Metagenome Family F016636

Basic Information
Family ID	F016636
Family Type	Metagenome
Number of Sequences	245
Average Sequence Length	47 residues
Representative Sequence	LKALVWFWLIDETLSANLVYQSDYEIGSTTPSDEAMAKIMTMVMAW
Number of Associated Samples	80
Number of Associated Scaffolds	245

Quality Assessment
Transcriptomic Evidence	No
Most common taxonomic group	Unclassified
% of genes with valid RBS motifs	46.06 %
% of genes near scaffold ends (potentially truncated)	50.61 %
% of genes from short scaffolds (< 2000 bps)	98.37 %
Associated GOLD sequencing projects	77
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.40

Most Common Taxonomy
Group	Unclassified (86.531 % of family members)
NCBI Taxonomy ID	N/A
Taxonomy	N/A

Most Common Ecosystem
GOLD Ecosystem	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere (92.653 % of family members)
Environment Ontology (ENVO)	Unclassified (93.469 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant surface (93.061 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 51.35% β-sheet: 0.00% Coil/Unstructured: 48.65%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 245 Family Scaffolds
PF07727	RVT_2	0.82
PF10536	PMD	0.41
PF00665	rve	0.41
PF00338	Ribosomal_S10	0.41
PF03732	Retrotrans_gag	0.41
PF00182	Glyco_hydro_19	0.41
PF00078	RVT_1	0.41
PF08284	RVP_2	0.41

COG ID	Name	Functional Category	% Frequency in 245 Family Scaffolds
COG0051	Ribosomal protein S10	Translation, ribosomal structure and biogenesis [J]	0.41
COG2801	Transposase InsO and inactivated derivatives	Mobilome: prophages, transposons [X]	0.41
COG2826	Transposase and inactivated derivatives, IS30 family	Mobilome: prophages, transposons [X]	0.41
COG3179	Chitinase, GH19 family	Carbohydrate transport and metabolism [G]	0.41
COG3316	Transposase (or an inactivated derivative), DDE domain	Mobilome: prophages, transposons [X]	0.41
COG3979	Chitodextrinase	Carbohydrate transport and metabolism [G]	0.41
COG4584	Transposase	Mobilome: prophages, transposons [X]	0.41

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	86.53 %
All Organisms	root	All Organisms	13.47 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	86.53 %
cellular organisms	root	All Organisms → cellular organisms	13.47 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	86.53 %
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	13.47 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	86.53 %
Viridiplantae	kingdom	All Organisms → cellular organisms → Eukaryota → Viridiplantae	13.47 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	86.53 %
Streptophyta	phylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	13.47 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	86.53 %
Streptophytina	subphylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina	13.47 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	86.53 %
Embryophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	13.47 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	86.53 %
Tracheophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta	11.84 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	86.53 %
Euphyllophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta	11.84 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	86.53 %
Spermatophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta	11.84 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	86.53 %
Magnoliopsida	class	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	11.84 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	86.53 %
Mesangiospermae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae	11.84 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	86.53 %
Liliopsida	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida	11.43 %
eudicotyledons	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons	0.41 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	86.53 %
Petrosaviidae	subclass	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae	11.43 %
Gunneridae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae	0.41 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	86.53 %
commelinids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids	11.43 %
Pentapetalae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae	0.41 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	86.53 %
Poales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales	11.43 %
rosids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids	0.41 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	86.53 %
Poaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	11.43 %
rosids incertae sedis	no rank	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis	0.41 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	86.53 %
PACMAD clade	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade	9.39 %
Vitales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales	0.41 %
BOP clade	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade	0.41 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	86.53 %
Panicoideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	9.39 %
Oryzoideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae	0.41 %
Vitaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales → Vitaceae	0.41 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	86.53 %
Andropogonodae	no rank	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae	6.12 %
Panicodae	no rank	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae	2.04 %
Viteae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales → Vitaceae → Viteae	0.41 %
Oryzeae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae	0.41 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	86.53 %
Andropogoneae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	6.12 %
Paniceae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae	2.04 %
Oryzinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae	0.41 %
Vitis	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales → Vitaceae → Viteae → Vitis	0.41 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	86.53 %
Saccharinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae	3.67 %
Sorghinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae	2.04 %
Panicinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae	1.63 %
Anthephorinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Anthephorinae	0.41 %
Tripsacinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae	0.41 %
Oryza	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza	0.41 %
Vitis vinifera	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales → Vitaceae → Viteae → Vitis → Vitis vinifera	0.41 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	86.53 %
Miscanthus	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus	2.45 %
Sorghum	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum	2.04 %
Panicum	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	1.63 %
Saccharum	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum	1.22 %
Digitaria	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Anthephorinae → Digitaria	0.41 %
Zea	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea	0.41 %
Oryza	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza	0.41 %
