKGAEQPTRP |
| Ga0307479_110277422 | 3300031962 | Hardwood Forest Soil | VESAAERDALTKQADDLLDKVKELKQKRAEQAPAA |
| Ga0307479_119838772 | 3300031962 | Hardwood Forest Soil | RKADMVESAEERAALLKQADDLVDKVKEIKQKRAEQPQPAS |
| Ga0307471_1030958611 | 3300032180 | Hardwood Forest Soil | RKADMVESAEERAKLQKAADDLIDKVKEIKQKRAEQVQPSP |
| Ga0307472_1006826372 | 3300032205 | Hardwood Forest Soil | NLLYRRKADMVESADERASLLKQADDLVDKVKEIKQRRADQPQQTS |
| Ga0307472_1014234402 | 3300032205 | Hardwood Forest Soil | RRKADMVESADERNNFLKQADDLVDKVKEIKQRRAEQPQTTS |
| Ga0335080_106771532 | 3300032828 | Soil | TAESQAERDNLRKQADDLVEKVKEIKQKRLEQPQTSSMN |
| Ga0335080_117120762 | 3300032828 | Soil | LLYRRKADMVESSVERDALTKQADELLDKVKEIKQKKAEQPAPTTPAQ |
| Ga0335081_110100761 | 3300032892 | Soil | DTVESAAERDDLRKKADELVDKVKEIKQKRLEQPPQPS |
| Ga0335072_103225612 | 3300032898 | Soil | RKADEVESAEERDNYLKQADALLDKVKEIKQKRAEQPAPTT |
| Ga0310811_104528141 | 3300033475 | Soil | YRRKADMVESADERASLQKQADDLLDKIKEIKQKRLEQQTQQGS |
| Ga0371490_11592381 | 3300033561 | Peat Soil | YLNLLLRRKADQVDDMNERTALQKQADDLVDKVKDIKQQKAAAAANTAAS |
| Ga0370484_0232408_379_495 | 3300034125 | Untreated Peat Soil | MVESAGERTSLQKQADELVDKVKEIKQKRAENPPPQTS |
| ⦗Top⦘ |