| Basic Information | |
|---|---|
| Family ID | F016732 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 245 |
| Average Sequence Length | 42 residues |
| Representative Sequence | QALAVATSESEMFRLQGKINSLVRLEQLPEQVKEAVNRKEEI |
| Number of Associated Samples | 194 |
| Number of Associated Scaffolds | 245 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 95.10 % |
| % of genes from short scaffolds (< 2000 bps) | 95.51 % |
| Associated GOLD sequencing projects | 164 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.54 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (48.980 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine (26.531 % of family members) |
| Environment Ontology (ENVO) | Unclassified (84.898 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (87.755 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 57.14% β-sheet: 0.00% Coil/Unstructured: 42.86% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.54 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 51.02 % |
| Unclassified | root | N/A | 48.98 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000947|BBAY92_10026842 | All Organisms → Viruses → Predicted Viral | 1571 | Open in IMG/M |
| 3300000949|BBAY94_10069401 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium TMED211 | 974 | Open in IMG/M |
| 3300001460|JGI24003J15210_10160817 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium TMED211 | 564 | Open in IMG/M |
| 3300001589|JGI24005J15628_10087504 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium TMED211 | 1079 | Open in IMG/M |
| 3300002482|JGI25127J35165_1065004 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 768 | Open in IMG/M |
| 3300002484|JGI25129J35166_1054829 | Not Available | 760 | Open in IMG/M |
| 3300002519|JGI25130J35507_1043585 | Not Available | 915 | Open in IMG/M |
| 3300005596|Ga0066834_10220952 | Not Available | 599 | Open in IMG/M |
| 3300006025|Ga0075474_10128231 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 805 | Open in IMG/M |
| 3300006026|Ga0075478_10251528 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium TMED211 | 529 | Open in IMG/M |
| 3300006165|Ga0075443_10406744 | Not Available | 511 | Open in IMG/M |
| 3300006339|Ga0068481_1278550 | Not Available | 1419 | Open in IMG/M |
| 3300006637|Ga0075461_10129690 | Not Available | 780 | Open in IMG/M |
| 3300006735|Ga0098038_1225090 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 599 | Open in IMG/M |
| 3300006735|Ga0098038_1236403 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 581 | Open in IMG/M |
| 3300006737|Ga0098037_1237344 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 588 | Open in IMG/M |
| 3300006737|Ga0098037_1276658 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium TMED211 | 534 | Open in IMG/M |
| 3300006738|Ga0098035_1137468 | Not Available | 836 | Open in IMG/M |
| 3300006738|Ga0098035_1280470 | Not Available | 545 | Open in IMG/M |
| 3300006750|Ga0098058_1067541 | Not Available | 990 | Open in IMG/M |
| 3300006750|Ga0098058_1069338 | Not Available | 975 | Open in IMG/M |
| 3300006751|Ga0098040_1195713 | Not Available | 591 | Open in IMG/M |
| 3300006752|Ga0098048_1080521 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium TMED211 | 995 | Open in IMG/M |
| 3300006752|Ga0098048_1118252 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. | 797 | Open in IMG/M |
| 3300006753|Ga0098039_1162821 | Not Available | 761 | Open in IMG/M |
| 3300006793|Ga0098055_1247857 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium TMED211 | 670 | Open in IMG/M |
| 3300006802|Ga0070749_10322267 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium TMED211 | 863 | Open in IMG/M |
| 3300006802|Ga0070749_10351767 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium TMED211 | 819 | Open in IMG/M |
| 3300006802|Ga0070749_10474262 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium TMED211 | 684 | Open in IMG/M |
| 3300006867|Ga0075476_10053219 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. | 1632 | Open in IMG/M |
| 3300006869|Ga0075477_10369407 | Not Available | 561 | Open in IMG/M |
| 3300006869|Ga0075477_10423861 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium TMED211 | 515 | Open in IMG/M |
| 3300006874|Ga0075475_10367919 | Not Available | 583 | Open in IMG/M |
| 3300006874|Ga0075475_10434125 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium TMED211 | 524 | Open in IMG/M |
| 3300006916|Ga0070750_10423270 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 553 | Open in IMG/M |
| 3300006916|Ga0070750_10455509 | Not Available | 528 | Open in IMG/M |
| 3300006916|Ga0070750_10481454 | Not Available | 510 | Open in IMG/M |
| 3300006924|Ga0098051_1092911 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. | 812 | Open in IMG/M |
| 3300006925|Ga0098050_1169149 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. | 548 | Open in IMG/M |
| 3300006926|Ga0098057_1136847 | Not Available | 597 | Open in IMG/M |
| 3300006928|Ga0098041_1236521 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 583 | Open in IMG/M |
| 3300006929|Ga0098036_1237115 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
| 3300006947|Ga0075444_10401514 | Not Available | 515 | Open in IMG/M |
| 3300007234|Ga0075460_10220715 | Not Available | 639 | Open in IMG/M |
| 3300007234|Ga0075460_10228788 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. | 625 | Open in IMG/M |
| 3300007236|Ga0075463_10122938 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 838 | Open in IMG/M |
| 3300007344|Ga0070745_1271881 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 609 | Open in IMG/M |
| 3300007344|Ga0070745_1350907 | Not Available | 517 | Open in IMG/M |
| 3300007538|Ga0099851_1100139 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 1104 | Open in IMG/M |
| 3300007538|Ga0099851_1185554 | Not Available | 762 | Open in IMG/M |
| 3300007539|Ga0099849_1133660 | Not Available | 969 | Open in IMG/M |
| 3300007540|Ga0099847_1131423 | Not Available | 751 | Open in IMG/M |
| 3300007540|Ga0099847_1177806 | Not Available | 626 | Open in IMG/M |
| 3300007540|Ga0099847_1221593 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. | 548 | Open in IMG/M |
| 3300007541|Ga0099848_1128994 | Not Available | 950 | Open in IMG/M |
| 3300007541|Ga0099848_1237866 | Not Available | 641 | Open in IMG/M |
| 3300007541|Ga0099848_1277567 | Not Available | 580 | Open in IMG/M |
| 3300007542|Ga0099846_1104869 | Not Available | 1039 | Open in IMG/M |
| 3300007640|Ga0070751_1355739 | Not Available | 535 | Open in IMG/M |
| 3300007784|Ga0102955_1086183 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 801 | Open in IMG/M |
| 3300007960|Ga0099850_1259742 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium TMED211 | 667 | Open in IMG/M |
| 3300007963|Ga0110931_1209885 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. | 581 | Open in IMG/M |
| 3300008012|Ga0075480_10465229 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. | 613 | Open in IMG/M |
| 3300008012|Ga0075480_10542606 | Not Available | 556 | Open in IMG/M |
| 3300008050|Ga0098052_1045596 | Not Available | 1913 | Open in IMG/M |
| 3300008050|Ga0098052_1340037 | Not Available | 563 | Open in IMG/M |
| 3300008050|Ga0098052_1369630 | Not Available | 535 | Open in IMG/M |
| 3300008216|Ga0114898_1072866 | Not Available | 1059 | Open in IMG/M |
| 3300008216|Ga0114898_1087296 | Not Available | 946 | Open in IMG/M |
| 3300008216|Ga0114898_1110255 | Not Available | 816 | Open in IMG/M |
| 3300008217|Ga0114899_1053136 | Not Available | 1440 | Open in IMG/M |
| 3300008219|Ga0114905_1036337 | Not Available | 1866 | Open in IMG/M |
| 3300008219|Ga0114905_1121161 | Not Available | 891 | Open in IMG/M |
| 3300008219|Ga0114905_1271262 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
| 3300008220|Ga0114910_1082491 | Not Available | 979 | Open in IMG/M |
| 3300009001|Ga0102963_1324015 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. | 605 | Open in IMG/M |
| 3300009027|Ga0102957_1127953 | Not Available | 895 | Open in IMG/M |
| 3300009071|Ga0115566_10351867 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. | 858 | Open in IMG/M |
| 3300009124|Ga0118687_10245347 | Not Available | 662 | Open in IMG/M |
| 3300009409|Ga0114993_10012210 | Not Available | 7462 | Open in IMG/M |
| 3300009414|Ga0114909_1047145 | Not Available | 1285 | Open in IMG/M |
| 3300009414|Ga0114909_1102155 | Not Available | 786 | Open in IMG/M |
| 3300009414|Ga0114909_1138955 | Not Available | 646 | Open in IMG/M |
| 3300009422|Ga0114998_10198537 | Not Available | 954 | Open in IMG/M |