Vitis vinifera	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales → Vitaceae → Viteae → Vitis → Vitis vinifera	0.41 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	86.53 %
Miscanthus lutarioriparius	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius	2.45 %
Sorghum bicolor	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	2.04 %
Saccharum officinarum complex	no rank	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex	1.22 %
Digitaria exilis	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Anthephorinae → Digitaria → Digitaria exilis	0.41 %
Panicum miliaceum	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	0.41 %
Zea mays	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays	0.41 %
Oryza	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza	0.41 %
Vitis vinifera	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales → Vitaceae → Viteae → Vitis → Vitis vinifera	0.41 %
Panicum sect. Hiantes	section	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes	0.82 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	86.53 %
Miscanthus lutarioriparius	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius	2.45 %
Sorghum bicolor	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	2.04 %
Saccharum spontaneum	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum spontaneum	0.41 %
Digitaria exilis	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Anthephorinae → Digitaria → Digitaria exilis	0.41 %
Panicum miliaceum	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	0.41 %
Zea mays	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays	0.41 %
Oryza	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza	0.41 %
Vitis vinifera	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales → Vitaceae → Viteae → Vitis → Vitis vinifera	0.41 %
Panicum virgatum	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	0.82 %
Saccharum hybrid cultivar	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum hybrid cultivar	0.82 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300005290\|Ga0065712_10056663	Not Available	593	Open in IMG/M
3300005334\|Ga0068869_101722978	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius	559	Open in IMG/M
3300005364\|Ga0070673_100977410	Not Available	787	Open in IMG/M
3300005459\|Ga0068867_101067983	Not Available	735	Open in IMG/M
3300005459\|Ga0068867_101994003	Not Available	548	Open in IMG/M
3300005614\|Ga0068856_101506209	Not Available	686	Open in IMG/M
3300005718\|Ga0068866_11261789	Not Available	535	Open in IMG/M
3300005840\|Ga0068870_11259173	Not Available	537	Open in IMG/M
3300009036\|Ga0105244_10316542	Not Available	721	Open in IMG/M
3300009148\|Ga0105243_12758667	Not Available	532	Open in IMG/M
3300013296\|Ga0157374_11510265	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	695	Open in IMG/M
3300013296\|Ga0157374_12339797	Not Available	562	Open in IMG/M
3300015267\|Ga0182122_1053368	Not Available	549	Open in IMG/M
3300015268\|Ga0182154_1001812	Not Available	1378	Open in IMG/M
3300015268\|Ga0182154_1005289	Not Available	1019	Open in IMG/M
3300015268\|Ga0182154_1013996	Not Available	788	Open in IMG/M
3300015269\|Ga0182113_1020557	Not Available	793	Open in IMG/M
3300015269\|Ga0182113_1074367	Not Available	547	Open in IMG/M
3300015269\|Ga0182113_1092526	Not Available	510	Open in IMG/M
3300015269\|Ga0182113_1096456	Not Available	503	Open in IMG/M
3300015275\|Ga0182172_1017599	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	757	Open in IMG/M
3300015275\|Ga0182172_1023943	Not Available	698	Open in IMG/M
3300015275\|Ga0182172_1056049	Not Available	553	Open in IMG/M
3300015275\|Ga0182172_1075503	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	504	Open in IMG/M
3300015276\|Ga0182170_1014200	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius	806	Open in IMG/M
3300015277\|Ga0182128_1020299	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays	738	Open in IMG/M
3300015277\|Ga0182128_1028754	Not Available	672	Open in IMG/M
3300015277\|Ga0182128_1075628	Not Available	510	Open in IMG/M
3300015277\|Ga0182128_1080743	Not Available	500	Open in IMG/M
3300015279\|Ga0182174_1020919	Not Available	753	Open in IMG/M
3300015282\|Ga0182124_1015429	Not Available	799	Open in IMG/M
3300015282\|Ga0182124_1016939	Not Available	780	Open in IMG/M
3300015282\|Ga0182124_1048080	Not Available	589	Open in IMG/M
3300015283\|Ga0182156_1009349	Not Available	947	Open in IMG/M
3300015283\|Ga0182156_1039795	Not Available	635	Open in IMG/M
3300015283\|Ga0182156_1042020	Not Available	625	Open in IMG/M
3300015283\|Ga0182156_1083424	Not Available	511	Open in IMG/M
3300015285\|Ga0182186_1003462	Not Available	1246	Open in IMG/M
3300015285\|Ga0182186_1033824	Not Available	654	Open in IMG/M
3300015286\|Ga0182176_1019062	Not Available	806	Open in IMG/M
3300015286\|Ga0182176_1078753	Not Available	517	Open in IMG/M
3300015287\|Ga0182171_1004820	Not Available	1120	Open in IMG/M
3300015287\|Ga0182171_1060741	Not Available	563	Open in IMG/M
3300015288\|Ga0182173_1000646	Not Available	1988	Open in IMG/M
3300015288\|Ga0182173_1056994	Not Available	569	Open in IMG/M
3300015289\|Ga0182138_1014262	Not Available	842	Open in IMG/M
3300015289\|Ga0182138_1066101	Not Available	550	Open in IMG/M
3300015289\|Ga0182138_1071740	Not Available	537	Open in IMG/M
3300015289\|Ga0182138_1075077	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum hybrid cultivar	530	Open in IMG/M
3300015291\|Ga0182125_1084774	Not Available	520	Open in IMG/M
3300015292\|Ga0182141_1017547	Not Available	811	Open in IMG/M
3300015292\|Ga0182141_1021768	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	765	Open in IMG/M
3300015292\|Ga0182141_1067925	Not Available	555	Open in IMG/M
3300015292\|Ga0182141_1084978	Not Available	519	Open in IMG/M
3300015294\|Ga0182126_1080320	Not Available	531	Open in IMG/M
3300015295\|Ga0182175_1034909	Not Available	684	Open in IMG/M
3300015296\|Ga0182157_1031827	Not Available	712	Open in IMG/M
3300015296\|Ga0182157_1059865	Not Available	594	Open in IMG/M
3300015296\|Ga0182157_1082438	Not Available	539	Open in IMG/M
3300015298\|Ga0182106_1064828	Not Available	580	Open in IMG/M
3300015298\|Ga0182106_1073810	Not Available	557	Open in IMG/M
3300015298\|Ga0182106_1100163	Not Available	506	Open in IMG/M
3300015299\|Ga0182107_1024172	Not Available	775	Open in IMG/M
3300015299\|Ga0182107_1037595	Not Available	684	Open in IMG/M
3300015300\|Ga0182108_1044303	Not Available	657	Open in IMG/M
3300015300\|Ga0182108_1044990	Not Available	655	Open in IMG/M
3300015300\|Ga0182108_1048507	Not Available	640	Open in IMG/M
3300015300\|Ga0182108_1063257	Not Available	591	Open in IMG/M
3300015300\|Ga0182108_1077293	Not Available	556	Open in IMG/M
3300015300\|Ga0182108_1093013	Not Available	525	Open in IMG/M
3300015302\|Ga0182143_1040105	Not Available	670	Open in IMG/M
3300015302\|Ga0182143_1096574	Not Available	515	Open in IMG/M
3300015302\|Ga0182143_1102837	Not Available	505	Open in IMG/M
3300015302\|Ga0182143_1103559	Not Available	503	Open in IMG/M
3300015303\|Ga0182123_1048099	Not Available	620	Open in IMG/M
3300015303\|Ga0182123_1059053	Not Available	585	Open in IMG/M
3300015304\|Ga0182112_1004832	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	1202	Open in IMG/M
3300015305\|Ga0182158_1034324	Not Available	699	Open in IMG/M
3300015305\|Ga0182158_1038770	Not Available	675	Open in IMG/M
3300015305\|Ga0182158_1069333	Not Available	570	Open in IMG/M
3300015305\|Ga0182158_1069566	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	570	Open in IMG/M
3300015305\|Ga0182158_1081812	Not Available	542	Open in IMG/M
3300015305\|Ga0182158_1096778	Not Available	515	Open in IMG/M
3300015307\|Ga0182144_1038620	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales → Vitaceae → Viteae → Vitis → Vitis vinifera	686	Open in IMG/M
3300015308\|Ga0182142_1020765	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	835	Open in IMG/M
3300015308\|Ga0182142_1026726	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza	778	Open in IMG/M
3300015308\|Ga0182142_1059613	Not Available	617	Open in IMG/M
3300015308\|Ga0182142_1066376	Not Available	597	Open in IMG/M
3300015314\|Ga0182140_1008956	Not Available	1052	Open in IMG/M
3300015314\|Ga0182140_1095141	Not Available	535	Open in IMG/M
3300015314\|Ga0182140_1107073	Not Available	516	Open in IMG/M
3300015321\|Ga0182127_1032824	Not Available	758	Open in IMG/M
3300015321\|Ga0182127_1060996	Not Available	630	Open in IMG/M
3300015321\|Ga0182127_1082242	Not Available	575	Open in IMG/M
3300015321\|Ga0182127_1093120	Not Available	553	Open in IMG/M
3300015322\|Ga0182110_1054337	Not Available	651	Open in IMG/M
3300015322\|Ga0182110_1061123	Not Available	628	Open in IMG/M
3300015323\|Ga0182129_1099840	Not Available	527	Open in IMG/M
3300015338\|Ga0182137_1124578	Not Available	589	Open in IMG/M
3300015341\|Ga0182187_1034856	Not Available	921	Open in IMG/M
3300015341\|Ga0182187_1057017	Not Available	782	Open in IMG/M
3300015341\|Ga0182187_1064598	Not Available	750	Open in IMG/M
3300015341\|Ga0182187_1112238	Not Available	620	Open in IMG/M
3300015342\|Ga0182109_1041265	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius	929	Open in IMG/M
3300015342\|Ga0182109_1078154	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius	743	Open in IMG/M
3300015342\|Ga0182109_1082402	Not Available	729	Open in IMG/M
3300015342\|Ga0182109_1101029	Not Available	677	Open in IMG/M
3300015342\|Ga0182109_1107767	Not Available	662	Open in IMG/M
3300015342\|Ga0182109_1120150	Not Available	636	Open in IMG/M
3300015342\|Ga0182109_1169661	Not Available	559	Open in IMG/M
3300015342\|Ga0182109_1216634	Not Available	508	Open in IMG/M
3300015343\|Ga0182155_1004005	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	1798	Open in IMG/M
3300015343\|Ga0182155_1034613	Not Available	968	Open in IMG/M
3300015343\|Ga0182155_1135636	Not Available	607	Open in IMG/M
3300015343\|Ga0182155_1148873	Not Available	587	Open in IMG/M
3300015343\|Ga0182155_1190801	Not Available	535	Open in IMG/M
3300015343\|Ga0182155_1193152	Not Available	532	Open in IMG/M
3300015343\|Ga0182155_1193638	Not Available	532	Open in IMG/M
3300015343\|Ga0182155_1193647	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius	532	Open in IMG/M
3300015343\|Ga0182155_1196768	Not Available	529	Open in IMG/M
3300015343\|Ga0182155_1226629	Not Available	500	Open in IMG/M
3300015344\|Ga0182189_1016922	Not Available	1238	Open in IMG/M
3300015344\|Ga0182189_1146813	Not Available	596	Open in IMG/M
3300015344\|Ga0182189_1187148	Not Available	543	Open in IMG/M
3300015344\|Ga0182189_1217824	Not Available	512	Open in IMG/M
3300015345\|Ga0182111_1119389	Not Available	663	Open in IMG/M
3300015345\|Ga0182111_1132066	Not Available	639	Open in IMG/M
3300015345\|Ga0182111_1187823	Not Available	558	Open in IMG/M
3300015345\|Ga0182111_1193668	Not Available	551	Open in IMG/M
3300015345\|Ga0182111_1202518	Not Available	541	Open in IMG/M
3300015345\|Ga0182111_1204109	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	540	Open in IMG/M
3300015345\|Ga0182111_1242875	Not Available	503	Open in IMG/M
3300015346\|Ga0182139_1091982	Not Available	731	Open in IMG/M
3300015346\|Ga0182139_1092750	Not Available	729	Open in IMG/M
3300015346\|Ga0182139_1160130	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	594	Open in IMG/M
3300015346\|Ga0182139_1218042	Not Available	526	Open in IMG/M
3300015347\|Ga0182177_1046665	Not Available	937	Open in IMG/M
3300015347\|Ga0182177_1053355	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum spontaneum	895	Open in IMG/M
3300015347\|Ga0182177_1167990	Not Available	586	Open in IMG/M
3300015347\|Ga0182177_1191648	Not Available	557	Open in IMG/M
3300015351\|Ga0182161_1055728	Not Available	923	Open in IMG/M
3300015351\|Ga0182161_1112130	Not Available	709	Open in IMG/M
3300015351\|Ga0182161_1121266	Not Available	688	Open in IMG/M
3300015351\|Ga0182161_1126232	Not Available	678	Open in IMG/M
3300015351\|Ga0182161_1164451	Not Available	611	Open in IMG/M
3300015351\|Ga0182161_1176695	Not Available	594	Open in IMG/M
3300015351\|Ga0182161_1182122	Not Available	587	Open in IMG/M
3300015351\|Ga0182161_1210634	Not Available	554	Open in IMG/M
3300015351\|Ga0182161_1231091	Not Available	533	Open in IMG/M
3300015355\|Ga0182159_1064344	Not Available	1021	Open in IMG/M
3300015355\|Ga0182159_1134527	Not Available	760	Open in IMG/M
3300015355\|Ga0182159_1152431	Not Available	721	Open in IMG/M
3300015355\|Ga0182159_1166932	Not Available	694	Open in IMG/M
3300015355\|Ga0182159_1191024	Not Available	655	Open in IMG/M
3300015355\|Ga0182159_1195617	Not Available	649	Open in IMG/M
3300015355\|Ga0182159_1209767	Not Available	630	Open in IMG/M
3300015355\|Ga0182159_1252725	Not Available	581	Open in IMG/M
3300015355\|Ga0182159_1274499	Not Available	560	Open in IMG/M
3300015355\|Ga0182159_1330578	Not Available	516	Open in IMG/M
3300015355\|Ga0182159_1348428	Not Available	504	Open in IMG/M
3300015361\|Ga0182145_1077593	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	684	Open in IMG/M
3300015361\|Ga0182145_1148003	Not Available	551	Open in IMG/M
3300015361\|Ga0182145_1150513	Not Available	548	Open in IMG/M
3300015361\|Ga0182145_1161164	Not Available	535	Open in IMG/M
3300015361\|Ga0182145_1173438	Not Available	522	Open in IMG/M
3300015361\|Ga0182145_1178793	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	517	Open in IMG/M
3300017404\|Ga0182203_1151330	Not Available	516	Open in IMG/M
3300017404\|Ga0182203_1153366	Not Available	514	Open in IMG/M
3300017407\|Ga0182220_1016552	Not Available	838	Open in IMG/M
3300017407\|Ga0182220_1029708	Not Available	718	Open in IMG/M
3300017407\|Ga0182220_1056118	Not Available	606	Open in IMG/M
3300017407\|Ga0182220_1067844	Not Available	575	Open in IMG/M
3300017407\|Ga0182220_1074790	Not Available	560	Open in IMG/M
3300017409\|Ga0182204_1072491	Not Available	587	Open in IMG/M
3300017409\|Ga0182204_1074949	Not Available	581	Open in IMG/M
3300017410\|Ga0182207_1016763	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	1064	Open in IMG/M
3300017410\|Ga0182207_1107913	Not Available	595	Open in IMG/M
3300017411\|Ga0182208_1028177	Not Available	797	Open in IMG/M
3300017411\|Ga0182208_1073846	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Anthephorinae → Digitaria → Digitaria exilis	600	Open in IMG/M
3300017411\|Ga0182208_1111460	Not Available	527	Open in IMG/M