| 3300009425|Ga0114997_10328037 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium TMED211 | 841 | Open in IMG/M |
| 3300009428|Ga0114915_1186907 | Not Available | 575 | Open in IMG/M |
| 3300009428|Ga0114915_1209503 | Not Available | 534 | Open in IMG/M |
| 3300009441|Ga0115007_11180866 | Not Available | 532 | Open in IMG/M |
| 3300009512|Ga0115003_10683362 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 598 | Open in IMG/M |
| 3300009604|Ga0114901_1226053 | Not Available | 531 | Open in IMG/M |
| 3300009604|Ga0114901_1233182 | Not Available | 520 | Open in IMG/M |
| 3300009605|Ga0114906_1047472 | All Organisms → cellular organisms → Bacteria | 1646 | Open in IMG/M |
| 3300009620|Ga0114912_1026521 | Not Available | 1590 | Open in IMG/M |
| 3300009622|Ga0105173_1032922 | Not Available | 829 | Open in IMG/M |
| 3300009705|Ga0115000_10450298 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium TMED211 | 815 | Open in IMG/M |
| 3300010149|Ga0098049_1044155 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. | 1430 | Open in IMG/M |
| 3300010150|Ga0098056_1159778 | Not Available | 759 | Open in IMG/M |
| 3300010151|Ga0098061_1153660 | Not Available | 833 | Open in IMG/M |
| 3300010153|Ga0098059_1278429 | Not Available | 642 | Open in IMG/M |
| 3300010155|Ga0098047_10058114 | All Organisms → Viruses → Predicted Viral | 1524 | Open in IMG/M |
| 3300010155|Ga0098047_10221272 | Not Available | 723 | Open in IMG/M |
| 3300010155|Ga0098047_10405512 | Not Available | 510 | Open in IMG/M |
| 3300010297|Ga0129345_1353103 | Not Available | 506 | Open in IMG/M |
| 3300010299|Ga0129342_1236841 | Not Available | 639 | Open in IMG/M |
| 3300010300|Ga0129351_1289196 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. | 621 | Open in IMG/M |
| 3300010318|Ga0136656_1168861 | Not Available | 742 | Open in IMG/M |
| 3300010368|Ga0129324_10375308 | Not Available | 551 | Open in IMG/M |
| 3300010883|Ga0133547_12082143 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium TMED211 | 1035 | Open in IMG/M |
| 3300011252|Ga0151674_1050438 | Not Available | 1192 | Open in IMG/M |
| 3300017697|Ga0180120_10271971 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. | 683 | Open in IMG/M |
| 3300017697|Ga0180120_10414305 | Not Available | 528 | Open in IMG/M |
| 3300017704|Ga0181371_1041334 | Not Available | 753 | Open in IMG/M |
| 3300017708|Ga0181369_1044011 | All Organisms → Viruses → Predicted Viral | 1015 | Open in IMG/M |
| 3300017713|Ga0181391_1122161 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 583 | Open in IMG/M |
| 3300017714|Ga0181412_1078546 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. | 797 | Open in IMG/M |
| 3300017717|Ga0181404_1138281 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. | 590 | Open in IMG/M |
| 3300017718|Ga0181375_1073760 | Not Available | 557 | Open in IMG/M |
| 3300017720|Ga0181383_1133344 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. | 667 | Open in IMG/M |
| 3300017725|Ga0181398_1135561 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. | 585 | Open in IMG/M |
| 3300017727|Ga0181401_1098211 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. | 747 | Open in IMG/M |
| 3300017738|Ga0181428_1122528 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. | 610 | Open in IMG/M |
| 3300017739|Ga0181433_1105579 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium TMED211 | 681 | Open in IMG/M |
| 3300017740|Ga0181418_1052048 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium TMED211 | 1018 | Open in IMG/M |
| 3300017740|Ga0181418_1172018 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium TMED211 | 518 | Open in IMG/M |
| 3300017744|Ga0181397_1141104 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium TMED211 | 619 | Open in IMG/M |
| 3300017750|Ga0181405_1130854 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium TMED211 | 624 | Open in IMG/M |
| 3300017750|Ga0181405_1173111 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. | 528 | Open in IMG/M |
| 3300017751|Ga0187219_1109319 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium TMED211 | 831 | Open in IMG/M |
| 3300017751|Ga0187219_1116540 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. | 796 | Open in IMG/M |
| 3300017755|Ga0181411_1095784 | Not Available | 879 | Open in IMG/M |
| 3300017757|Ga0181420_1080304 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium TMED211 | 1018 | Open in IMG/M |
| 3300017757|Ga0181420_1099064 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium TMED211 | 898 | Open in IMG/M |
| 3300017758|Ga0181409_1206779 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. | 565 | Open in IMG/M |
| 3300017759|Ga0181414_1175017 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. | 558 | Open in IMG/M |
| 3300017760|Ga0181408_1066330 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. | 953 | Open in IMG/M |
| 3300017768|Ga0187220_1202804 | Not Available | 597 | Open in IMG/M |
| 3300017769|Ga0187221_1125011 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. | 774 | Open in IMG/M |
| 3300017770|Ga0187217_1220376 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium TMED211 | 625 | Open in IMG/M |
| 3300017772|Ga0181430_1144743 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium TMED211 | 692 | Open in IMG/M |
| 3300017775|Ga0181432_1174198 | Not Available | 668 | Open in IMG/M |
| 3300017779|Ga0181395_1250690 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. | 541 | Open in IMG/M |
| 3300017783|Ga0181379_1122237 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. | 941 | Open in IMG/M |
| 3300017783|Ga0181379_1244471 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 620 | Open in IMG/M |
| 3300017786|Ga0181424_10222720 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium TMED211 | 795 | Open in IMG/M |
| 3300017824|Ga0181552_10403150 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. | 655 | Open in IMG/M |
| 3300017951|Ga0181577_10743519 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium TMED211 | 594 | Open in IMG/M |
| 3300017952|Ga0181583_10144740 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1594 | Open in IMG/M |
| 3300017969|Ga0181585_10725771 | Not Available | 648 | Open in IMG/M |
| 3300018415|Ga0181559_10660787 | Not Available | 562 | Open in IMG/M |
| 3300018420|Ga0181563_10606093 | Not Available | 609 | Open in IMG/M |
| 3300018424|Ga0181591_10745037 | Not Available | 685 | Open in IMG/M |
| 3300018426|Ga0181566_10706826 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium TMED211 | 693 | Open in IMG/M |
| 3300019281|Ga0182077_1168713 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 518 | Open in IMG/M |
| 3300019282|Ga0182075_1519185 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium TMED211 | 684 | Open in IMG/M |
| 3300019756|Ga0194023_1077862 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium TMED211 | 666 | Open in IMG/M |
| 3300019756|Ga0194023_1123489 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 528 | Open in IMG/M |
| 3300020428|Ga0211521_10207144 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. | 894 | Open in IMG/M |
| 3300020436|Ga0211708_10269463 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. | 690 | Open in IMG/M |
| 3300020439|Ga0211558_10492738 | Not Available | 560 | Open in IMG/M |
| 3300020463|Ga0211676_10256416 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium TMED211 | 1021 | Open in IMG/M |
| 3300021368|Ga0213860_10367249 | Not Available | 625 | Open in IMG/M |
| 3300021389|Ga0213868_10381695 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. | 784 | Open in IMG/M |
| 3300021958|Ga0222718_10598343 | Not Available | 517 | Open in IMG/M |
| 3300021960|Ga0222715_10627911 | Not Available | 550 | Open in IMG/M |
| 3300021962|Ga0222713_10767972 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 541 | Open in IMG/M |
| 3300021964|Ga0222719_10511323 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. | 718 | Open in IMG/M |
| 3300022065|Ga0212024_1102472 | Not Available | 510 | Open in IMG/M |
| 3300022074|Ga0224906_1095939 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. | 881 | Open in IMG/M |
| 3300022167|Ga0212020_1055290 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium TMED211 | 672 | Open in IMG/M |
| 3300022168|Ga0212027_1018054 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 965 | Open in IMG/M |
| 3300022176|Ga0212031_1073267 | Not Available | 583 | Open in IMG/M |
| 3300022198|Ga0196905_1039651 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium TMED211 | 1377 | Open in IMG/M |
| 3300022198|Ga0196905_1075674 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium TMED211 | 922 | Open in IMG/M |
| 3300022200|Ga0196901_1117596 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium TMED211 | 911 | Open in IMG/M |
| 3300022309|Ga0224510_10811740 | Not Available | 533 | Open in IMG/M |
| 3300022937|Ga0255770_10281053 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium TMED211 | 780 | Open in IMG/M |
| 3300023170|Ga0255761_10302466 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium TMED211 | 836 | Open in IMG/M |
| 3300023176|Ga0255772_10558478 | Not Available | 537 | Open in IMG/M |
| 3300023180|Ga0255768_10594868 | Not Available | 537 | Open in IMG/M |
| 3300025046|Ga0207902_1018784 | Not Available | 804 | Open in IMG/M |
| 3300025048|Ga0207905_1034095 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 818 | Open in IMG/M |
| 3300025049|Ga0207898_1015309 | Not Available | 961 | Open in IMG/M |
| 3300025069|Ga0207887_1010950 | All Organisms → Viruses → Predicted Viral | 1405 | Open in IMG/M |
| 3300025069|Ga0207887_1031601 | Not Available | 852 | Open in IMG/M |
| 3300025083|Ga0208791_1085685 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. | 505 | Open in IMG/M |
| 3300025098|Ga0208434_1055150 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. | 860 | Open in IMG/M |
| 3300025103|Ga0208013_1090956 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 778 | Open in IMG/M |
| 3300025108|Ga0208793_1099562 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. | 817 | Open in IMG/M |
| 3300025118|Ga0208790_1112455 | Not Available | 782 | Open in IMG/M |
| 3300025125|Ga0209644_1129861 | Not Available | 600 | Open in IMG/M |
| 3300025138|Ga0209634_1235445 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium TMED211 | 673 | Open in IMG/M |
| 3300025168|Ga0209337_1320517 | Not Available | 548 | Open in IMG/M |
| 3300025251|Ga0208182_1046257 | Not Available | 920 | Open in IMG/M |
| 3300025276|Ga0208814_1056290 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 1124 | Open in IMG/M |
| 3300025277|Ga0208180_1112971 | Not Available | 588 | Open in IMG/M |
| 3300025282|Ga0208030_1049106 | All Organisms → cellular organisms → Bacteria | 1207 | Open in IMG/M |
| 3300025282|Ga0208030_1069415 | Not Available | 949 | Open in IMG/M |
| 3300025293|Ga0208934_1049456 | Not Available | 769 | Open in IMG/M |
| 3300025652|Ga0208134_1080936 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. | 940 | Open in IMG/M |
| 3300025687|Ga0208019_1066202 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. | 1194 | Open in IMG/M |
| 3300025751|Ga0208150_1116863 | Not Available | 862 | Open in IMG/M |
| 3300025759|Ga0208899_1092951 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. | 1143 | Open in IMG/M |
| 3300025769|Ga0208767_1241010 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 573 | Open in IMG/M |
| 3300025771|Ga0208427_1219174 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. | 597 | Open in IMG/M |
| 3300025818|Ga0208542_1114133 | Not Available | 764 | Open in IMG/M |
| 3300025840|Ga0208917_1080258 | All Organisms → Viruses → Predicted Viral | 1227 | Open in IMG/M |
| 3300025840|Ga0208917_1241488 | Not Available | 583 | Open in IMG/M |
| 3300025889|Ga0208644_1309132 | Not Available | 624 | Open in IMG/M |
| 3300026103|Ga0208451_1017516 | Not Available | 784 | Open in IMG/M |
| 3300026115|Ga0208560_1029161 | Not Available | 538 | Open in IMG/M |
| 3300026212|Ga0208409_1096515 | Not Available | 673 | Open in IMG/M |
| 3300026268|Ga0208641_1193047 | Not Available | 534 | Open in IMG/M |
| 3300027704|Ga0209816_1138474 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium TMED211 | 887 | Open in IMG/M |
| 3300027714|Ga0209815_1186283 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium TMED211 | 646 | Open in IMG/M |
| 3300027771|Ga0209279_10083618 | Not Available | 907 | Open in IMG/M |
| 3300027788|Ga0209711_10077036 | All Organisms → Viruses → Predicted Viral | 1745 | Open in IMG/M |
| (restricted) 3300027837|Ga0255041_10044638 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium TMED211 | 1355 | Open in IMG/M |
| (restricted) 3300027837|Ga0255041_10407335 | Not Available | 501 | Open in IMG/M |
| 3300031519|Ga0307488_10788779 | Not Available | 527 | Open in IMG/M |
| 3300031569|Ga0307489_10523212 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium TMED211 | 809 | Open in IMG/M |
| 3300031605|Ga0302132_10549105 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium TMED211 | 502 | Open in IMG/M |
| 3300031646|Ga0302133_10026436 | All Organisms → Viruses → Predicted Viral | 3228 | Open in IMG/M |
| 3300031774|Ga0315331_10716954 | All Organisms → Viruses | 705 | Open in IMG/M |
| 3300031886|Ga0315318_10575644 | Not Available | 639 | Open in IMG/M |
| 3300032073|Ga0315315_11808508 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 519 | Open in IMG/M |
| 3300032136|Ga0316201_10969978 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. | 715 | Open in IMG/M |
| 3300032820|Ga0310342_101318434 | Not Available | 856 | Open in IMG/M |
| 3300033742|Ga0314858_052841 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium TMED211 | 988 | Open in IMG/M |
| 3300033742|Ga0314858_078155 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium TMED211 | 828 | Open in IMG/M |
| 3300034374|Ga0348335_077330 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 1135 | Open in IMG/M |
| 3300034374|Ga0348335_090158 | Not Available | 1001 | Open in IMG/M |
| 3300034374|Ga0348335_131443 | Not Available | 720 | Open in IMG/M |
| 3300034375|Ga0348336_097948 | All Organisms → cellular organisms → Bacteria | 1003 | Open in IMG/M |
| 3300034375|Ga0348336_163373 | Not Available | 643 | Open in IMG/M |
| 3300034375|Ga0348336_191131 | Not Available | 557 | Open in IMG/M |
| 3300034418|Ga0348337_087859 | Not Available | 1058 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 26.53% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 23.27% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 13.47% |
| Deep Ocean | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean | 11.43% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 5.71% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 4.08% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 2.86% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 1.63% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 1.63% |
| Marine Oceanic | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine Oceanic | 1.22% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 0.82% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 0.82% |
| Sackhole Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine | 0.82% |
| Sea-Ice Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sea-Ice Brine | 0.82% |
| Pond Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water | 0.82% |
| Macroalgal Surface | Host-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface | 0.82% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 0.41% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine | 0.41% |
| Worm Burrow | Environmental → Aquatic → Marine → Coastal → Sediment → Worm Burrow | 0.41% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.41% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 0.41% |
| Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 0.41% |
| Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment | 0.41% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.41% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000947 | Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY92 | Host-Associated | Open in IMG/M |
| 3300000949 | Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY94 | Host-Associated | Open in IMG/M |
| 3300001460 | Marine viral communities from the Pacific Ocean - LP-28 | Environmental | Open in IMG/M |
| 3300001589 | Marine viral communities from the Pacific Ocean - LP-40 | Environmental | Open in IMG/M |
| 3300002482 | Marine viral communities from the Pacific Ocean - ETNP_2_30 | Environmental | Open in IMG/M |
| 3300002484 | Marine viral communities from the Pacific Ocean - ETNP_2_130 | Environmental | Open in IMG/M |
| 3300002519 | Marine viral communities from the Pacific Ocean - ETNP_2_300 | Environmental | Open in IMG/M |
| 3300005596 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306PF43B | Environmental | Open in IMG/M |
| 3300006025 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006026 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006165 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG006-DNA | Environmental | Open in IMG/M |
| 3300006339 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT232_3_0500m | Environmental | Open in IMG/M |