3300017411\|Ga0182208_1122445	Not Available	511	Open in IMG/M
3300017415\|Ga0182202_1001651	Not Available	1888	Open in IMG/M
3300017415\|Ga0182202_1048154	Not Available	704	Open in IMG/M
3300017415\|Ga0182202_1094923	Not Available	570	Open in IMG/M
3300017415\|Ga0182202_1132672	Not Available	510	Open in IMG/M
3300017420\|Ga0182228_1075839	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	610	Open in IMG/M
3300017420\|Ga0182228_1081850	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	593	Open in IMG/M
3300017424\|Ga0182219_1133100	Not Available	511	Open in IMG/M
3300017425\|Ga0182224_1029182	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	861	Open in IMG/M
3300017425\|Ga0182224_1085772	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	621	Open in IMG/M
3300017425\|Ga0182224_1085794	Not Available	621	Open in IMG/M
3300017430\|Ga0182192_1014399	Not Available	1157	Open in IMG/M
3300017430\|Ga0182192_1060009	Not Available	725	Open in IMG/M
3300017430\|Ga0182192_1079186	Not Available	660	Open in IMG/M
3300017430\|Ga0182192_1124774	Not Available	564	Open in IMG/M
3300017430\|Ga0182192_1135357	Not Available	548	Open in IMG/M
3300017436\|Ga0182209_1061826	Not Available	700	Open in IMG/M
3300017436\|Ga0182209_1062786	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius	697	Open in IMG/M
3300017436\|Ga0182209_1121543	Not Available	566	Open in IMG/M
3300017436\|Ga0182209_1168933	Not Available	506	Open in IMG/M
3300017438\|Ga0182191_1007773	Not Available	1366	Open in IMG/M
3300017438\|Ga0182191_1020413	Not Available	1022	Open in IMG/M
3300017438\|Ga0182191_1121416	Not Available	578	Open in IMG/M
3300017438\|Ga0182191_1153112	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	534	Open in IMG/M
3300017438\|Ga0182191_1162177	Not Available	524	Open in IMG/M
3300017438\|Ga0182191_1181804	Not Available	503	Open in IMG/M
3300017442\|Ga0182221_1162918	Not Available	509	Open in IMG/M
3300017442\|Ga0182221_1163925	Not Available	508	Open in IMG/M
3300017442\|Ga0182221_1169190	Not Available	503	Open in IMG/M
3300017443\|Ga0182193_1015115	Not Available	1144	Open in IMG/M
3300017443\|Ga0182193_1049089	Not Available	801	Open in IMG/M
3300017443\|Ga0182193_1097411	Not Available	642	Open in IMG/M
3300017443\|Ga0182193_1112337	Not Available	612	Open in IMG/M
3300017680\|Ga0182233_1076453	Not Available	604	Open in IMG/M
3300017683\|Ga0182218_1075297	Not Available	627	Open in IMG/M
3300017683\|Ga0182218_1139407	Not Available	518	Open in IMG/M
3300017684\|Ga0182225_1025418	Not Available	863	Open in IMG/M
3300017684\|Ga0182225_1027684	Not Available	840	Open in IMG/M
3300017684\|Ga0182225_1090972	Not Available	581	Open in IMG/M
3300017684\|Ga0182225_1098930	Not Available	566	Open in IMG/M
3300017684\|Ga0182225_1112226	Not Available	544	Open in IMG/M
3300017685\|Ga0182227_1068952	Not Available	651	Open in IMG/M
3300017685\|Ga0182227_1090329	Not Available	586	Open in IMG/M
3300017685\|Ga0182227_1099341	Not Available	566	Open in IMG/M
3300017685\|Ga0182227_1107325	Not Available	549	Open in IMG/M
3300017686\|Ga0182205_1018863	Not Available	1026	Open in IMG/M
3300017686\|Ga0182205_1045848	Not Available	778	Open in IMG/M
3300017686\|Ga0182205_1053062	Not Available	742	Open in IMG/M
3300017686\|Ga0182205_1078700	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum hybrid cultivar	653	Open in IMG/M
3300017686\|Ga0182205_1082975	Not Available	642	Open in IMG/M
3300017686\|Ga0182205_1157965	Not Available	517	Open in IMG/M
3300017689\|Ga0182231_1065898	Not Available	684	Open in IMG/M
3300017689\|Ga0182231_1066015	Not Available	684	Open in IMG/M
3300017690\|Ga0182223_1086795	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	556	Open in IMG/M
3300017690\|Ga0182223_1100768	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	534	Open in IMG/M
3300017690\|Ga0182223_1107436	Not Available	524	Open in IMG/M
3300025926\|Ga0207659_11869485	Not Available	509	Open in IMG/M
3300025935\|Ga0207709_11179117	Not Available	631	Open in IMG/M
3300025942\|Ga0207689_10363393	Not Available	1204	Open in IMG/M
3300026023\|Ga0207677_11687831	Not Available	587	Open in IMG/M
3300026089\|Ga0207648_10802348	Not Available	876	Open in IMG/M

Habitat	Taxonomy	Distribution
Host-Associated	Host-Associated	100.00%

Habitat	Taxonomy	Distribution
Plants	Host-Associated → Plants	100.00%

Habitat	Taxonomy	Distribution
Phyllosphere	Host-Associated → Plants → Phyllosphere	93.06%
Rhizoplane	Host-Associated → Plants → Rhizoplane	4.08%
Rhizosphere	Host-Associated → Plants → Rhizosphere	2.86%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified	93.06%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	3.67%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	2.04%
Soil	Host-Associated → Plants → Rhizosphere → Soil	0.82%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	0.41%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified	93.06%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	3.67%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	2.04%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	0.82%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	0.41%

Habitat	Taxonomy	Distribution
Miscanthus Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere	92.65%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	3.27%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	1.22%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	0.82%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere	0.41%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	0.41%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	0.41%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere	0.41%
Switchgrass Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere	0.41%

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
Ga0065712_100566631	3300005290	Miscanthus Rhizosphere	KALVWFWLIDETLSANLVYQSDHEIGSTTPSDEAMTKIMTMVMAWL*
Ga0068869_1017229783	3300005334	Miscanthus Rhizosphere	VKALVWFWLIDETLSANLVYQDVYEIGSTTPSDEAMTKIMTMVIAW
Ga0070673_1009774101	3300005364	Switchgrass Rhizosphere	LKALVWFWLIDETLSANLVYQDDYEIGSTTPSDEAMTKIMTMVIAW*
Ga0068867_1010679832	3300005459	Miscanthus Rhizosphere	LKALVWFWLIDKTLSANLVYQSDYEIGSTTPSDEAMVKIMMMVMAW*
Ga0068867_1019940031	3300005459	Miscanthus Rhizosphere	LKALVWFWLIDETLSANLVYQDDYEIGSTTPSDEAMAKIMTMVMAW*
Ga0068856_1015062091	3300005614	Corn Rhizosphere	ALVWFWLIDETLSANLVYQSDYEIGSTTPSDEAMTKIMTMVIAW*
Ga0068866_112617891	3300005718	Miscanthus Rhizosphere	KRGRLKALVWFWLIDETLSANLVYQSDYEIGSTTPSDEAMAKIMMMVMAW*
Ga0068870_112591731	3300005840	Miscanthus Rhizosphere	LKALVWFWLIDETLSANLVYQSDYEIGSTTPSDEAMAKIMTMVMAW*
Ga0105244_103165421	3300009036	Miscanthus Rhizosphere	LKALVWFWLIDKTLSVNLVYQSDYEIGSTTPSDEAMVKIMMMVMAW*
Ga0105243_127586671	3300009148	Miscanthus Rhizosphere	LKALVWFWLIDETLSANLVYQDVYEIGSTTPSDEAMTKIMTMVIAW
Ga0157374_115102651	3300013296	Miscanthus Rhizosphere	VKALVWFWLIDEALSANLVYQSDYEIGSTIPSGEANEDHDMMMVIPW*
Ga0157374_123397971	3300013296	Miscanthus Rhizosphere	LKALVWFWLIDETLSANLVYQSDYEIGSTTPSDEAMAKIMTTVTAW*
Ga0182122_10533681	3300015267	Miscanthus Phyllosphere	MLKALVWFWLIDETLSANLVYQDDYEIGSTTPSDEAMAKIM
Ga0182154_10018123	3300015268	Miscanthus Phyllosphere	LKALVWFWLIDETLSANLVYQDDYEIGSTTPSDEAMMKIMTMVIAW*