| 3300006637 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006735 | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG | Environmental | Open in IMG/M |
| 3300006737 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG | Environmental | Open in IMG/M |
| 3300006738 | Marine viral communities from the Subarctic Pacific Ocean - 3_ETSP_OMZ_AT15126 metaG | Environmental | Open in IMG/M |
| 3300006750 | Marine viral communities from the Subarctic Pacific Ocean - 19_ETSP_OMZ_AT15317 metaG | Environmental | Open in IMG/M |
| 3300006751 | Marine viral communities from the Subarctic Pacific Ocean - 7_ETSP_OMZ_AT15161 metaG | Environmental | Open in IMG/M |
| 3300006752 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG | Environmental | Open in IMG/M |
| 3300006753 | Marine viral communities from the Subarctic Pacific Ocean - 6_ETSP_OMZ_AT15160 metaG | Environmental | Open in IMG/M |
| 3300006793 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006867 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006869 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006874 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006916 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 | Environmental | Open in IMG/M |
| 3300006924 | Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaG | Environmental | Open in IMG/M |
| 3300006925 | Marine viral communities from the Subarctic Pacific Ocean - 14_ETSP_OMZ_AT15311 metaG | Environmental | Open in IMG/M |
| 3300006926 | Marine viral communities from the Subarctic Pacific Ocean - 18_ETSP_OMZAT15316 metaG | Environmental | Open in IMG/M |
| 3300006928 | Marine viral communities from the Subarctic Pacific Ocean - 8_ETSP_OMZ_AT15162 metaG | Environmental | Open in IMG/M |
| 3300006929 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG | Environmental | Open in IMG/M |
| 3300006947 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG017-DNA | Environmental | Open in IMG/M |
| 3300007234 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007236 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_DNA | Environmental | Open in IMG/M |
| 3300007344 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 | Environmental | Open in IMG/M |
| 3300007538 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007539 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG | Environmental | Open in IMG/M |
| 3300007540 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007541 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG | Environmental | Open in IMG/M |
| 3300007542 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG | Environmental | Open in IMG/M |
| 3300007640 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 | Environmental | Open in IMG/M |
| 3300007784 | Salt pond soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_A_D1_MG | Environmental | Open in IMG/M |
| 3300007960 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG | Environmental | Open in IMG/M |
| 3300007963 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG (version 2) | Environmental | Open in IMG/M |
| 3300008012 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_DNA | Environmental | Open in IMG/M |
| 3300008050 | Marine viral communities from the Subarctic Pacific Ocean - 15_ETSP_OMZ_AT15312 metaG | Environmental | Open in IMG/M |
| 3300008216 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_Geostar | Environmental | Open in IMG/M |
| 3300008217 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_215 | Environmental | Open in IMG/M |
| 3300008219 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_b05 | Environmental | Open in IMG/M |
| 3300008220 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_908 | Environmental | Open in IMG/M |
| 3300009001 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MG | Environmental | Open in IMG/M |
| 3300009027 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_A_H2O_MG | Environmental | Open in IMG/M |
| 3300009071 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405 | Environmental | Open in IMG/M |
| 3300009124 | Marine sediment microbial communities from methane seeps within Hudson Canyon, US Atlantic Margin - Hudson Canyon PC-16 72 cmbsf | Environmental | Open in IMG/M |
| 3300009409 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_150 | Environmental | Open in IMG/M |
| 3300009414 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_906 | Environmental | Open in IMG/M |
| 3300009422 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_138 | Environmental | Open in IMG/M |
| 3300009425 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_136 | Environmental | Open in IMG/M |
| 3300009428 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_55 | Environmental | Open in IMG/M |
| 3300009441 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M Metagenome | Environmental | Open in IMG/M |
| 3300009512 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_88 | Environmental | Open in IMG/M |
| 3300009603 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_904 | Environmental | Open in IMG/M |
| 3300009604 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s16 | Environmental | Open in IMG/M |
| 3300009605 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_M9 | Environmental | Open in IMG/M |
| 3300009620 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_51 | Environmental | Open in IMG/M |
| 3300009622 | Marine viral communities from the Southern Atlantic ocean transect to study dissolved organic matter and carbon cycling - metaG 3321_4155 | Environmental | Open in IMG/M |
| 3300009705 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_128 | Environmental | Open in IMG/M |
| 3300010149 | Marine viral communities from the Subarctic Pacific Ocean - 13B_ETSP_OMZ_AT15268_CsCl metaG | Environmental | Open in IMG/M |
| 3300010150 | Marine viral communities from the Subarctic Pacific Ocean - 17B_ETSP_OMZ_AT15314_CsCl metaG | Environmental | Open in IMG/M |
| 3300010151 | Marine viral communities from the Subarctic Pacific Ocean - 22_ETSP_OMZ_AT15343 metaG | Environmental | Open in IMG/M |
| 3300010153 | Marine viral communities from the Subarctic Pacific Ocean - 20_ETSP_OMZ_AT15318 metaG | Environmental | Open in IMG/M |
| 3300010155 | Marine viral communities from the Subarctic Pacific Ocean - 12_ETSP_OMZ_AT15267 metaG | Environmental | Open in IMG/M |
| 3300010297 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_20_0.8_DNA | Environmental | Open in IMG/M |
| 3300010299 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.2_DNA | Environmental | Open in IMG/M |
| 3300010300 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_DNA | Environmental | Open in IMG/M |
| 3300010318 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.8_DNA | Environmental | Open in IMG/M |
| 3300010368 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNA | Environmental | Open in IMG/M |
| 3300010883 | western Arctic Ocean co-assembly | Environmental | Open in IMG/M |
| 3300011252 | Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2014_4, permeate | Environmental | Open in IMG/M |
| 3300017697 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_DNA (version 2) | Environmental | Open in IMG/M |
| 3300017704 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_07 viral metaG | Environmental | Open in IMG/M |
| 3300017708 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_04 viral metaG | Environmental | Open in IMG/M |
| 3300017713 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11 | Environmental | Open in IMG/M |
| 3300017714 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 35 SPOT_SRF_2012-08-15 | Environmental | Open in IMG/M |
| 3300017717 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 27 SPOT_SRF_2011-10-25 | Environmental | Open in IMG/M |
| 3300017718 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_11 viral metaG | Environmental | Open in IMG/M |
| 3300017720 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23 | Environmental | Open in IMG/M |
| 3300017725 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 21 SPOT_SRF_2011-04-29 | Environmental | Open in IMG/M |
| 3300017727 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 24 SPOT_SRF_2011-07-20 | Environmental | Open in IMG/M |
| 3300017738 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 51 SPOT_SRF_2014-02-12 | Environmental | Open in IMG/M |
| 3300017739 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10 | Environmental | Open in IMG/M |
| 3300017740 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 41 SPOT_SRF_2013-03-13 | Environmental | Open in IMG/M |
| 3300017744 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 20 SPOT_SRF_2011-02-23 | Environmental | Open in IMG/M |
| 3300017750 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 28 SPOT_SRF_2011-11-29 | Environmental | Open in IMG/M |
| 3300017751 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21 (version 2) | Environmental | Open in IMG/M |
| 3300017755 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 34 SPOT_SRF_2012-07-09 | Environmental | Open in IMG/M |
| 3300017757 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 43 SPOT_SRF_2013-05-22 | Environmental | Open in IMG/M |
| 3300017758 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 32 SPOT_SRF_2012-05-30 | Environmental | Open in IMG/M |
| 3300017759 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 37 SPOT_SRF_2012-11-28 | Environmental | Open in IMG/M |
| 3300017760 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 31 SPOT_SRF_2012-02-16 | Environmental | Open in IMG/M |
| 3300017768 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23 (version 2) | Environmental | Open in IMG/M |
| 3300017769 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 5 SPOT_SRF_2009-10-22 (version 2) | Environmental | Open in IMG/M |
| 3300017770 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15 (version 2) | Environmental | Open in IMG/M |
| 3300017772 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 53 SPOT_SRF_2014-04-10 | Environmental | Open in IMG/M |
| 3300017775 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 55 SPOT_SRF_2014-07-17 | Environmental | Open in IMG/M |
| 3300017779 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 18 SPOT_SRF_2010-12-16 | Environmental | Open in IMG/M |
| 3300017783 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 2 SPOT_SRF_2009-07-10 | Environmental | Open in IMG/M |
| 3300017786 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 47 SPOT_SRF_2013-09-18 | Environmental | Open in IMG/M |
| 3300017824 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011501BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017951 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101413BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017952 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071405CT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017969 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071407BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018415 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011508AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018420 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018424 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018426 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101402AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300019281 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071409AT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019282 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071407BT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019756 | Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW6Sep16_MG | Environmental | Open in IMG/M |
| 3300020428 | Marine microbial communities from Tara Oceans - TARA_E500000331 (ERX556032-ERR599094) | Environmental | Open in IMG/M |
| 3300020436 | Marine microbial communities from Tara Oceans - TARA_B100000424 (ERX556009-ERR598984) | Environmental | Open in IMG/M |
| 3300020439 | Marine microbial communities from Tara Oceans - TARA_B100001939 (ERX556062-ERR599029) | Environmental | Open in IMG/M |
| 3300020463 | Marine microbial communities from Tara Oceans - TARA_B100001057 (ERX555988-ERR599050) | Environmental | Open in IMG/M |
| 3300020478 | Marine microbial communities from Tara Oceans - TARA_B100000029 (ERX556025-ERR599111) | Environmental | Open in IMG/M |
| 3300021368 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO550 | Environmental | Open in IMG/M |
| 3300021389 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO127 | Environmental | Open in IMG/M |
| 3300021958 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_27D | Environmental | Open in IMG/M |
| 3300021960 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9D | Environmental | Open in IMG/M |
| 3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
| 3300021964 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_34D | Environmental | Open in IMG/M |
| 3300022065 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (v2) | Environmental | Open in IMG/M |
| 3300022074 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10 (v2) | Environmental | Open in IMG/M |
| 3300022167 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (v2) | Environmental | Open in IMG/M |
| 3300022168 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v2) | Environmental | Open in IMG/M |
| 3300022176 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v2) | Environmental | Open in IMG/M |
| 3300022198 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022200 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022309 | Sediment microbial communities from San Francisco Bay, California, United States - SF_May12_sed_USGS_4_1 | Environmental | Open in IMG/M |
| 3300022937 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071404AT metaG | Environmental | Open in IMG/M |
| 3300023170 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071407BT metaG | Environmental | Open in IMG/M |
| 3300023176 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071411BT metaG | Environmental | Open in IMG/M |
| 3300023180 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412AT metaG | Environmental | Open in IMG/M |
| 3300025046 | Marine viral communities from the Pacific Ocean - LP-45 (SPAdes) | Environmental | Open in IMG/M |
| 3300025048 | Marine viral communities from the Subarctic Pacific Ocean - LP-49 (SPAdes) | Environmental | Open in IMG/M |
| 3300025049 | Marine viral communities from the Pacific Ocean - LP-55 (SPAdes) | Environmental | Open in IMG/M |
| 3300025069 | Marine viral communities from the Pacific Ocean - LP-38 (SPAdes) | Environmental | Open in IMG/M |
| 3300025083 | Marine viral communities from the Subarctic Pacific Ocean - 11_ETSP_OMZ_AT15265 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025098 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025103 | Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025108 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025118 | Marine viral communities from the Subarctic Pacific Ocean - 10_ETSP_OMZ_AT15264 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025125 | Marine viral communities from the Pacific Ocean - ETNP_2_1000 (SPAdes) | Environmental | Open in IMG/M |
| 3300025138 | Marine viral communities from the Pacific Ocean - LP-40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025168 | Marine viral communities from the Pacific Ocean - LP-53 (SPAdes) | Environmental | Open in IMG/M |
| 3300025251 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_906 (SPAdes) | Environmental | Open in IMG/M |
| 3300025276 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_55 (SPAdes) | Environmental | Open in IMG/M |
| 3300025277 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s16 (SPAdes) | Environmental | Open in IMG/M |
| 3300025280 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s17 (SPAdes) | Environmental | Open in IMG/M |
| 3300025282 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_M9 (SPAdes) | Environmental | Open in IMG/M |
| 3300025286 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_215 (SPAdes) | Environmental | Open in IMG/M |
| 3300025293 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025652 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (SPAdes) | Environmental | Open in IMG/M |
| 3300025687 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025751 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025759 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (SPAdes) | Environmental | Open in IMG/M |
| 3300025769 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (SPAdes) | Environmental | Open in IMG/M |
| 3300025771 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025818 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025840 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025889 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes) | Environmental | Open in IMG/M |
| 3300026103 | Marine viral communities from the Southern Atlantic ocean transect to study dissolved organic matter and carbon cycling - metaG 3321_4155 (SPAdes) | Environmental | Open in IMG/M |
| 3300026115 | Marine viral communities from the Southern Atlantic ocean transect to study dissolved organic matter and carbon cycling - metaG 3827_250 (SPAdes) | Environmental | Open in IMG/M |
| 3300026212 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV201 (SPAdes) | Environmental | Open in IMG/M |
| 3300026268 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F10-02SV253 (SPAdes) | Environmental | Open in IMG/M |
| 3300027704 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG017-DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027714 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG002-DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027771 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG006-DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027788 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_88 (SPAdes) | Environmental | Open in IMG/M |
| 3300027837 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_3 | Environmental | Open in IMG/M |
| 3300031519 | Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 0.2 | Environmental | Open in IMG/M |
| 3300031569 | Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 1.2 | Environmental | Open in IMG/M |
| 3300031605 | Marine microbial communities from Western Arctic Ocean, Canada - CB9_32.1 | Environmental | Open in IMG/M |
| 3300031646 | Marine microbial communities from Western Arctic Ocean, Canada - CB9_33.1 | Environmental | Open in IMG/M |
| 3300031701 | Marine microbial communities from Western Arctic Ocean, Canada - AG5_Bottom | Environmental | Open in IMG/M |
| 3300031774 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 60m 34915 | Environmental | Open in IMG/M |
| 3300031886 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 200m 3416 | Environmental | Open in IMG/M |
| 3300032032 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 32315 | Environmental | Open in IMG/M |
| 3300032073 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 3416 | Environmental | Open in IMG/M |
| 3300032136 | Coastal sediment microbial communities from Delaware Bay, Delaware, United States - CS-6 worm burrow | Environmental | Open in IMG/M |
| 3300032820 | Marine microbial communities from station ALOHA, North Pacific Subtropical Gyre - S1503-DNA-20-500_MG | Environmental | Open in IMG/M |
| 3300033742 | Sea-ice brine viral communities from Beaufort Sea near Barrow, Alaska, United States - 2018 seawater | Environmental | Open in IMG/M |
| 3300034374 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v4) | Environmental | Open in IMG/M |
| 3300034375 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 (v4) | Environmental | Open in IMG/M |
| 3300034418 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 (v4) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| BBAY92_100268421 | 3300000947 | Macroalgal Surface | SEQEMYRLQGKVSSLVRIEQLPLQVEEALNRKEEEK* |
| BBAY94_100694011 | 3300000949 | Macroalgal Surface | EQEMYRLQGKVSSLVRIEQLPLQVEEALNRKEEEK* |
| JGI24003J15210_101608172 | 3300001460 | Marine | TSESEMFRLQGRVASLARLITLPQQVKEALTRLEE* |
| JGI24005J15628_100875042 | 3300001589 | Marine | EQEMYRLQGKMNLLGKLEQLDLQIKEAITRKEEI* |
| JGI25127J35165_10650041 | 3300002482 | Marine | IVKELVVAQSEQAMYRLQGKMNLLDSLESLPDKVKEALTRGEQ* |
| JGI25129J35166_10548291 | 3300002484 | Marine | LVVATSEQEMFRYQGKINSLVRLEQLKETVQEALDRGEENA* |
| JGI25130J35507_10435852 | 3300002519 | Marine | LVVATSEQEMFRYQGKINSLVRLEQLKETVQEALNRKEEE* |
| Ga0066834_102209521 | 3300005596 | Marine | ATSEQEMFRYQGKINSLVRLEQLKETVQEALNRKEEE* |
| Ga0075474_101282313 | 3300006025 | Aqueous | LDLQALAVATSESEMFRLQGKVNSLVRLEQLPDKVKEALTRKEEK* |
| Ga0075478_102515282 | 3300006026 | Aqueous | ESEMFRLQGKVNSLVRLEQLDLQVKEAINRKEEL* |
| Ga0075443_104067441 | 3300006165 | Marine | HLNNLKTLELQALVVATSESEMFRSQGRVNSLARLEQLDLQIKEAINRKEEI* |
| Ga0068481_12785503 | 3300006339 | Marine | NNLKSLELQAPVVATSEQEMFRCQGKINSLVRLEQLKETIKEAIDRKEEGEK* |
| Ga0075461_101296901 | 3300006637 | Aqueous | LDLQALAVATSESEMFRLQGKINSLVRLEQLPEQVKEAVNRKEEV* |
| Ga0098038_12250902 | 3300006735 | Marine | DLQALAVATSESEMFRLQGKINSLVRLEQLPEQVKEAVNRKEET* |
| Ga0098038_12364032 | 3300006735 | Marine | ATSESEMFRLQGKINSLVRLEQLPEQVKEAANRKEET* |
| Ga0098037_12373441 | 3300006737 | Marine | ALAVATSESEMFRLQGKINSLVRLEQLPEQVKEAANRKEET* |
| Ga0098037_12766581 | 3300006737 | Marine | ALAVATSESEMFRLQGKINSLVRLEQLPEQVKEAANRKEEI* |
| Ga0098035_11374681 | 3300006738 | Marine | VVATSEQEMFRYQGKINSLVRLEQLKETVQEALDRGEENA* |
| Ga0098035_12804701 | 3300006738 | Marine | KNLELQALVVATSEQEMFRYQGKINSLVRLEQLKETVQEALNRKEEGEK* |
| Ga0098058_10675411 | 3300006750 | Marine | LKNLELQALVVATSEQEMFRCQGKINSLVRLEQLKETVQEALDRGEENA* |
| Ga0098058_10693382 | 3300006750 | Marine | KNLELQALVVATSEQEMFRYQGKINSLVRLEQLKETVQEALNRKEEE* |
| Ga0098040_11957131 | 3300006751 | Marine | SEQEMFRCQGKINSLVRLEQLKETVQEALDRGEENA* |
| Ga0098048_10805212 | 3300006752 | Marine | QALAVATSESEMFRLQGKINSLVRLEQLPEQVKEAVNRKEEL* |
| Ga0098048_11182521 | 3300006752 | Marine | QALAVATSESEMFRLQGKINSLVRLEQLPEQVKEAVNRKEEV* |
| Ga0098039_11628211 | 3300006753 | Marine | TSELEMFRCQGKINSLERLEQLENEVEEAMNRKEEN* |
| Ga0098055_12478571 | 3300006793 | Marine | ALAVATSESEMFRLQGKINSLVRLEQLPEQVKEAVNRKEET* |
| Ga0070749_103222671 | 3300006802 | Aqueous | VATSESEMFRLQGKLRSLVHLEQLPGKVKEALTRKEEEQ* |
| Ga0070749_103517671 | 3300006802 | Aqueous | QALAVATSESEMFRLQGKVNSLVRLEQLPEQVKEAVNRKEEL* |
| Ga0070749_104742621 | 3300006802 | Aqueous | VATSESEMFRLQGRVNSLVRLEQLPGRVKEALTRKEEEQ* |
| Ga0075476_100532191 | 3300006867 | Aqueous | LQALAVATSESEMFRLQGKINSLVRLEQLPEQVKEAVNRKEEA* |
| Ga0075477_103694072 | 3300006869 | Aqueous | YLLHLKNLDLQALVVATSESEMFRLQGKLRSLVHLEQLPGKVKEALTRKEEEQ* |
| Ga0075477_104238612 | 3300006869 | Aqueous | VVATSESEMFRLQGKVNSLVRLEQLDLQVKEAINRKEEL* |
| Ga0075475_103679191 | 3300006874 | Aqueous | TSESEMFRLQGKLRSLVHLEQLPGKVKEALTRKEEEQ* |
| Ga0075475_104341251 | 3300006874 | Aqueous | QALVVATSESEMFRLQGKVNSLVRLEQLDLQVKEAINRKEEL* |
| Ga0070750_104232701 | 3300006916 | Aqueous | TSESEMFRLQGRVNSLVRLEQLPGKVKEALTRKEEEQ* |
| Ga0070750_104555091 | 3300006916 | Aqueous | DLQALAVATSESEMFRLQGKINSLVRLEQLPEQVKEAVNRKEEA* |
| Ga0070750_104814543 | 3300006916 | Aqueous | KNLDLQALAVATSESEMFRLQGKVNSLVRLEQLPDKVKEALTRKEEK* |
| Ga0098051_10929112 | 3300006924 | Marine | LKTLDLQALAVATSESEMFRLQGKINSLVRLEQLPEQVKEAVNRKEDI* |
| Ga0098050_11691491 | 3300006925 | Marine | ESEMFRLQGKINSLVRLEQLPEQVKEAANRKEET* |
| Ga0098057_11368472 | 3300006926 | Marine | LVVATSEQEMFRCQGKINSLVRLEQLKETVQEALDRGEENA* |
| Ga0098041_12365211 | 3300006928 | Marine | LAVATSESEMFRLQGKINSLVRLEQLPEQVKEAANRKEET* |
| Ga0098036_12371151 | 3300006929 | Marine | QALVAATSEQEMFRSQGKVALLVRLEQLKEQVKEAKDRKE* |
| Ga0075444_104015141 | 3300006947 | Marine | ATSESEMFRSQGKVNSLARLEQLDLQVKEAITRKEEI* |
| Ga0075460_102207152 | 3300007234 | Aqueous | VATSESEMFRLQGKINSLVRLEQLPEQVKEAVNRKEEV* |
| Ga0075460_102287881 | 3300007234 | Aqueous | SLDLQALAVATSESEMFRLQGKINSLVRLEQLPEQVKEAANRKEEI* |
| Ga0075463_101229382 | 3300007236 | Aqueous | TSESEMFRLQGRVNSLVRLEQLPEQVKEAVNRKEEI* |
| Ga0070745_12718812 | 3300007344 | Aqueous | LKTLDLQALAVATSESEMFRLQGRVNSLVRLEQLPEQVKEAVNRKEEI* |
| Ga0070745_13509071 | 3300007344 | Aqueous | ALVVATSESEMFRLQGKLRSLVHLEQLPGKVKEALTRKEEEQ* |
| Ga0099851_11001392 | 3300007538 | Aqueous | SESEMFRLQGKINSLVRLEQLPEQVKEAVNRKEEL* |
| Ga0099851_11855541 | 3300007538 | Aqueous | LVVATSESEMFRLQGKLRSLVHLEQLPGKVKEALTRKEEE* |
| Ga0099849_11336601 | 3300007539 | Aqueous | LAVATSESEMFRLQGRVNSLVRLEQLPGKVKEALTRKEEEQ* |
| Ga0099847_11314232 | 3300007540 | Aqueous | AVATSESEMFRLQGKVNSLVRLEQLPDKVKEALTRKEEE* |
| Ga0099847_11778061 | 3300007540 | Aqueous | VATSESEMFRLQGKINSLVRLEQLPEQVKEAVNRKEEL* |
| Ga0099847_12215931 | 3300007540 | Aqueous | LAVATSESEMFRLQGKINSLVRLEQLPGQVKEAVNRKEEI* |
| Ga0099848_11289941 | 3300007541 | Aqueous | ATSESEMFRLQGKLRSLVHLEQLPGKVKEALTRKEEE* |
| Ga0099848_12378662 | 3300007541 | Aqueous | QALAVATSESEMFRLQGRVNSLVRLEQLPGKVKEALTRKEEK* |
| Ga0099848_12775671 | 3300007541 | Aqueous | LLSLKTLDLQALAVATSESEMFRLQGKINSVVRLEQLPDKVKEALTRKEEK* |
| Ga0099846_11048691 | 3300007542 | Aqueous | VATSESEMFRLQGKLRSLVHLEQLPGKVKEALTRKEEE* |
| Ga0070751_13557391 | 3300007640 | Aqueous | LQALAVATSESEMFRLQGKINSLVRLEQLPEQVKEAVNRKEEV* |
| Ga0102955_10861832 | 3300007784 | Soil | ESEMFRLQGRVNSLVRLEQLPEQVKEAVNRKEEL* |
| Ga0099850_12597421 | 3300007960 | Aqueous | ATSESEMFRLQGKLRSLVHLEQLPGKVKEALTRKEEEQ* |
| Ga0110931_12098851 | 3300007963 | Marine | QALAVATSESEMFRLQGKINSLVRLEQLPEQVKEAANRKEDI* |
| Ga0075480_104652291 | 3300008012 | Aqueous | NLKSLDLQALAVATSESEMFRLQGKINSLVRLEQLPEQVKEAANRKEEI* |
| Ga0075480_105426061 | 3300008012 | Aqueous | ALAVATSESEMFRLQGKINSLVRLEQLPEQVKEAVNRKEEA* |
| Ga0098052_10455961 | 3300008050 | Marine | QEMFRYQGKINSLVRLEQLKETVQEALNRKEEGEK* |
| Ga0098052_13400371 | 3300008050 | Marine | ALVVATSEQEMYRCQGKINSLVQLEQLKGQVQEALDRGEENA* |
| Ga0098052_13696302 | 3300008050 | Marine | QALVVATSEQEMFRYQGKINSLVRLEQLKETVQEALNRKEEE* |
| Ga0114898_10728661 | 3300008216 | Deep Ocean | LVVATSEQEMFRCQGKINSLVRLEQLKETVQEALNIGEENA* |
| Ga0114898_10872963 | 3300008216 | Deep Ocean | AKTRKEMFRCQGKVSALVRVERGVEEVKEALERNE* |
| Ga0114898_11102552 | 3300008216 | Deep Ocean | ELQALVVATSEQEMFRCQGKINSLVRLEQLKETVQEALNRGEENA* |
| Ga0114899_10531361 | 3300008217 | Deep Ocean | LQALVVATSEQEMFRCQGKVSSLVRLEGLVEEVKEALERNE* |
| Ga0114899_11144142 | 3300008217 | Deep Ocean | QVLAVATSELEMFRCQGKINLLERLEQLGNEVDEAMNRKEEN* |
| Ga0114905_10363373 | 3300008219 | Deep Ocean | QALVVATSEQEMFRCQGKVALLERLEQLKEQVKESKNRKEE* |
| Ga0114905_11211611 | 3300008219 | Deep Ocean | LEALKNLELQALVVATSEQEMFRCQGRVASLVRLVKLPDEVKEALEREE* |
| Ga0114905_12712622 | 3300008219 | Deep Ocean | ALAVATSELEMFRSQGKVNLLVRLEQLPDEVKEALEREE* |
| Ga0114910_10824911 | 3300008220 | Deep Ocean | LKNLELQALAVATSELEMFRSQGKVNLLVRLEQLPDEVKEALEREE* |
| Ga0102963_13240151 | 3300009001 | Pond Water | TSESEMFRLQGKINSLVRLEQLPEQVKEAVNRKEEI* |
| Ga0102957_11279531 | 3300009027 | Pond Water | NLKTLDLQALAVATSESEMFRLQGRVNSLVRLEQLPEQVKEAVNRKEEL* |
| Ga0115566_103518672 | 3300009071 | Pelagic Marine | ESEMFRLQGKINSLVRLEQLPEQVKEAVNRKEEI* |
| Ga0118687_102453472 | 3300009124 | Sediment | DLQALAVATSESEMFRLQGRVNSLVRLEQLPEQVKEAVNRKEEL* |
| Ga0114993_100122101 | 3300009409 | Marine | ELEMFRSQGKVNFLVRLGQLKGEVREALEREEEE* |
| Ga0114909_10471451 | 3300009414 | Deep Ocean | TSEQEMYRCQGKINSLVQLEQLKGQVTEALNRGEENA* |
| Ga0114909_11021552 | 3300009414 | Deep Ocean | ATSEQEMFRCQGKINSLVRLEQLKETVQEALDRGEENA* |
| Ga0114909_11389552 | 3300009414 | Deep Ocean | ELQALAVATSELEMFRSQGKVNLLVRLEQLPDEVKEALEREE* |
| Ga0114998_101985372 | 3300009422 | Marine | NNLKTLDLQALVVATSESEMFRLQGRLHSLHRLKELDLQVKEAINRKEET* |
| Ga0114997_103280371 | 3300009425 | Marine | LVVATSESEMFRSQGKINSLVRLEQLDLQVREAINRKEEI* |
| Ga0114915_11869071 | 3300009428 | Deep Ocean | SEQEMYRLQGKLSLLGKLEELDLQVKEAINRKEEI* |
| Ga0114915_12095032 | 3300009428 | Deep Ocean | LKTLELQALVVATSESEMFRSQGRVNSLVRLEQLDLQVKEAINRKEET* |
| Ga0115007_111808661 | 3300009441 | Marine | LQALVVATSELEMFRSQGRVNSLVRLEQLDLQVKEAINRKEET* |
| Ga0115003_106833621 | 3300009512 | Marine | EHLNNLKTLELQALVVATSELEMFRSQGRVNSLVRLEQLDLQVKEAINRKEEI* |
| Ga0114911_11189222 | 3300009603 | Deep Ocean | QVLAVATSELEMFRCQGKINSLERLEQLGNEVDEAMNRQEEN* |
| Ga0114901_12260531 | 3300009604 | Deep Ocean | KEHLLALKNLELQALAVATSELEMFRCQGRVASLVRLVRLRDEVKEALEREE* |
| Ga0114901_12331821 | 3300009604 | Deep Ocean | QEMYRCQGKINSLVQLEQLKEQVTEALNRGEENA* |
| Ga0114906_10474721 | 3300009605 | Deep Ocean | LELQALAVATSELEMFRCQGRVSSLVRLEQLPDEVKEALEREE* |
| Ga0114906_12131672 | 3300009605 | Deep Ocean | QVLAVATSELEMFRCQGRINSLERLEQLGNEVEEAMTRKEEN* |
| Ga0114912_10265213 | 3300009620 | Deep Ocean | ATSEQEMFRCQGKINSLVRLEQLKETVQEALNRGEENA* |
| Ga0105173_10329221 | 3300009622 | Marine Oceanic | TSELEMFRCQGKINSLERLEQLGNEVDEAMNRQEEN* |
| Ga0115000_104502981 | 3300009705 | Marine | ESEMFRSQGKINSLVRLEQLDLQVREAINRKEEI* |
| Ga0098049_10441552 | 3300010149 | Marine | DLQALAVATSESEMFRLQGKINSLVRLEQLPEQVKEAVNRKEEV* |
| Ga0098056_11597783 | 3300010150 | Marine | LQALVVATSEQEMFRYQGKINSLVRLEQLPEQVKEAVERKKEEI* |
| Ga0098061_11536602 | 3300010151 | Marine | LEMYRCQGKINSLVMLEQLKDQVTEALNRGEENA* |
| Ga0098059_12784291 | 3300010153 | Marine | VATSEQEMFRYQGKINSLVRLEQLKETVQEALDRGEENA* |
| Ga0098059_13631612 | 3300010153 | Marine | QVLAVATSELEMFRCQGKINLLERLEQLENEVKEAMNRQEEN* |
| Ga0098047_100581141 | 3300010155 | Marine | QALVVATSEQEMFRYQGKINSLVRLEQLPEQVKEALERKKEEI* |
| Ga0098047_102212722 | 3300010155 | Marine | ALVVATSEQEMFRCQGKINSLVRLEQLKETVQEALDRGEENA* |
| Ga0098047_104055122 | 3300010155 | Marine | VATSEQEMFRYQGKINSLVRLEQLKETVQEALNRKEEE* |
| Ga0129345_13531031 | 3300010297 | Freshwater To Marine Saline Gradient | LAVATSESEMFRLQGKVNSLVRLEQLPDKVKEALTRKEEEQ* |
| Ga0129342_12368412 | 3300010299 | Freshwater To Marine Saline Gradient | VVATSESEMFRLQGKLRSLVHLEQLPGKVKEALTRKEEEQ* |
| Ga0129351_12891961 | 3300010300 | Freshwater To Marine Saline Gradient | KSLDLQALAVATSESEMFRLQGKINSLVRLEQLPEQVKEAANRKEEI* |
| Ga0136656_11688612 | 3300010318 | Freshwater To Marine Saline Gradient | ATSESEMFRLQGKVNSLVRLEQLPEQVKEAVNRKEEL* |
| Ga0129324_103753081 | 3300010368 | Freshwater To Marine Saline Gradient | TLDLQALAVATSESEMFRLQGKINSLVRLEQLPEQVKEAINRKEEI* |
| Ga0133547_120821432 | 3300010883 | Marine | DNLKTLDLQALVVATSESEMFRLQGRLHSLHRLKELDLQVKEAINRKEET* |
| Ga0151674_10504383 | 3300011252 | Marine | KTLELQALVVATSEQEMFRRQGKVSSLVNLEALKDQVTEARNRKDD* |
| Ga0180120_102719712 | 3300017697 | Freshwater To Marine Saline Gradient | QALAVATSESEMFRLQGKINSLVRLEQLPEQVKEAANRKEEI |
| Ga0180120_104143051 | 3300017697 | Freshwater To Marine Saline Gradient | DLQALAVATSESEMFRLQGKINSLVRLEQLPEQVKEAVNRKEEA |
| Ga0181371_10413342 | 3300017704 | Marine | EQEMFRYQGKINSLVRLEQLKETVQEALDRGEENA |
| Ga0181369_10440111 | 3300017708 | Marine | KTLDLQALAVATSESEMFRLQGKINSLVRLEQLPEQVKEAANRKEET |
| Ga0181391_11221611 | 3300017713 | Seawater | NLELQALAVATSEQEMYRLQGRVSSLVRLEQLDKQVKEAINRKEGD |
| Ga0181412_10785462 | 3300017714 | Seawater | LKTLDLQALAVATSESEMFRLQGKINSLVRLEQLPEQVKEAANRKEEI |
| Ga0181404_11382811 | 3300017717 | Seawater | TSESEMFRLQGKINSLVRLEQLPEQVKEAANRKEEI |
| Ga0181375_10737601 | 3300017718 | Marine | KNLELQALVVATSEQEMFRYQGKINSLVRLEQLKETVQEALNRKEEGEKNAF |
| Ga0181383_11333441 | 3300017720 | Seawater | NLKTLDLQALAVATSESEMFRLQGKINSLVRLEQLPEQVKEAANRKEET |
| Ga0181398_11355611 | 3300017725 | Seawater | QALAVATSESEMFRLQGKINSLVRLEQLPEQVKEAANRKEDI |
| Ga0181401_10982111 | 3300017727 | Seawater | ATSESEMFRLQGKINSLVRLEQLPEQVKEAANRKEET |
| Ga0181428_11225281 | 3300017738 | Seawater | TLDLQALAVATSESEMFRLQGKINSLVRLEQLPEQVKEAANRKEET |
| Ga0181433_11055791 | 3300017739 | Seawater | TSESEMFRLQGKITSLVRLEQLPEQVKEAVNRKEET |
| Ga0181418_10520481 | 3300017740 | Seawater | LVVATSESEMFRLQGKITSLVRLEQLPEQVKEAVNRKEET |
| Ga0181418_11720181 | 3300017740 | Seawater | VATSELEMFRLQGKINSLVRLEQLPEQVKEAINRKEET |
| Ga0181397_11411041 | 3300017744 | Seawater | VVATSEQEMFRLQGKMSSLVRLEQLDLQVKEALTRREENV |
| Ga0181405_11308541 | 3300017750 | Seawater | ALVVATSESEMFRLQGKITSLVRLEQLPEQVKEAVNRKEET |
| Ga0181405_11731111 | 3300017750 | Seawater | LAVATSESEMFRLQGKINSLVRLEQLPEQVKEAANRKEET |
| Ga0187219_11093192 | 3300017751 | Seawater | VVATSESEMFRVQGKINSLVRLEQLPEQVKEAINRKKEL |
| Ga0187219_11165402 | 3300017751 | Seawater | KTLDLQALAVATSESEMFRLQGKINSLVRLEQLPEQVKEAANRKEEI |
| Ga0181411_10957841 | 3300017755 | Seawater | GKGQQELEVATSEQEMYRSQGKVNLLVRLEQLKDSVNEAKDRNE |
| Ga0181420_10803041 | 3300017757 | Seawater | LAVATSESEMFRLQGRVNSLVRLEQLDLQVKEAITRKEEI |
| Ga0181420_10990642 | 3300017757 | Seawater | ATSESEMFRLQGKINSLVRLEQLPEQVKEAVNRKEEV |
| Ga0181409_12067791 | 3300017758 | Seawater | LAVAASESEMFRLQGKINSLVRLEQLPEQVKEAVNRKEEI |
| Ga0181414_11750172 | 3300017759 | Seawater | ATSESEMFRLQGKINSLVRLEQLPEQVKEAANRKEEI |
| Ga0181408_10663301 | 3300017760 | Seawater | TSESEMFRLQGKINSLVRLEQLPEQVKEAANRKEDI |
| Ga0187220_12028042 | 3300017768 | Seawater | VATSEQEMFRLQGKLRSLVHLEQLEEQVKEALNRRED |
| Ga0187221_11250112 | 3300017769 | Seawater | VATSESEMFRLQGKINSLVRLEQLPEQVKEAVNRKEDI |
| Ga0187217_12203761 | 3300017770 | Seawater | QALAVATSEQEMYRLQGRVSSLVRLEQLDKQVKEAINRKEGD |
| Ga0181430_11447432 | 3300017772 | Seawater | KTLESQALVVATSESEMFRLQGKITSLVRLEQLPEQVKEAVNRKEET |
| Ga0181432_11741982 | 3300017775 | Seawater | TSEQEMFRCQGKVASLVRLEQLKEIVQEALNRGEENA |
| Ga0181395_12506901 | 3300017779 | Seawater | HLDNLKTLELQALVVATSESEMFRLQGKVNSLVRLEQLPEQVKEAINRKEET |
| Ga0181379_11222372 | 3300017783 | Seawater | LAVATSESEMFRLQGKINSLVRLEQLPEQVKEAANRKEDI |
| Ga0181379_12444711 | 3300017783 | Seawater | SESEMFRLQGKINSLVRLEQLPEQVKEAINRKEET |
| Ga0181424_102227201 | 3300017786 | Seawater | QALVVATSESEMFRLQGKITSLVRLEQLPEQVKEAVNRKEET |
| Ga0181552_104031501 | 3300017824 | Salt Marsh | QALAVATSESEMFRLQGKINSLVRLEQLPEQVKEAVNRKEEI |
| Ga0181577_107435191 | 3300017951 | Salt Marsh | KNLELQALVVATSESEMFRLQGKVNSLVRLEQLDLQVKEAINRKEEL |
| Ga0181583_101447401 | 3300017952 | Salt Marsh | NLDLQALVVATSELEMYRLQGKLRLVGHLDQLDLLVKEALNRKEEK |
| Ga0181585_107257711 | 3300017969 | Salt Marsh | NLDLQALAVATSESEMFRLQGKVNSLVRLEQLPDKVKEALTRKEEEQ |
| Ga0181559_106607871 | 3300018415 | Salt Marsh | LDLQALVVATSESEMFRLQGKLRSLVHLEQLAEQVKEALNRIED |
| Ga0181563_106060931 | 3300018420 | Salt Marsh | LDLQALAVATSESEMFRLQGRVNSLVRLEQLPGRVKEALTRKEEK |
| Ga0181591_107450371 | 3300018424 | Salt Marsh | SLKNLDLQALAVATSESEMFRLQGKVNSLVRLEQLPGKVKEALTRKEEEQ |
| Ga0181566_107068261 | 3300018426 | Salt Marsh | LVVATSESEMFRLQGKVNSLVRLEQLDLQVKEAINRKEEL |
| Ga0182077_11687131 | 3300019281 | Salt Marsh | EYLHSLKTLDLQALAVATSESEMFRLQGRVNSLVRLEQLPGRVKEALTRKEEKQ |
| Ga0182075_15191852 | 3300019282 | Salt Marsh | LDLQALAVATSESEMFRLQGKVNSLVRLEQLPDKVKEALTRKEEEQ |
| Ga0194023_10778621 | 3300019756 | Freshwater | QALAVATSESEMFRLQGRVNSLVRLEQLPGRVKEALTRKEEEQ |
| Ga0194023_11234891 | 3300019756 | Freshwater | QALAVATSESEMFRLQGRVNSLVRLEQLPGRVKEALTRKEEKQ |
| Ga0211521_102071441 | 3300020428 | Marine | LQALAVATSESEMFRLQGKINSLVRLEQLPEQVKEAANRKEET |
| Ga0211708_102694631 | 3300020436 | Marine | ALAVATSESEMFRLQGRITSLGMLEELPQKVKEALTRIEE |
| Ga0211558_104927382 | 3300020439 | Marine | DLQALAVATSESEMFRLQGKVNSVVRLEQLPEQVKEALNRKED |
| Ga0211676_102564161 | 3300020463 | Marine | LQALAVATSESEMFRLQGKINSLVRLEQLPEQVKEAVNRKEEL |
| Ga0211503_105768171 | 3300020478 | Marine | NLALRELVVATSELEMYRCQGRINSLERLEQLENEVEEALNRQEE |
| Ga0213860_103672492 | 3300021368 | Seawater | KNQQNLDLQALVVATSELEMYRLQGKIRLVGQLEQLQQQVQEALNRKEEN |
| Ga0213868_103816952 | 3300021389 | Seawater | ALAVATSESEMFRLQGKINSLVRLEQLPEQVKEAVNRKEEI |
| Ga0222718_105983432 | 3300021958 | Estuarine Water | NLKTLDLQALAVATSESEMFRLQGRVNSLVRLEQLPEQVKEAVNRKEEL |
| Ga0222715_106279111 | 3300021960 | Estuarine Water | ALVVATSESEMFRLQGKLRSLVHLEQLPGKVKEALTRKEEEQ |
| Ga0222713_107679721 | 3300021962 | Estuarine Water | LDLQALVVATSESEMFRLQGKLRSLVHLEQLPGKVKEALTRKEEK |
| Ga0222719_105113232 | 3300021964 | Estuarine Water | AVATSESEMFRLQGKINSLVRLEQLPEQVKEAANRKEEI |
| Ga0212024_11024722 | 3300022065 | Aqueous | VVATSELEMYRLQGKLRLVGQLEQLDLQVKEALNRKEEN |
| Ga0224906_10959392 | 3300022074 | Seawater | LDLQALAVATSESEMFRLQGKINSLVRLEQLPEQVKEAANRKEET |
| Ga0212020_10552902 | 3300022167 | Aqueous | TSESEMFRLQGKVNSLVRLEQLDLQVKEAINRKEEL |
| Ga0212027_10180543 | 3300022168 | Aqueous | HNLKTLDLQALAVATSESEMFRLQGKVNSLVRLEQLPDKVKEALTRKEEK |
| Ga0212031_10732672 | 3300022176 | Aqueous | LQALVVATSESEMFRLQGKLRSLVHLEQLPGKVKEALTRKEEEQ |
| Ga0196905_10396512 | 3300022198 | Aqueous | QALAVATSESEMFRLQGRVNSLVRLEQLPGKVKEALTRKEEE |
| Ga0196905_10756742 | 3300022198 | Aqueous | QALVVATSESEMFRLQGKLRSLVHLEQLPGKVKEALTRKEEEQ |
| Ga0196901_11175962 | 3300022200 | Aqueous | QEYLLHLKNLDLQALVVATSESEMFRLQGKLRSLVHLEQLPGKVKEALTRKEEEQ |
| Ga0224510_108117401 | 3300022309 | Sediment | DLQALVVATSESEMFRLQGKLRSLVHLEQLPGKVKEALTRKEEEQ |
| Ga0255770_102810532 | 3300022937 | Salt Marsh | VATSESEMFRLQGKVNSLVRLEQLPGKVKEALTRKEEEQ |
| Ga0255761_103024661 | 3300023170 | Salt Marsh | ESEMFRLQGKVNSLVRLEQLPGRVKEALTRKEEEQ |
| Ga0255772_105584781 | 3300023176 | Salt Marsh | QALAVATSESEMFRLQGKVNSLVRLEQLPGRVKEALTRKEEEQ |
| Ga0255768_105948682 | 3300023180 | Salt Marsh | AVATSESEMFRLQGRVNSLVRLEQLPGRVKEALTRKEEEQ |
| Ga0207902_10187841 | 3300025046 | Marine | LQALVVATSEQEMFRCQGKVSSLVRLEGLVEEVKEALERNE |
| Ga0207905_10340952 | 3300025048 | Marine | LNNLKTLELQALVVATSESEMFRSQGRVNSLVRLEQLPEQVKEAITRKEEI |
| Ga0207898_10153092 | 3300025049 | Marine | EGLKNLELQALAVATSELEMFRCQGKVASLVRLVKLPDEVKEALEREE |
| Ga0207887_10109501 | 3300025069 | Marine | ATSELEMFRCQGRVASLVRLARLRDEVKEALEREE |
| Ga0207887_10316012 | 3300025069 | Marine | VVATSEQEMFRCQGKINSLVRLEQLKETVQEALNRGEENA |
| Ga0208791_10856852 | 3300025083 | Marine | LAVATSESEMFRLQGKINSLVRLEQLPEQVKEAANRKEEI |
| Ga0208434_10551501 | 3300025098 | Marine | QALAVATSESEMFRLQGKINSLVRLEQLPEQVKEAVNRKEQT |
| Ga0208013_10909562 | 3300025103 | Marine | VATSESEMFRLQGKINSLVRLEQLPEQVKEAVNRKEET |
| Ga0208793_10995622 | 3300025108 | Marine | LKTLDLQALAVATSESEMFRLQGKINSLVRLEQLPEQVKEAVNRKEDI |
| Ga0208790_11124552 | 3300025118 | Marine | LVVATSEQEMFRYQGKINSLVRLEQLKETVQEALDRGEENA |
| Ga0209644_11298612 | 3300025125 | Marine | ATSEQEMFRCQGKINSLVRLEQLKETVQEALDRGEDNA |
| Ga0209634_12354451 | 3300025138 | Marine | TLELQALVVATSESEMFRSQGRVNSLVRLEQLPEQVKEAITRKEEI |
| Ga0209337_13205171 | 3300025168 | Marine | LVVATSESEMFRSQGKINSLVRLEQLDLQVREAINRKEEI |
| Ga0208182_10462572 | 3300025251 | Deep Ocean | EQEMYRCQGKINSLVQLEQLKGQVTEALNRGEENA |
| Ga0208814_10562902 | 3300025276 | Deep Ocean | LKTLELQALVVATSELEMFRSQGRVNSLVRLEQLDLQVKEAITRKEEI |
| Ga0208180_11129711 | 3300025277 | Deep Ocean | LVVATSEQEMYRCQGKINSLVRLEQLKETVQEALNRGEENA |
| Ga0208449_11470281 | 3300025280 | Deep Ocean | NLELQVLAVATSELEMFRCQGKINLLERLEQLENEVKEAMNRQEEN |
| Ga0208030_10491061 | 3300025282 | Deep Ocean | LEGLKNLELQALAVATSELEMFRCQGRVSSLVRLEQLPDEVKEALEREE |
| Ga0208030_10694153 | 3300025282 | Deep Ocean | VATSEQEMFRCQGKVSSLVRLEGLVEEVKEALERNE |
| Ga0208315_10877362 | 3300025286 | Deep Ocean | TLELQVLAVATSELEMFRCQGKINSLERLEQLGNEVDEAMNRQEEN |
| Ga0208934_10494562 | 3300025293 | Deep Ocean | LQALAVATSELEMFRCQGRVSSLVRLEQLPDEVKEALEREE |
| Ga0208134_10809361 | 3300025652 | Aqueous | LDLQALAVATSESEMFRLQGKINSLVRLEQLPEQVKEAVNRKEEA |
| Ga0208019_10662021 | 3300025687 | Aqueous | ATSESEMFRLQGKLRSLVHLEQLPGKVKEALTRKEEEQ |
| Ga0208150_11168632 | 3300025751 | Aqueous | VATSESEMFRLQGKINSLVRLEQLPEQVKEAVNRKEEA |
| Ga0208899_10929512 | 3300025759 | Aqueous | VATSESEMFRLQGKINSLVRLEQLPEQVKEAVNRKEEV |
| Ga0208767_12410101 | 3300025769 | Aqueous | KNWDLQALAVATSESEMFRLQGKVNSLVRLEQLPDKVKEALTRKEEK |
| Ga0208427_12191741 | 3300025771 | Aqueous | ALAVATSESEMFRLQGKINSLVRLEQLPEQVKEAANRKEEI |
| Ga0208542_11141331 | 3300025818 | Aqueous | TSESEMFRLQGKVNSLVRLEQLPDKVKEALTRKEEK |
| Ga0208917_10802581 | 3300025840 | Aqueous | LHLNNLDLQALVVATSESEMFRLQGKLRSLVHLEQLPGKVKEALTRKEEEQ |
| Ga0208917_12414882 | 3300025840 | Aqueous | TSESEMFRLQGKLRSLVHLEQLPGKVKEALTRKEEEQ |
| Ga0208644_13091322 | 3300025889 | Aqueous | ATSESEMFRLQGRVNSLVRLEQLPGRVKEALTRKEEEQ |
| Ga0208451_10175162 | 3300026103 | Marine Oceanic | LVVATSEQEMFRCQGKVGSLVRLEQLKETVQEALNRGEENA |
| Ga0208560_10291611 | 3300026115 | Marine Oceanic | ELQGLVVATSEQEMYRCQGKINSLVRLEQLKETVQEALNRGEENA |
| Ga0208409_10965152 | 3300026212 | Marine | LVVATSEQEMFRYQGKINSLVRLEQLKETVQEALNRKEEGEK |
| Ga0208641_11930471 | 3300026268 | Marine | LQALVVATSEQEMFRCQGKVNSLVRLEQLKEQVAEAINRKIEEE |
| Ga0209816_11384742 | 3300027704 | Marine | DLQALVVATSEQEMYRLQGKVNSLVRLEQLDQQVKEAITRKEEI |
| Ga0209815_11862832 | 3300027714 | Marine | LVVATSESEMFRSQGRVNSLVRLEQLDLQVKEAITRKEEI |
| Ga0209279_100836182 | 3300027771 | Marine | NRKNLDLQALAVATSEQEMFRSQGKINSLATLLRLKEQVDEAIKRRE |
| Ga0209711_100770363 | 3300027788 | Marine | KALDLQALVVATSEQEMFRLQGKMSSLVRLEQLDLQVKEALTRRDENV |
| (restricted) Ga0255041_100446382 | 3300027837 | Seawater | LNNLKNFELQALVVATSEQEMYRLQGKLSFLGRLEQLDKQVKEAINRKEEI |
| (restricted) Ga0255041_104073351 | 3300027837 | Seawater | ATSESEMFRLQGKVSSLVRLEQLPAQVKEAINRKEEI |
| Ga0307488_107887791 | 3300031519 | Sackhole Brine | ELQALVVATSESEMFRLQGKVNSLVRLEQLDLQVREAVNRKEEI |
| Ga0307489_105232122 | 3300031569 | Sackhole Brine | VATSESEMFRSQGKINSLVRLEQLDLQVREAINRKEEI |
| Ga0302132_105491051 | 3300031605 | Marine | ALVVATSESEMFRSQGKINSLVRLEQLDLQVREAINRKEEI |
| Ga0302133_100264365 | 3300031646 | Marine | SELEMFRSQGKVNFLVRLGQLKGEVREALEREEEE |
| Ga0302120_101808032 | 3300031701 | Marine | NLELQVLAVATSELEMFRCQGKINSLERLVQLGNEVDEAMNRKEEI |
| Ga0315331_107169541 | 3300031774 | Seawater | VVATSEQEMYRLQGKLSSLVRLEQLDLQVKEAITRKEEI |
| Ga0315318_105756441 | 3300031886 | Seawater | SLELQALVVATSEQEMYRCQGKINSLVQLEQLKEQVQEALNRGEENA |
| Ga0315327_101766031 | 3300032032 | Seawater | NLELQVLAVATSELEMFRCQGKINSLERLEQLGNEVDEAMNRQEENYATR |
| Ga0315315_118085081 | 3300032073 | Seawater | LELQALVVATSESEMFRLQGKVNSLVRLEQLPEQVKEALNRKQEI |
| Ga0316201_109699781 | 3300032136 | Worm Burrow | VATSESEMFRLQGKINSLVRLEQLPEQVKEAVNRKEEI |
| Ga0310342_1013184342 | 3300032820 | Seawater | LQALVVATSEQEMFRCQGKVNSLVRLEGLVEEVKEALERNE |
| Ga0314858_052841_817_984 | 3300033742 | Sea-Ice Brine | LQEHLHNLKTLDLQALAVATSESEMFRLQGKINSLVRLEQLPEQVKEAVNRKEDI |
| Ga0314858_078155_681_818 | 3300033742 | Sea-Ice Brine | LELQALAVATSEQEMYRLQGRVSSLVRLEQLDKQVKEAINRKEEV |
| Ga0348335_077330_3_167 | 3300034374 | Aqueous | QEHLHNLKTLDLQALAVATSESEMFRLQGKINSLVRLEQLPEQVKEAVNRKEEI |
| Ga0348335_090158_2_139 | 3300034374 | Aqueous | LDLQALAVATSESEMFRLQGKVNSLVRLEQLPEQVKEAVNRKEEL |
| Ga0348335_131443_571_708 | 3300034374 | Aqueous | LDLQALAVATSESEMFRLQGKINSLVRLEQLPEQVKEAINRKEEI |
| Ga0348336_097948_3_131 | 3300034375 | Aqueous | QALAVATSESEMFRLQGKVNSLVRLEQLPEQVKEAVNRKEEL |
| Ga0348336_163373_477_641 | 3300034375 | Aqueous | QEHLHNLKSLDLQALAVATSESEMFRLQGKINSLVRLEQLPEQVKEAINRKEEI |
| Ga0348336_191131_7_144 | 3300034375 | Aqueous | MLELQALAVATSESEMFRLQGKIASLVHLEALPQQVKEALNRIEE |
| Ga0348337_087859_929_1057 | 3300034418 | Aqueous | QALAVATSESEMFRLQGKINSLVRLEQLPEQVKEAVNRKEEL |
| ⦗Top⦘ |