Ga0182154_10052892	3300015268	Miscanthus Phyllosphere	VKALVWFWLIDETLSANLVYQSDYEIGSTTPSDEEMAKIMTMVMAW*
Ga0182154_10139961	3300015268	Miscanthus Phyllosphere	MHLKALVCFWLIDETLSANLVYQDDYEIGSTTPSDEAMTKIM
Ga0182113_10205572	3300015269	Miscanthus Phyllosphere	VKALVWFWLIDETLSANLVYQDDHEIGSTTPSDEAMAKMMTMVM
Ga0182113_10735771	3300015269	Miscanthus Phyllosphere	MLGLCVNPLKALVWFWLIDEILSANLVYQSDYEIGSTTPSGETNQDHDMMMVMPW*
Ga0182113_10743671	3300015269	Miscanthus Phyllosphere	VVLLGHALLGSLKALVWFWLIDETLSANLVYQDDYEIGSTTPSKEAMMKIMIMVIAW*
Ga0182113_10925262	3300015269	Miscanthus Phyllosphere	LAGQNQGAHLKALVWFWLIDGTLSANLVYQSIYEIGSTTPSDEAMMKIMTMVMAW*
Ga0182113_10964562	3300015269	Miscanthus Phyllosphere	LLQLKALVWFWLIDETLSANLVYQDDYEIGSTTPSDEAMVKIMMMMMAW*
Ga0182172_10175991	3300015275	Miscanthus Phyllosphere	MAVMKALVWFWLIDETVSANLIYQSGHEIGSTIPSVEAMTKIMTMVMAWLRSKA*
Ga0182172_10239431	3300015275	Miscanthus Phyllosphere	FWLIDETLSANLVYQSDYEIGSTTPSDEAMAKIMTMVMAW*
Ga0182172_10560491	3300015275	Miscanthus Phyllosphere	MLEVVKALVWFWLIDETLSANLVCQGDYEIGSTTPSDEAMTKIMTMVMA*
Ga0182172_10755031	3300015275	Miscanthus Phyllosphere	VAVSYSTMMKALVWFWIDETLSANLVYLSDYKIGVTIPSDGVMVKIMMMVLP
Ga0182170_10142001	3300015276	Miscanthus Phyllosphere	MSSLNFYYRQLKALVWFWLIDETLSANLVYQDDYEIGSTTPSDEAMAKIMTMVMAW*
Ga0182170_10406813	3300015276	Miscanthus Phyllosphere	MKALVWFWLIDETLSANLVYQSDYEIGSTTPSDEEM
Ga0182128_10202991	3300015277	Miscanthus Phyllosphere	VKALVWLWLIDETLSANLVYQDDYEIGSITPSDEAMTKIMTMVIA
Ga0182128_10287542	3300015277	Miscanthus Phyllosphere	VKALVWFWLIDETLSANLVYQDDYEIGSTTPSDKAMVKIMTMVMAW*
Ga0182128_10756281	3300015277	Miscanthus Phyllosphere	MGRLKALVWFWLIDETLSVNLVYQSDYEIGSTTSSDEAMVKITMMVMAW*
Ga0182128_10807431	3300015277	Miscanthus Phyllosphere	MKALVWFWIIDETLSANLVYQDDYEIGSTTPSDEAMAKIMTMVMAW*
Ga0182174_10209192	3300015279	Miscanthus Phyllosphere	VAGAVKALDWFWLIDETLSANLVYQDDYEIGSTTPSDEAMTKIMIMVIAW*
Ga0182124_10154291	3300015282	Miscanthus Phyllosphere	VWFWLIDETLSANLVYQGDYEIGSTTPSDEAITKIMTMVMAW*
Ga0182124_10169392	3300015282	Miscanthus Phyllosphere	MATTAAVKALVWFWLIDETLSANLVYQSDYEIGSTTPSDEAMTKIMTMVMAW*
Ga0182124_10480801	3300015282	Miscanthus Phyllosphere	LKALVWFWLIDKTLSANLVYQSDYEIGSTTPSDEAMAKIMMMVMAW*
Ga0182156_10093491	3300015283	Miscanthus Phyllosphere	VKALVWFWLIDEPLSANLVYQSDYEIGSTTPSDEEMAKIMTMVMAW*
Ga0182156_10397951	3300015283	Miscanthus Phyllosphere	RLKALVWFWLIDETLSANLVYQGDYEIGSTTPSDEAITKIMTMVMAW*
Ga0182156_10420202	3300015283	Miscanthus Phyllosphere	VKALVWFWLIDETLSANLVYQDDYEIGSTTPSDEAMTKI
Ga0182156_10834241	3300015283	Miscanthus Phyllosphere	LKALVWFWLIDETLSANLVDQDDYEIGSTTPSDEAMAKIMTMVMTG*
Ga0182186_10034622	3300015285	Miscanthus Phyllosphere	LKALVWFWLIDETLSANLVYQDDYEIGSTTPSDEAMTKIMTMVIA
Ga0182186_10338241	3300015285	Miscanthus Phyllosphere	INETLSASLVYQSDHEICSTTSSGETNEDHDMMMVLTW*
Ga0182176_10190621	3300015286	Miscanthus Phyllosphere	HRRNVVKALVWFWLIDETLSANLVYQSDYEIGSNTPSDEAMVKIMTMVMAW*
Ga0182176_10787531	3300015286	Miscanthus Phyllosphere	MQLLKALVWFWLIDETLSANLVYQDDYEIGSTTSSDEAMTKIMTMVIAW*
Ga0182171_10048202	3300015287	Miscanthus Phyllosphere	MKALVWFWLIDETLSANLVYQYDYEIGSTTPSDEAMAKIMMMVMAW*
Ga0182171_10607411	3300015287	Miscanthus Phyllosphere	LKALVWFWLIDETLSANLAYQSDYEIGSTAPSDEAMVKIMMLVMAW*
Ga0182173_10006461	3300015288	Miscanthus Phyllosphere	SRTNRMKALVWFWLIDETLSANLVYQSDYEIGSTTPRDEAILKIMIMVMVC*
Ga0182173_10569941	3300015288	Miscanthus Phyllosphere	LKSLVWFWLIDETQSANLVYQSDYEIGSTTPSDEAMAKIMTMVMAW*
Ga0182138_10142621	3300015289	Miscanthus Phyllosphere	VKALVWFWLIDETLSANLVYQSDYEIGSTTPSDEAMAKIMTMVMAW*
Ga0182138_10661011	3300015289	Miscanthus Phyllosphere	LLHFLRLARLKALVWFWLIDETLSANLVYQSDYEIGSTTPSDEAMAKIMT
Ga0182138_10717401	3300015289	Miscanthus Phyllosphere	VSLVKALVWFWLIDETLSANLVYQSDYEIDSTTPSDEAMVKIIM
Ga0182138_10750771	3300015289	Miscanthus Phyllosphere	VKALVWFWIIDETLSANLVYQDDYEIGSTTPSDEAMAKIMTMVM
Ga0182125_10847741	3300015291	Miscanthus Phyllosphere	MKALVWFW*IDKTLSANLVYQSDYEIASTTPNNEAMVKIKMMV
Ga0182141_10175471	3300015292	Miscanthus Phyllosphere	MMKALVWFWGIYEILSANLVYQSDHEIGSTTPSEGNEDHDMTMVLPW*
Ga0182141_10217681	3300015292	Miscanthus Phyllosphere	VKALVWFWLIDETLSANLVYQSDYEIDSTTPSDEAIAKIMTMVMAW*
Ga0182141_10679252	3300015292	Miscanthus Phyllosphere	LKALVWFWLIDETLSANLVYLSDYEIGSTTPSDEAMMKIMTMMMA*
Ga0182141_10849781	3300015292	Miscanthus Phyllosphere	VKALVWFWLIDETLSANLVYQDDYEIGSTTPSDEAMTK
Ga0182126_10803202	3300015294	Miscanthus Phyllosphere	LKALVWFWLIDETLSANLVYQGDYEIGSTTPSDEAMTKIMTMVMAW*
Ga0182175_10349092	3300015295	Miscanthus Phyllosphere	LVWFCLINETLSANLVYQSDYKIGSTTPSNEAMVKIMMMMKAW*
Ga0182157_10318271	3300015296	Miscanthus Phyllosphere	MKALVSFWLIDETLSANLVYQSNYEIGSTTPSDEAMAKIMTMVMVW*
Ga0182157_10598651	3300015296	Miscanthus Phyllosphere	MDKPILGERRVKALVWFWLIDETLSANLVCQGDYEIGSTTPSDEAMMKIMTMVM
Ga0182157_10824382	3300015296	Miscanthus Phyllosphere	VWFWIIDEILSANLVYQSDHKIGSTTPSDEAMTMIMTMVMA*
Ga0182106_10648282	3300015298	Miscanthus Phyllosphere	VKALVWFWLIDETLSDNLVYQSDYEIGSTTPSDEAMVKIMMMVKAW*
Ga0182106_10738102	3300015298	Miscanthus Phyllosphere	LKALVWFWLIDETLSANLVYQSDYEIGSTTPSNEAMMKIMMMVMAW*
Ga0182106_11001631	3300015298	Miscanthus Phyllosphere	MAGSSSLKALVWFWLINETLSANLVYQDDYEIGSTTPSDEAMAKIMTMVM
Ga0182107_10241721	3300015299	Miscanthus Phyllosphere	LKALVCFWLIDETLSANLVYQSNYEIGSTTPSDEAMAKIMM
Ga0182107_10375951	3300015299	Miscanthus Phyllosphere	KALVWFWLIDETLSANLVYLSDYEIGSTTPRDEAMMKIMTMVMEC*
Ga0182108_10443031	3300015300	Miscanthus Phyllosphere	VLGILKALVWFWLIDETLSANLVYQDVYEIGSTTPSDEAMMKIMIMV
Ga0182108_10449901	3300015300	Miscanthus Phyllosphere	VKALVWFWLIDETLSANLVYQSNYEIGSTTPSDEAMAKIMTMVMAW*
Ga0182108_10485071	3300015300	Miscanthus Phyllosphere	LKALVWFWLIDETLSANLVYQSDYEIGSAIPSGEAIEDHDMMMVIPW*
Ga0182108_10632572	3300015300	Miscanthus Phyllosphere	MKALVWFWLIDKTLSANLVYQSDYETGSTTPSDEAMAKIMKMVMAW*
Ga0182108_10772931	3300015300	Miscanthus Phyllosphere	ETLSANLVYQSNYEIGSTTPSDEAMAKIMTMVMAW*
Ga0182108_10930131	3300015300	Miscanthus Phyllosphere	MKALVWFWLIDETLSANLVYQSDYEIGSTTPSDEAMVKIMMMVMAW*
Ga0182143_10401052	3300015302	Miscanthus Phyllosphere	VGRLKALVWFWLIDETLSANLVYRSDYEIGSTTPSDEAMAKIMTMVMAW*
Ga0182143_10965742	3300015302	Miscanthus Phyllosphere	VQVQFLYLKALVWFWLIDETLSANLVYQSNYEICSTTPSDEAMVKIMIMVM
Ga0182143_11028371	3300015302	Miscanthus Phyllosphere	VKALVWFWLIEETLSANLAYQSEYEKGSTTPSDAAMAKIMMMVMAW*
Ga0182143_11035592	3300015302	Miscanthus Phyllosphere	MARLCRVKALVWFWLIDETLSANLVYQSDYEISSTTPSDEARAKIMTMV
Ga0182123_10480992	3300015303	Miscanthus Phyllosphere	VKALVWFWLIDETLSANLVYQSDYEIGSTTPSDEARAKIMTMVMGW*
Ga0182123_10590531	3300015303	Miscanthus Phyllosphere	MECALKALVWFIDETLSANLVYQSDYEIGGTTPSDEEIMKIIMMVMPWS
Ga0182112_10048321	3300015304	Miscanthus Phyllosphere	MKALVWFLLIDETLSANLVYQSDYEIGSTTPSDEAMAKIMTMVM
Ga0182158_10343241	3300015305	Miscanthus Phyllosphere	MGLGRGSLKALVWFWLIDETLNANLVYQSDYEIGSTTPSDEAMAKIMTTVMAW*
Ga0182158_10387701	3300015305	Miscanthus Phyllosphere	MALVTDRTATLKALVWFWLIDETLSANLVYQSDHEIGSTIPSDEAMTKIMTMMMA
Ga0182158_10693331	3300015305	Miscanthus Phyllosphere	MVSLIESDQGVKALVLFWLIDETLCANLVYQSEYEIGSTTPSDEINEDHDMIMMMPW*
Ga0182158_10695661	3300015305	Miscanthus Phyllosphere	VKALVWFWLIDETLSANLVYQSDYQIGSTTPSDEAMAKIMMMVMAW*
Ga0182158_10818121	3300015305	Miscanthus Phyllosphere	LLERIEPLKALVCFWLIDETLSANLVYQSDYEIGSTTPSDEAMAKIMTTMMAW*
Ga0182158_10967781	3300015305	Miscanthus Phyllosphere	VKALVWFWLIDETLSANLVYQSDYEIGSTTPSDEAMTKIMT
Ga0182144_10386201	3300015307	Miscanthus Phyllosphere	MGKRLKALDWFWLIDETLSANLVYQDDFEIGSTTPSDEAMTKIMIMV
Ga0182142_10207651	3300015308	Miscanthus Phyllosphere	LKALIWFWLIDETLSANLVYQDDYEIGSTTPSDEAMAKIMTMVMA
Ga0182142_10267261	3300015308	Miscanthus Phyllosphere	LWCLKALVWFWLIDETLSANLVYQDDYEIGSTTPSDEAMTKIMTM
Ga0182142_10596132	3300015308	Miscanthus Phyllosphere	WLIDETLSANLVYQSDYEIGSTTPSDVAMAKIMTTVMAW*
Ga0182142_10663761	3300015308	Miscanthus Phyllosphere	VKALVWFWLIDETLSANLVYQSDYEIRSTTPSDEVMVKIMTMV
Ga0182140_10089562	3300015314	Miscanthus Phyllosphere	WLIDETLSANLIYQSDYEIGSTTPSDEEMAKIMTMVMAW*
Ga0182140_10951412	3300015314	Miscanthus Phyllosphere	VKALVWFWLIDETLSANLIYQSDYEIGSTTPSDEAMVKIMTMVMAW*
Ga0182140_11070732	3300015314	Miscanthus Phyllosphere	LKALVWFWLIDETLSANLVYQSFYEIGSTISSGEANEDHDMMMVIPW*
Ga0182127_10328241	3300015321	Miscanthus Phyllosphere	HQLLKRGRLKALVWFSLIDETLSANLVYQDDHEIGCTTPSDEAITKIVTMVMAW*
Ga0182127_10609961	3300015321	Miscanthus Phyllosphere	LKALDWFWLIDETLSANLVYQSDYEIGSTTLSDEAMAKIMTTVMAW*
Ga0182127_10822421	3300015321	Miscanthus Phyllosphere	LKALVWFWLIDKTLSANLVYLSDYEIGSTISSGEANEDHDMMMVIPW*
Ga0182127_10931201	3300015321	Miscanthus Phyllosphere	LIDETLTANLVYQDDYEIGSTTNDEAMAKIMTMVMAW*
Ga0182110_10543371	3300015322	Miscanthus Phyllosphere	VKALVWFWLIDETLSANLVYQSDYEIGSTTPSDEAMAKIMT
Ga0182110_10611232	3300015322	Miscanthus Phyllosphere	VKALVWFWLIDETLSANLLYHSDYEIGSTTPSDEAMVKIMTMVMAW*
Ga0182129_10998401	3300015323	Miscanthus Phyllosphere	MKALVWFWLIDETLSANLVYQSNYEIGSTTPSDEAMAKIM
Ga0182137_11245781	3300015338	Switchgrass Phyllosphere	LKALVWFWLIDETLSANLVYQDDYEIGSTTPSDEAMAKIMTTVMAW*
Ga0182187_10348561	3300015341	Miscanthus Phyllosphere	MAHLKALVWFWLIDETLSANLVDQDDYEIGSTTPSDEAMAKIMTMVMAW*
Ga0182187_10570173	3300015341	Miscanthus Phyllosphere	LKALVCFWLIDETLSANLVYQSDYEIGSTTPSNEAMVKIMVMVM
Ga0182187_10645983	3300015341	Miscanthus Phyllosphere	MSSASIHLKALVSFWLIDETLSANLVYQSDYEIGSTTPSDEAMAKI
Ga0182187_11122382	3300015341	Miscanthus Phyllosphere	VSSWRDAVLATLKALVWFWIIDETLSANLVYQDDYEIGSTTPSDEAMAKIMTMVMAW*
Ga0182109_10412651	3300015342	Miscanthus Phyllosphere	VKALVWFGLIDETLSANLVYQDDYEIGSTTPSDEAMTKIMTM
Ga0182109_10781541	3300015342	Miscanthus Phyllosphere	VKALVWFWLIDETLSANLVYQDDYEIGSTTPSDEAMTKIMTMVMSW*
Ga0182109_10824021	3300015342	Miscanthus Phyllosphere	LKALVWFWLIDETLSTNLVYQDDHEIDSTTPSDEAMMKIMTLVMIKC
Ga0182109_11010291	3300015342	Miscanthus Phyllosphere	VDPVAATLKTLVWFWLIDETLSANLVYQSDYEIGSTTPSKEAMTKIMTMVMAW*
Ga0182109_11077671	3300015342	Miscanthus Phyllosphere	VKTLVWFWLTDETLSANLVYQSDHEIGSTIPSNEAMTKIMTMVMAWL*L
Ga0182109_11201501	3300015342	Miscanthus Phyllosphere	LPKRERLKALVWFWLIDETLSANLVYQSDYEIGSTTPSDEEMAKIMTMVMAW*
Ga0182109_11696612	3300015342	Miscanthus Phyllosphere	MGRLKALVWFWLIDETLSANLVYQSDYKIGSTTPSDEAMVKIMMMVMAW*
Ga0182109_12166341	3300015342	Miscanthus Phyllosphere	VKALVWFWLIDETLSANLVYQSDYEIGSTTPSDEAMTKIM
Ga0182155_10040052	3300015343	Miscanthus Phyllosphere	MVKALVWFWLIDETLSANLVYQSDYEIGSTTPSDEAMAKIMT
Ga0182155_10346131	3300015343	Miscanthus Phyllosphere	MLKALVCFWLIDETLSANLVYQSDYEIGSTTPSDEAMAKIMTMVMAW*
Ga0182155_11356361	3300015343	Miscanthus Phyllosphere	MHSPLKPLVWFWLINKTLSANLVYQSDYEICSTTPSDEAMAKIM
Ga0182155_11488731	3300015343	Miscanthus Phyllosphere	LKALVWYWLIDETLSANLVYQSDYEIGSTTPSDEAMAKIMTMVMAW*
Ga0182155_11908012	3300015343	Miscanthus Phyllosphere	MLAVVKALVWFWLIDETQSANLVYQSDYEIGSTTPSDEAMAKIMTMVMAW*
Ga0182155_11931521	3300015343	Miscanthus Phyllosphere	VKALVWFWLIDETPSANLVYQSDYEIGSTTPSDEAMAKIMTMVMAW*
Ga0182155_11936381	3300015343	Miscanthus Phyllosphere	MWIPPPSPLKALVWFWLIDETISANLVYQSDYEIGSTTPSDEAMVKIMMMVMAW*
Ga0182155_11936472	3300015343	Miscanthus Phyllosphere	LKALVWFWLIDETLSANLVYQSDYEIGSTTPSDEAMAKII
Ga0182155_11967682	3300015343	Miscanthus Phyllosphere	MQIRHALLKALVWFWLIDETLSENLVYQSDYEIGSTTPSDEVMAKIMTMVIAW*
Ga0182155_12266291	3300015343	Miscanthus Phyllosphere	LKALVWFWLIDETLSANLVYQGVYEIGSTTPSDEAITKIMTMVMAW
Ga0182189_10169222	3300015344	Miscanthus Phyllosphere	LKALVWFWLIDETLSANLVYQSDYETGSTTPSDEAMAKIMKMVMAW*
Ga0182189_11468131	3300015344	Miscanthus Phyllosphere	MGRLKALVWFWLIDETLSVNLVYQSDYEIGSTTPSDEAMAKIMTMVMAW*
Ga0182189_11871482	3300015344	Miscanthus Phyllosphere	VTIGVKECRGGLVKTLVWFWLIDETLSANLVYQDDYEIGSTTPSDEAMIKIMTMV
Ga0182189_12178242	3300015344	Miscanthus Phyllosphere	MVSMKALVWFWLIDETLSANLVYQSDYEIGSTTPSDEAMV
Ga0182111_11193891	3300015345	Miscanthus Phyllosphere	MQVHRGDHVQALVWFWLIDETLSANLVYQSDHEIGSTIPSDEAMTKIITMVMVWL*
Ga0182111_11320661	3300015345	Miscanthus Phyllosphere	PGASRLPTSLKALVWFWLIDETLSANLVYQDDYEIGSTTPSDKAMTKIMTMVMAWL*
Ga0182111_11878231	3300015345	Miscanthus Phyllosphere	MKEWVTPSQVKALVWFWLIDETLSANLVYQGDYEIGSTTPSDEAITKIMTMVMAW*
Ga0182111_11936681	3300015345	Miscanthus Phyllosphere	MKALVWFWLIDETLSANVVYQSNYEIGSTTPSDKAMAKIMTMVMAW*
Ga0182111_12025182	3300015345	Miscanthus Phyllosphere	MMKALVWFWSIDETLSANLVSQSDYEIGSTTPSDEAMAKIMTTVMAW*
Ga0182111_12041092	3300015345	Miscanthus Phyllosphere	MKALVWFW*IDKTLSANLVYQSDYEIGSTTPSDETMAKIMT
Ga0182111_12428752	3300015345	Miscanthus Phyllosphere	VKALVWFWLIDETLSANLVYQSDYDIGSTTPSDEAMMKILMMVMAW*
Ga0182139_10919821	3300015346	Miscanthus Phyllosphere	KALVWFWLIDETLSINLVYQSDYEIGSTTPSDAKIMMMVMAW*
Ga0182139_10927502	3300015346	Miscanthus Phyllosphere	LSDNLKALVCFWLIDETLSANLVYQSDYEIGSTTPSDEAMAKILTMVMAL*
Ga0182139_11601302	3300015346	Miscanthus Phyllosphere	VATVKALVWFWLIDETLSANLVCQGDYEKGSTTPSDEAMTKIMTMVMAWR*
Ga0182139_12180422	3300015346	Miscanthus Phyllosphere	LKALVWFWRIDETLSANLVYQSDYEIGGTTPSDEEIVKIMMMVMPW*
Ga0182177_10466651	3300015347	Miscanthus Phyllosphere	MWIPPPSPLKALVWFWLIDETISANLVYQSDYEIGSTTPSDEAMAKIMTMVMAW*
Ga0182177_10533552	3300015347	Miscanthus Phyllosphere	VEFASVGRLKALVWFWLIDETLSANLVYQDDYEIGSTTPSDEAMTKIMT
Ga0182177_11679901	3300015347	Miscanthus Phyllosphere	VKALVWFWLIDETLSANLVYQDDYEIGSTTPSDEAMVKIMT
Ga0182177_11916481	3300015347	Miscanthus Phyllosphere	MPQHRQRLSHLKALVWLIDETLSVNLVYQSDYEIDSTTLSDEAMVNIMTMVMAW*
Ga0182161_10557281	3300015351	Miscanthus Phyllosphere	MMKALVWFWLIDETLSANLVYQSDYEIGSTTPSDEAMAKIM
Ga0182161_11121301	3300015351	Miscanthus Phyllosphere	MLKALVCFWLIDETLSANLVYQSDYEIGSTTPSNEAMAKIM
Ga0182161_11212662	3300015351	Miscanthus Phyllosphere	VVLARSACARLLPCLVGLVKALVWFWLIDETLSANLVYQSDYEIGSTTSSDEAMAKIMT*
Ga0182161_11262321	3300015351	Miscanthus Phyllosphere	VKALVWFWLTDETLSANLVYQGDHEIGSTTPNDEAMAKIMTMMMAW*
Ga0182161_11644511	3300015351	Miscanthus Phyllosphere	VKALVWFWLIDETLSANLVYQSNYEIGSTTPSDEAMTKI
Ga0182161_11766952	3300015351	Miscanthus Phyllosphere	MKALVWFWLIDETLSANLVYQNDYEIGSTTPSDEAMTKIMTMVMAW*
Ga0182161_11821222	3300015351	Miscanthus Phyllosphere	VCTLTTPQLKALVWFWLIDETLSANLVYQSDYEIGSTTPSDEAMAKIM
Ga0182161_12106341	3300015351	Miscanthus Phyllosphere	MAIHTHVKALV*FWLIDETLSANLVYQSDCEIGSTTLSDEAMTKIMTMVMAW
Ga0182161_12310911	3300015351	Miscanthus Phyllosphere	VKALVWFWLIDETLSANLVYQSDYEIGSTTPSDEAMAKI
Ga0182159_10643441	3300015355	Miscanthus Phyllosphere	MKALVWFC*IDEPLSANLVYQSDHEICSTIPSDGAMVKI
Ga0182159_11345271	3300015355	Miscanthus Phyllosphere	ETLSANLVYQSDYEIGSTTPSDEAMVKIMIMVMAW*
Ga0182159_11524311	3300015355	Miscanthus Phyllosphere	MKALVWFWLIDETLSENLVYQSDYEIGSTTPSDEVMAKIMTMVIAW*
Ga0182159_11669321	3300015355	Miscanthus Phyllosphere	MKALVWFWLIDETLSANLVYQDDYEIGSTTLSDEAMTKIMTMVIAW*
Ga0182159_11910241	3300015355	Miscanthus Phyllosphere	LLKALVWFWLIDETLSANLVYQGNHEIGSTTPSDEAKVKIMTMVMAW*
Ga0182159_11956172	3300015355	Miscanthus Phyllosphere	LVESSLLKALVWFWLIDETLSAHLVYQGDYEIGSTTPSDEAMTKIMTMMMAW*
Ga0182159_12097672	3300015355	Miscanthus Phyllosphere	VKALVWFWLIDETLSANLVYQDDHEIGSTTPSDEAMKKIMTMVMAW*
Ga0182159_12527251	3300015355	Miscanthus Phyllosphere	ETLSANLVYQSDYEIGSTTPSNEAIVKIVMMVMAW*
Ga0182159_12744992	3300015355	Miscanthus Phyllosphere	MGLGRGSLKALVWFWLIDETLNANLVYQSDYEIGSTTPSDEAIAKIMTMVMAW*
Ga0182159_13305782	3300015355	Miscanthus Phyllosphere	VKALVWFWLIDETLSANLVYQGDYEIGSTTPSDEAMAKIMTMMMAWR*
Ga0182159_13484281	3300015355	Miscanthus Phyllosphere	WFWLIDETLSANLVYQSDYEIGSTTPSDEAMLKIMMMVMAW*
Ga0182145_10775931	3300015361	Miscanthus Phyllosphere	VVSNVAATHWVKALVWFWLIDETLSANLVYQDDYKIGSTTPSDEAMAKIM
Ga0182145_11480032	3300015361	Miscanthus Phyllosphere	LKVLVWFWLIDETLSANLVYQDDYEIGGTTPSDEAMANIMMTVMAWR*
Ga0182145_11505131	3300015361	Miscanthus Phyllosphere	LKALVWFWLIDETLSANLVYQDDYEIGSTTPSDEAMAKI
Ga0182145_11611641	3300015361	Miscanthus Phyllosphere	LIDETLSANLVYQDDYEIGSTTPSDEAMAKIMTMMMAW*
Ga0182145_11734382	3300015361	Miscanthus Phyllosphere	MSGRLKALVWFWLIDETLSANLVYQDDYEIGSTTPSDDAMEKIMTMVMAW*
Ga0182145_11787931	3300015361	Miscanthus Phyllosphere	VKALVWFWLIDETLSANLVYQGDYEIGSTTPSDEAITK
Ga0182203_11513301	3300017404	Miscanthus Phyllosphere	RGRLKALVWFWLIDETLSANLVYQSDHEIGSTTPSNEAMTKIMTMVMAW
Ga0182203_11533661	3300017404	Miscanthus Phyllosphere	MVLPTVGRVKALVWFWLIDETLSANLVYQSDYEIGSTTRSDEVMAKIMTMVMAW
Ga0182220_10165521	3300017407	Miscanthus Phyllosphere	VKALVWLWLIDETLSANLVYQDDHEIGSTTPSDEAM
Ga0182220_10297081	3300017407	Miscanthus Phyllosphere	MKALVWFWLIDETLSANLVYQSDYEIGSTTPSDEEMAKIMTVVMAW
Ga0182220_10561182	3300017407	Miscanthus Phyllosphere	VKALVWFWLIDETLSANLVYQDDYEIGSTTPSDEAMMKIMTMVMAWL
Ga0182220_10678441	3300017407	Miscanthus Phyllosphere	LKALVWFWLIDEILSANLVYQDDYEIGSTTPSDEAMAKIMTM
Ga0182220_10747902	3300017407	Miscanthus Phyllosphere	VLLDTVKALVWFWLIDKILSANLVYQDGYEIGSTTTSDEVMSKIM
Ga0182204_10338162	3300017409	Miscanthus Phyllosphere	MLKALVWFWXIDETLSANLVYQSDYEIGSTTLGDEAMVKIMM
Ga0182204_10724911	3300017409	Miscanthus Phyllosphere	VKALVWFWLIDETLSANLVYQSDYEIGSTTPSDEAMAKIMTM
Ga0182204_10749491	3300017409	Miscanthus Phyllosphere	MRFFLGGLKALVWFWLIDETLSANLVYQSDYEIGSTTPSAKAIAKILTMVM
Ga0182207_10167633	3300017410	Miscanthus Phyllosphere	VISSPMALLKALVWFWLIDETLSANLVYQDDYEIGSTTPSDEAMAKIMT
Ga0182207_11079131	3300017410	Miscanthus Phyllosphere	MKALVWFWLIDETLSANLVYQSDYEIGSTTPSDEAMVKIMM
Ga0182208_10281771	3300017411	Miscanthus Phyllosphere	MVKALVWFWLIDETLSANLVYQDDHEIGSTTPSDEAMTKIMTW
Ga0182208_10738461	3300017411	Miscanthus Phyllosphere	MVPRVVSRSGLELKALVWFWLIDETLSANLVDQDDYEIDSTTPSDEAKMKIMTMVMAW
Ga0182208_11114601	3300017411	Miscanthus Phyllosphere	RGRLKALVWFWLIDETLSANLVYQSDYEIGSTTPSDEAMVKIMMMVMAW
Ga0182208_11224452	3300017411	Miscanthus Phyllosphere	VGKTNGVKALVWFWLIDETLSANLVYQSDYEIGSTTPSDEAMAKIMTM
Ga0182222_10088152	3300017413	Miscanthus Phyllosphere	MKALVWFWLIDETLSANLVCQSDYEIGSTTPNDEAMAKIMTMVMA
Ga0182202_10016512	3300017415	Miscanthus Phyllosphere	VKALVWFWLIDETLSANLLYHSDYEIGSTTPSDEAMVKIMTMVMAW
Ga0182202_10481542	3300017415	Miscanthus Phyllosphere	LKALVWFWLIDKTLSANLVYQSDYEIGSTTPSDEAMAKIM
Ga0182202_10949231	3300017415	Miscanthus Phyllosphere	VKALFWFWLIDETLSANLVYQDDYEIGSTTPSDEAMTKIMTM
Ga0182202_11326721	3300017415	Miscanthus Phyllosphere	VRHACWSVNALVXFCXIDETLSANLVYQSDHEIGSTIPSVEQMVKIMMMV
Ga0182228_10758392	3300017420	Miscanthus Phyllosphere	MKALVWFWLIDEPLSANLVYQSDYEIGSTTPSDKAMAKIMTMVMAW
Ga0182228_10818502	3300017420	Miscanthus Phyllosphere	MKALVWFWLIDETYSANLVYQSDYEIGSTTPSDEAMVKIMMMVMAWXXS
Ga0182219_11331001	3300017424	Miscanthus Phyllosphere	VPVKALVWFWLIDETLSANLVYQSDYEIGSTIPSDEANEDRDMMMVIPW
Ga0182224_10291822	3300017425	Miscanthus Phyllosphere	VEFASVGRLKALVWFWLIDETLSANLVYQDDYEIGSTTPSDEAMTKI
Ga0182224_10857722	3300017425	Miscanthus Phyllosphere	MLKALVWFWLIDETLSANLVFQDDYEIGSTTPSDEAMAKIMTMVMAW
Ga0182224_10857941	3300017425	Miscanthus Phyllosphere	MNLLKALVWFWLIDETLSANLVYQTDYEIGSTAPSDEAMAKIMTMVMAW
Ga0182192_10143991	3300017430	Miscanthus Phyllosphere	MCELRSARVKALAWFWLIDETLSANLVYQSDYEIGSTTPSDEALAKIMTMVMA
Ga0182192_10600092	3300017430	Miscanthus Phyllosphere	LKALVWFWLIDETLSANLVYQGDYEIGSTTTSDEAMMKIMTMVMAW
Ga0182192_10791862	3300017430	Miscanthus Phyllosphere	LKALVWFWLIDETLSANLVYQSDYEIGGTTPSDEAMVKIMTMVMAW
Ga0182192_11247741	3300017430	Miscanthus Phyllosphere	LNLSYLRTWGCLTNMKALVWFWLIDETLSANLVYQSDYEIGSTNPSDEAMAKIMTMVMA
Ga0182192_11353571	3300017430	Miscanthus Phyllosphere	VKALVWFWLSDETLSANLVYQSDYEIGSTTPSDEAMAKIMTMVMA
Ga0182209_10618262	3300017436	Miscanthus Phyllosphere	MQVKALVWFWLIDETLSANLVYQSDYEIGSTTPSDEAMVKIMMMVMAW
Ga0182209_10627861	3300017436	Miscanthus Phyllosphere	MKALVWFWLIDATLSANLVYQSDYEIGSTTPSDEAMAKIM
Ga0182209_11215431	3300017436	Miscanthus Phyllosphere	VKALVWLWLIDETLSANLVYQSDYEIGSTTPSNEAMVKIMVMVMAC
Ga0182209_11689331	3300017436	Miscanthus Phyllosphere	LKALVWFWLIDETLSANLVYQDDYEIGSTTPSDEAMAKIMTMVMAW
Ga0182191_10077731	3300017438	Miscanthus Phyllosphere	VGLKALVWFWLIDETLSINLVYQSDYEIGSTTPSDEAMAKIMTMVMVW
Ga0182191_10204131	3300017438	Miscanthus Phyllosphere	VKALVWFWLIDETLSVNLVYQSDHEIGSTIPSDEAMTKIMTSVMAWL
Ga0182191_11214161	3300017438	Miscanthus Phyllosphere	MDMLKALVWFWLIDETLSANLVYQSDYEIGSTTPSDEAMAKIMTMV
Ga0182191_11531122	3300017438	Miscanthus Phyllosphere	VKSLVWFWLIDETLSANLVYQSDYEIGSTTPSDEAMTKIMTMV
Ga0182191_11621771	3300017438	Miscanthus Phyllosphere	VKALVWFWLIDETLSANLVYQDDYEIGSTTPSDAAMVKI
Ga0182191_11818042	3300017438	Miscanthus Phyllosphere	VKALVWFWLIDETLSANLVYQSDYKIGSTTPSDKAMAKIMTMVIAW
Ga0182221_11629181	3300017442	Miscanthus Phyllosphere	VTGHVRLKALVWFWLIDETLSANLVYQSDYEIGSTTPSNEAMVKIMMMVKAW
Ga0182221_11639251	3300017442	Miscanthus Phyllosphere	VEALVLFWLIDETLSANLVYQGDYEIGSTTPSDEAITKIMTMVMAW
Ga0182221_11691902	3300017442	Miscanthus Phyllosphere	MLKALVWFWLIDETLSTNLVYQSDYEIGSTTSSDEAKTKIITMVMAWXXSNAQTW
Ga0182193_10151152	3300017443	Miscanthus Phyllosphere	MMLKALVWFWLIDETLSANLVYQSDYEIGSTTPSDEAMTKIMT
Ga0182193_10490891	3300017443	Miscanthus Phyllosphere	LKALVWFWLIDETLSANLVYQSDLEIGSTTPRDEAMMKIMTMVMAW
Ga0182193_10974111	3300017443	Miscanthus Phyllosphere	VEALVLFWLIDETLSANLVYQGDYEIGSTTPSDEAITKIMTMVM
Ga0182193_11123371	3300017443	Miscanthus Phyllosphere	VRLKALVWFWLIDETLSANLVYQDDYEIGSTTPSNEAMVKIMMMVKAW
Ga0182233_10764531	3300017680	Miscanthus Phyllosphere	MVKALIWFWLIDETLSANLVYQSDYEIGSTTPSDEAMAKIMTMVMAW
Ga0182218_10752972	3300017683	Miscanthus Phyllosphere	MLKALVWFWLIDETLSANLVYQSDYEISSTTPSDEAMAKIMTMVMAW
Ga0182218_11394071	3300017683	Miscanthus Phyllosphere	MLKALVWFWLIDETLSANLVYQSNYEIGSTTPSDEAMAKIMTMVMAW
Ga0182225_10254181	3300017684	Miscanthus Phyllosphere	VLVWFWLIDEILSVNLVYQNDYEIGNTISSGEANEDRNMMMVI
Ga0182225_10276841	3300017684	Miscanthus Phyllosphere	VKALVWFWLIDETLSANLVYQSEYEIGSTTPSDEAMTKIMTMVMAW
Ga0182225_10909721	3300017684	Miscanthus Phyllosphere	EGEAAQVKALVWFWXIDETLSANLVYQSDLXDRWHIPSGEANEDNDMMMMMPW
Ga0182225_10989301	3300017684	Miscanthus Phyllosphere	MYGALKALVWFWLIDESLSANLVYQSNYEIGGTTPSGEANEDHDMMMVIPW
Ga0182225_11122261	3300017684	Miscanthus Phyllosphere	MKALVWFWLIDETLSANLVYQSDYEIGSTTPSDEAMVKIMMMV
Ga0182227_10689522	3300017685	Miscanthus Phyllosphere	MSVFNALKALVWFWLIDETLSANLVYQDDYEIGSTTPSDEVMLKTMTMVMAW
Ga0182227_10903291	3300017685	Miscanthus Phyllosphere	LFGTLDSTRYTVKALVWFWLIDETLSANLVYQSDYEISSTTPSDEAMAKIMTMVMA
Ga0182227_10993412	3300017685	Miscanthus Phyllosphere	MLGQSSPPRLGQVKALVWFWLIDETLSANLVYQSEYEIGSTTLSDEAMAKIMTMAMAW
Ga0182227_11073251	3300017685	Miscanthus Phyllosphere	GLKGLVWFWLIDETLSANLVYQSDYEIGSTTPSDEEMAKIMTMVMAW
Ga0182205_10188631	3300017686	Miscanthus Phyllosphere	VKALVWFWLIDETLSANLVYLSDYEIGSTTPRDEAMLKIMTMVKEC
Ga0182205_10458482	3300017686	Miscanthus Phyllosphere	GRLKALVWFWLIDETLSANLVYQSDYEIGSTTPSDEAMVKIMMMVMAW
Ga0182205_10530621	3300017686	Miscanthus Phyllosphere	VKALVWFWLIDETLSANLVYQDEYEIASTTPSDEAMTKIMTMVIAW
Ga0182205_10787001	3300017686	Miscanthus Phyllosphere	LLRVLEVIVKALVWFWLVNETLSANLVYQSDYEIGSTISSGETNEDHDMMM
Ga0182205_10829752	3300017686	Miscanthus Phyllosphere	MKALVWFWLIDETLSTNLVYQSNYEIGSTPPSDEAMAKIMTMVMAW
Ga0182205_11579652	3300017686	Miscanthus Phyllosphere	LDSPLAKNLAPIVKALVLFWLIDETPSANLVYQSDYEIGSTTPSDEAMVKIMTMVMAW
Ga0182231_10658982	3300017689	Miscanthus Phyllosphere	VKALVWFWLIDETLSANLFYQSNYEIGSTTPSDEAMAKIMMMVMAWXXSNAXTW
Ga0182231_10660151	3300017689	Miscanthus Phyllosphere	VATLKSLVWFWLIDETLSANLVYQSDYEIGSTTPSDEAMTKIMTMVIAW
Ga0182223_10867951	3300017690	Miscanthus Phyllosphere	VKALVWFWLIDETLSANLVYQDNYEIGSTTPSDEAMTKIMTMVIAW
Ga0182223_11007682	3300017690	Miscanthus Phyllosphere	MSILGLRCPSLKALVWFCLINETLSANLVYQSDYKIGSTTPSNEAMVKIMMM
Ga0182223_11074363	3300017690	Miscanthus Phyllosphere	VKALVWFWLIDETLSANLVYQSDYEIGSTTPSDEAMTKIMTMVMAW
Ga0207659_118694851	3300025926	Miscanthus Rhizosphere	YGQLKALVWFWLIDETLSANLVYQDDYEIGSTTPSDEAMTKIMTMVIAW
Ga0207709_111791172	3300025935	Miscanthus Rhizosphere	LPKRGRLKALVWFWLIDETLSANLVYQDDYEIGSTTPSDEAMTKIMIMVIAW
Ga0207689_103633931	3300025942	Miscanthus Rhizosphere	VKALVWFWLIDETLSTNLVYQDDYEIGSTTPSDEAMTKIMTM
Ga0207677_116878311	3300026023	Miscanthus Rhizosphere	LFSCLGFLKALVWFWLIDETLSANLVYQDDYEIGSTTPSDEAMTKIMTMVIAW
Ga0207648_108023481	3300026089	Miscanthus Rhizosphere	MLVKALVWVWLIDETLSANLVYQSDYEIDSTTPSDEAMAKIIT

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.40
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.40
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome Family F016636

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300005290	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1	Host-Associated	Open in IMG/M
3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Host-Associated	Open in IMG/M
3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Host-Associated	Open in IMG/M
3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Host-Associated	Open in IMG/M
3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Host-Associated	Open in IMG/M
3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Host-Associated	Open in IMG/M
3300005840	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2	Host-Associated	Open in IMG/M
3300009036	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG	Host-Associated	Open in IMG/M
3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Host-Associated	Open in IMG/M
3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Host-Associated	Open in IMG/M
3300015267	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015268	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015269	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015275	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015276	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015277	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015279	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015282	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015283	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015285	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015286	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015287	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015288	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015289	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015291	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015292	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015294	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015295	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015296	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015298	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015299	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015300	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015302	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015303	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015304	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015305	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015307	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015308	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015314	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015321	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015322	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015323	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015338	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015341	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015342	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015343	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015344	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015345	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015346	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015347	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015351	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015355	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015361	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300017404	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017407	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017409	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017410	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017411	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017413	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017415	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017420	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017424	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017425	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017430	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017436	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017438	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017442	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017443	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017680	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017683	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017684	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017685	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017686	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017689	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017690	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)	Host-Associated	Open in IMG/M

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign