| Basic Information | |
|---|---|
| Family ID | F016615 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 246 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MNPNLKWKALFILAVILFCIYFLFGYPVFPTSLAQVKDNFSK |
| Number of Associated Samples | 196 |
| Number of Associated Scaffolds | 246 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 8.13 % |
| % of genes near scaffold ends (potentially truncated) | 98.78 % |
| % of genes from short scaffolds (< 2000 bps) | 89.02 % |
| Associated GOLD sequencing projects | 183 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.42 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (100.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (21.545 % of family members) |
| Environment Ontology (ENVO) | Unclassified (29.268 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (54.472 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 44.29% β-sheet: 0.00% Coil/Unstructured: 55.71% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.42 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 246 Family Scaffolds |
|---|---|---|
| PF02699 | YajC | 76.02 |
| PF01702 | TGT | 15.85 |
| PF04893 | Yip1 | 2.03 |
| PF00005 | ABC_tran | 1.63 |
| PF00933 | Glyco_hydro_3 | 0.41 |
| PF03681 | Obsolete Pfam Family | 0.41 |
| PF05977 | MFS_3 | 0.41 |
| PF08352 | oligo_HPY | 0.41 |
| PF01713 | Smr | 0.41 |
| PF16576 | HlyD_D23 | 0.41 |
| PF11870 | LutB_C | 0.41 |
| COG ID | Name | Functional Category | % Frequency in 246 Family Scaffolds |
|---|---|---|---|
| COG1862 | Protein translocase subunit YajC | Intracellular trafficking, secretion, and vesicular transport [U] | 76.02 |
| COG0343 | Queuine/archaeosine tRNA-ribosyltransferase | Translation, ribosomal structure and biogenesis [J] | 15.85 |
| COG1549 | Archaeosine tRNA-ribosyltransferase, contains uracil-DNA-glycosylase and PUA domains | Translation, ribosomal structure and biogenesis [J] | 15.85 |
| COG1472 | Periplasmic beta-glucosidase and related glycosidases | Carbohydrate transport and metabolism [G] | 0.41 |
| COG2814 | Predicted arabinose efflux permease AraJ, MFS family | Carbohydrate transport and metabolism [G] | 0.41 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 100.00 % |
| Unclassified | root | N/A | 0.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001545|JGI12630J15595_10084559 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 623 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101088620 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 686 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101277686 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 625 | Open in IMG/M |
| 3300002909|JGI25388J43891_1000067 | All Organisms → cellular organisms → Bacteria | 17923 | Open in IMG/M |
| 3300002911|JGI25390J43892_10046245 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1034 | Open in IMG/M |
| 3300002914|JGI25617J43924_10087817 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1122 | Open in IMG/M |
| 3300004080|Ga0062385_10554655 | All Organisms → cellular organisms → Bacteria | 719 | Open in IMG/M |
| 3300004092|Ga0062389_101853989 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 782 | Open in IMG/M |
| 3300004136|Ga0058889_1407017 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 694 | Open in IMG/M |
| 3300004139|Ga0058897_10000214 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 748 | Open in IMG/M |
| 3300004152|Ga0062386_100424817 | All Organisms → cellular organisms → Bacteria | 1073 | Open in IMG/M |
| 3300004267|Ga0066396_10114956 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 511 | Open in IMG/M |
| 3300005167|Ga0066672_10369298 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 938 | Open in IMG/M |
| 3300005171|Ga0066677_10244461 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1017 | Open in IMG/M |
| 3300005187|Ga0066675_10204303 | All Organisms → cellular organisms → Bacteria | 1390 | Open in IMG/M |
| 3300005332|Ga0066388_100100545 | All Organisms → cellular organisms → Bacteria | 3354 | Open in IMG/M |
| 3300005332|Ga0066388_107281263 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 556 | Open in IMG/M |
| 3300005445|Ga0070708_100167238 | All Organisms → cellular organisms → Bacteria | 2051 | Open in IMG/M |
| 3300005467|Ga0070706_101308278 | All Organisms → cellular organisms → Bacteria | 665 | Open in IMG/M |
| 3300005526|Ga0073909_10213645 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 840 | Open in IMG/M |
| 3300005526|Ga0073909_10255654 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 780 | Open in IMG/M |
| 3300005526|Ga0073909_10593826 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 546 | Open in IMG/M |
| 3300005538|Ga0070731_10718147 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 664 | Open in IMG/M |
| 3300005545|Ga0070695_100424634 | All Organisms → cellular organisms → Bacteria | 1013 | Open in IMG/M |
| 3300005545|Ga0070695_100650539 | All Organisms → cellular organisms → Bacteria | 832 | Open in IMG/M |
| 3300005555|Ga0066692_10435739 | All Organisms → cellular organisms → Bacteria | 834 | Open in IMG/M |
| 3300005560|Ga0066670_10060439 | All Organisms → cellular organisms → Bacteria | 2001 | Open in IMG/M |
| 3300005568|Ga0066703_10596238 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 644 | Open in IMG/M |
| 3300005712|Ga0070764_11051185 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 515 | Open in IMG/M |
| 3300005952|Ga0080026_10177117 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 625 | Open in IMG/M |
| 3300006041|Ga0075023_100343112 | All Organisms → cellular organisms → Bacteria | 629 | Open in IMG/M |
| 3300006059|Ga0075017_101309465 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 569 | Open in IMG/M |
| 3300006163|Ga0070715_10107958 | All Organisms → cellular organisms → Bacteria | 1309 | Open in IMG/M |
| 3300006176|Ga0070765_102050470 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 535 | Open in IMG/M |
| 3300006755|Ga0079222_10563442 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 857 | Open in IMG/M |
| 3300006797|Ga0066659_11533431 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 558 | Open in IMG/M |
| 3300006806|Ga0079220_10335004 | All Organisms → cellular organisms → Bacteria | 954 | Open in IMG/M |
| 3300006903|Ga0075426_10952448 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 648 | Open in IMG/M |
| 3300006904|Ga0075424_101686646 | All Organisms → cellular organisms → Bacteria | 671 | Open in IMG/M |
| 3300007788|Ga0099795_10052030 | All Organisms → cellular organisms → Bacteria | 1494 | Open in IMG/M |
| 3300009038|Ga0099829_11118425 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 653 | Open in IMG/M |
| 3300009088|Ga0099830_10200888 | All Organisms → cellular organisms → Bacteria | 1560 | Open in IMG/M |
| 3300009088|Ga0099830_10598425 | All Organisms → cellular organisms → Bacteria | 904 | Open in IMG/M |
| 3300009088|Ga0099830_11637658 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 537 | Open in IMG/M |
| 3300009089|Ga0099828_10708535 | All Organisms → cellular organisms → Bacteria | 904 | Open in IMG/M |
| 3300009090|Ga0099827_10080261 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2544 | Open in IMG/M |
| 3300009090|Ga0099827_10439381 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1118 | Open in IMG/M |
| 3300009090|Ga0099827_10958252 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 742 | Open in IMG/M |
| 3300009137|Ga0066709_104058955 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 532 | Open in IMG/M |
| 3300009148|Ga0105243_10514001 | All Organisms → cellular organisms → Bacteria | 1137 | Open in IMG/M |
| 3300009522|Ga0116218_1399074 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 614 | Open in IMG/M |
| 3300009523|Ga0116221_1347819 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 643 | Open in IMG/M |
| 3300009524|Ga0116225_1296234 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 722 | Open in IMG/M |
| 3300009525|Ga0116220_10149186 | All Organisms → cellular organisms → Bacteria | 1003 | Open in IMG/M |
| 3300009525|Ga0116220_10299150 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 708 | Open in IMG/M |
| 3300009700|Ga0116217_10535974 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 733 | Open in IMG/M |
| 3300009824|Ga0116219_10021901 | All Organisms → cellular organisms → Bacteria | 3929 | Open in IMG/M |
| 3300010043|Ga0126380_11181227 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 658 | Open in IMG/M |
| 3300010047|Ga0126382_10951951 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 748 | Open in IMG/M |
| 3300010048|Ga0126373_10322851 | All Organisms → cellular organisms → Bacteria | 1547 | Open in IMG/M |
| 3300010304|Ga0134088_10387330 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 681 | Open in IMG/M |
| 3300010339|Ga0074046_10198955 | All Organisms → cellular organisms → Bacteria | 1260 | Open in IMG/M |
| 3300010343|Ga0074044_10790081 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 620 | Open in IMG/M |
| 3300010359|Ga0126376_10530296 | All Organisms → cellular organisms → Bacteria | 1097 | Open in IMG/M |
| 3300010360|Ga0126372_10119947 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2030 | Open in IMG/M |
| 3300010360|Ga0126372_11397361 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 732 | Open in IMG/M |
| 3300010360|Ga0126372_12695101 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 549 | Open in IMG/M |
| 3300010361|Ga0126378_13022880 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 536 | Open in IMG/M |
| 3300010361|Ga0126378_13082259 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 531 | Open in IMG/M |
| 3300010362|Ga0126377_12586855 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 583 | Open in IMG/M |
| 3300010362|Ga0126377_12690628 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 572 | Open in IMG/M |
| 3300010376|Ga0126381_100001217 | All Organisms → cellular organisms → Bacteria | 27865 | Open in IMG/M |
| 3300010376|Ga0126381_101105798 | All Organisms → cellular organisms → Bacteria | 1145 | Open in IMG/M |
| 3300010376|Ga0126381_101849423 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 871 | Open in IMG/M |
| 3300010376|Ga0126381_104127450 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 564 | Open in IMG/M |
| 3300010398|Ga0126383_11121279 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 876 | Open in IMG/M |
| 3300010861|Ga0126349_1153640 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 526 | Open in IMG/M |
| 3300011120|Ga0150983_11172848 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 853 | Open in IMG/M |
| 3300011120|Ga0150983_12575357 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 777 | Open in IMG/M |
| 3300011269|Ga0137392_10026527 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 4147 | Open in IMG/M |
| 3300011269|Ga0137392_10759544 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 802 | Open in IMG/M |
| 3300012004|Ga0120134_1012803 | All Organisms → cellular organisms → Bacteria | 1292 | Open in IMG/M |
| 3300012199|Ga0137383_10500414 | All Organisms → cellular organisms → Bacteria | 890 | Open in IMG/M |
| 3300012200|Ga0137382_10455246 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 906 | Open in IMG/M |
| 3300012202|Ga0137363_10008517 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 6475 | Open in IMG/M |
| 3300012202|Ga0137363_10474982 | All Organisms → cellular organisms → Bacteria | 1048 | Open in IMG/M |
| 3300012205|Ga0137362_10128520 | All Organisms → cellular organisms → Bacteria | 2154 | Open in IMG/M |
| 3300012209|Ga0137379_10657565 | All Organisms → cellular organisms → Bacteria | 954 | Open in IMG/M |
| 3300012210|Ga0137378_11262966 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 655 | Open in IMG/M |
| 3300012211|Ga0137377_11633539 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 568 | Open in IMG/M |
| 3300012359|Ga0137385_10667194 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 870 | Open in IMG/M |
| 3300012361|Ga0137360_11142608 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 673 | Open in IMG/M |
| 3300012361|Ga0137360_11770812 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 523 | Open in IMG/M |
| 3300012363|Ga0137390_10306421 | All Organisms → cellular organisms → Bacteria | 1570 | Open in IMG/M |
| 3300012363|Ga0137390_10611554 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1057 | Open in IMG/M |
| 3300012382|Ga0134038_1082071 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 753 | Open in IMG/M |
| 3300012582|Ga0137358_10147626 | All Organisms → cellular organisms → Bacteria | 1601 | Open in IMG/M |
| 3300012917|Ga0137395_10927672 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 628 | Open in IMG/M |
| 3300012917|Ga0137395_11283366 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 507 | Open in IMG/M |
| 3300012918|Ga0137396_10235684 | All Organisms → cellular organisms → Bacteria | 1349 | Open in IMG/M |
| 3300012923|Ga0137359_10963107 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 733 | Open in IMG/M |
| 3300012924|Ga0137413_10016515 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 3779 | Open in IMG/M |
| 3300012924|Ga0137413_10909913 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 684 | Open in IMG/M |
| 3300012925|Ga0137419_10998919 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 693 | Open in IMG/M |
| 3300012925|Ga0137419_11576978 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 558 | Open in IMG/M |
| 3300012929|Ga0137404_10596628 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 993 | Open in IMG/M |
| 3300012929|Ga0137404_11555299 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 613 | Open in IMG/M |
| 3300012930|Ga0137407_10450150 | All Organisms → cellular organisms → Bacteria | 1198 | Open in IMG/M |
| 3300012944|Ga0137410_10885227 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 754 | Open in IMG/M |
| 3300012948|Ga0126375_11711915 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
| 3300012961|Ga0164302_10896561 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 680 | Open in IMG/M |
| 3300012971|Ga0126369_13419740 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 520 | Open in IMG/M |
| 3300012984|Ga0164309_11426110 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 591 | Open in IMG/M |
| 3300014157|Ga0134078_10593100 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 529 | Open in IMG/M |
| 3300014201|Ga0181537_10030955 | All Organisms → cellular organisms → Bacteria | 3691 | Open in IMG/M |
| 3300014201|Ga0181537_10071668 | All Organisms → cellular organisms → Bacteria | 2351 | Open in IMG/M |
| 3300014657|Ga0181522_10115780 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1555 | Open in IMG/M |
| 3300015052|Ga0137411_1199120 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 841 | Open in IMG/M |
| 3300015054|Ga0137420_1036426 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 880 | Open in IMG/M |
| 3300015054|Ga0137420_1123222 | All Organisms → cellular organisms → Bacteria | 985 | Open in IMG/M |
| 3300015054|Ga0137420_1350230 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 802 | Open in IMG/M |
| 3300015241|Ga0137418_10684129 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 790 | Open in IMG/M |
| 3300015264|Ga0137403_10015781 | All Organisms → cellular organisms → Bacteria | 8184 | Open in IMG/M |
| 3300015264|Ga0137403_11592516 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 506 | Open in IMG/M |
| 3300016357|Ga0182032_10463103 | All Organisms → cellular organisms → Bacteria | 1036 | Open in IMG/M |
| 3300016371|Ga0182034_11320702 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 629 | Open in IMG/M |
| 3300016422|Ga0182039_10513894 | All Organisms → cellular organisms → Bacteria | 1036 | Open in IMG/M |
| 3300016702|Ga0181511_1005747 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 608 | Open in IMG/M |
| 3300016702|Ga0181511_1496298 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 700 | Open in IMG/M |
| 3300017822|Ga0187802_10150020 | All Organisms → cellular organisms → Bacteria | 890 | Open in IMG/M |
| 3300017933|Ga0187801_10066494 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1329 | Open in IMG/M |
| 3300017933|Ga0187801_10395213 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 574 | Open in IMG/M |
| 3300017961|Ga0187778_10838912 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 629 | Open in IMG/M |
| 3300017994|Ga0187822_10105192 | All Organisms → cellular organisms → Bacteria | 866 | Open in IMG/M |
| 3300017995|Ga0187816_10130947 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1082 | Open in IMG/M |
| 3300018012|Ga0187810_10397019 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 579 | Open in IMG/M |
| 3300018012|Ga0187810_10501038 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 519 | Open in IMG/M |
| 3300018079|Ga0184627_10475877 | All Organisms → cellular organisms → Bacteria | 647 | Open in IMG/M |
| 3300018089|Ga0187774_10050974 | All Organisms → cellular organisms → Bacteria | 1835 | Open in IMG/M |
| 3300018468|Ga0066662_12814795 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 516 | Open in IMG/M |
| 3300019284|Ga0187797_1159886 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 860 | Open in IMG/M |
| 3300019788|Ga0182028_1231671 | All Organisms → cellular organisms → Bacteria | 1027 | Open in IMG/M |
| 3300019789|Ga0137408_1119336 | All Organisms → cellular organisms → Bacteria | 997 | Open in IMG/M |
| 3300019789|Ga0137408_1473337 | All Organisms → cellular organisms → Bacteria | 725 | Open in IMG/M |
| 3300020140|Ga0179590_1115633 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 726 | Open in IMG/M |
| 3300020170|Ga0179594_10115604 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 974 | Open in IMG/M |
| 3300020579|Ga0210407_10569952 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 883 | Open in IMG/M |
| 3300020579|Ga0210407_11258601 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 554 | Open in IMG/M |
| 3300020580|Ga0210403_10428763 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1078 | Open in IMG/M |
| 3300020581|Ga0210399_10061759 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3023 | Open in IMG/M |
| 3300020582|Ga0210395_11077082 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 594 | Open in IMG/M |
| 3300021088|Ga0210404_10354821 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 814 | Open in IMG/M |
| 3300021168|Ga0210406_10240969 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1487 | Open in IMG/M |
| 3300021170|Ga0210400_10340893 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1233 | Open in IMG/M |
| 3300021170|Ga0210400_10480460 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1025 | Open in IMG/M |
| 3300021401|Ga0210393_10367843 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1171 | Open in IMG/M |
| 3300021405|Ga0210387_10043622 | All Organisms → cellular organisms → Bacteria | 3587 | Open in IMG/M |
| 3300021420|Ga0210394_10742725 | All Organisms → cellular organisms → Bacteria | 859 | Open in IMG/M |
| 3300021420|Ga0210394_11162741 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 663 | Open in IMG/M |
| 3300021432|Ga0210384_11458890 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 589 | Open in IMG/M |
| 3300021559|Ga0210409_10897319 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 760 | Open in IMG/M |
| 3300021559|Ga0210409_11344957 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 590 | Open in IMG/M |
| 3300021559|Ga0210409_11664970 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 514 | Open in IMG/M |
| 3300022510|Ga0242652_1019623 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 716 | Open in IMG/M |
| 3300022512|Ga0242676_1020563 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 684 | Open in IMG/M |
| 3300022512|Ga0242676_1043926 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 541 | Open in IMG/M |
| 3300022522|Ga0242659_1056282 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 706 | Open in IMG/M |
| 3300022532|Ga0242655_10294370 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 527 | Open in IMG/M |
| 3300022712|Ga0242653_1070232 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 600 | Open in IMG/M |
| 3300022712|Ga0242653_1072421 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 594 | Open in IMG/M |
| 3300022715|Ga0242678_1030200 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 710 | Open in IMG/M |
| 3300022720|Ga0242672_1122220 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 534 | Open in IMG/M |
| 3300022724|Ga0242665_10022038 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1480 | Open in IMG/M |
| 3300022873|Ga0224550_1014376 | All Organisms → cellular organisms → Bacteria | 1118 | Open in IMG/M |
| 3300024283|Ga0247670_1064131 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 667 | Open in IMG/M |
| 3300025469|Ga0208687_1076524 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 747 | Open in IMG/M |
| 3300025498|Ga0208819_1064199 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 822 | Open in IMG/M |
| 3300025922|Ga0207646_10808433 | All Organisms → cellular organisms → Bacteria | 835 | Open in IMG/M |
| 3300026296|Ga0209235_1219434 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 618 | Open in IMG/M |
| 3300026310|Ga0209239_1094609 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1275 | Open in IMG/M |
| 3300026314|Ga0209268_1182534 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 518 | Open in IMG/M |
| 3300026317|Ga0209154_1060544 | All Organisms → cellular organisms → Bacteria | 1667 | Open in IMG/M |
| 3300026317|Ga0209154_1214855 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 726 | Open in IMG/M |
| 3300026332|Ga0209803_1038137 | All Organisms → cellular organisms → Bacteria | 2208 | Open in IMG/M |
| 3300026333|Ga0209158_1152775 | All Organisms → cellular organisms → Bacteria | 843 | Open in IMG/M |
| 3300026355|Ga0257149_1013295 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1084 | Open in IMG/M |
| 3300026369|Ga0257152_1032298 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 564 | Open in IMG/M |
| 3300026467|Ga0257154_1056463 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 612 | Open in IMG/M |
| 3300026551|Ga0209648_10243198 | All Organisms → cellular organisms → Bacteria | 1338 | Open in IMG/M |
| 3300026557|Ga0179587_10517238 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 783 | Open in IMG/M |
| 3300027381|Ga0208983_1026973 | All Organisms → cellular organisms → Bacteria | 1124 | Open in IMG/M |
| 3300027610|Ga0209528_1123866 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 569 | Open in IMG/M |
| 3300027616|Ga0209106_1055731 | All Organisms → cellular organisms → Bacteria | 883 | Open in IMG/M |
| 3300027635|Ga0209625_1000042 | All Organisms → cellular organisms → Bacteria | 24783 | Open in IMG/M |
| 3300027643|Ga0209076_1083286 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 909 | Open in IMG/M |
| 3300027648|Ga0209420_1193902 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 542 | Open in IMG/M |
| 3300027655|Ga0209388_1085917 | All Organisms → cellular organisms → Bacteria | 905 | Open in IMG/M |
| 3300027667|Ga0209009_1030420 | All Organisms → cellular organisms → Bacteria | 1330 | Open in IMG/M |
| 3300027667|Ga0209009_1052655 | All Organisms → cellular organisms → Bacteria | 1018 | Open in IMG/M |
| 3300027765|Ga0209073_10100736 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1019 | Open in IMG/M |
| 3300027817|Ga0209112_10030367 | All Organisms → cellular organisms → Bacteria | 1597 | Open in IMG/M |
| 3300027824|Ga0209040_10148274 | All Organisms → cellular organisms → Bacteria | 1270 | Open in IMG/M |
| 3300027857|Ga0209166_10207082 | All Organisms → cellular organisms → Bacteria | 1053 | Open in IMG/M |
| 3300027875|Ga0209283_10330698 | All Organisms → cellular organisms → Bacteria | 1002 | Open in IMG/M |
| 3300027879|Ga0209169_10418671 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 704 | Open in IMG/M |
| 3300027908|Ga0209006_10237444 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1572 | Open in IMG/M |
| 3300027910|Ga0209583_10735690 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 518 | Open in IMG/M |
| 3300028047|Ga0209526_10483164 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 810 | Open in IMG/M |
| 3300028536|Ga0137415_10098439 | All Organisms → cellular organisms → Bacteria | 2778 | Open in IMG/M |
| 3300028746|Ga0302233_10397359 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 522 | Open in IMG/M |
| 3300028747|Ga0302219_10036200 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1843 | Open in IMG/M |
| 3300028792|Ga0307504_10035288 | All Organisms → cellular organisms → Bacteria | 1351 | Open in IMG/M |
| 3300028795|Ga0302227_10233719 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 705 | Open in IMG/M |
| 3300029993|Ga0302304_10227622 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 689 | Open in IMG/M |
| 3300030520|Ga0311372_10237994 | All Organisms → cellular organisms → Bacteria | 2972 | Open in IMG/M |
| 3300030730|Ga0307482_1078538 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 865 | Open in IMG/M |
| 3300030743|Ga0265461_11957998 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 666 | Open in IMG/M |
| 3300030935|Ga0075401_10902107 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 686 | Open in IMG/M |
| 3300031231|Ga0170824_107389374 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 552 | Open in IMG/M |
| 3300031544|Ga0318534_10370557 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 823 | Open in IMG/M |
| 3300031545|Ga0318541_10023187 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2995 | Open in IMG/M |
| 3300031715|Ga0307476_10137558 | All Organisms → cellular organisms → Bacteria | 1748 | Open in IMG/M |
| 3300031715|Ga0307476_10256255 | All Organisms → cellular organisms → Bacteria | 1278 | Open in IMG/M |
| 3300031718|Ga0307474_11295531 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 575 | Open in IMG/M |
| 3300031740|Ga0307468_100480571 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 978 | Open in IMG/M |
| 3300031740|Ga0307468_102117044 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 542 | Open in IMG/M |
| 3300031754|Ga0307475_10010079 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 6241 | Open in IMG/M |
| 3300031821|Ga0318567_10893370 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 503 | Open in IMG/M |
| 3300031823|Ga0307478_10098540 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2260 | Open in IMG/M |
| 3300031833|Ga0310917_10937109 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 582 | Open in IMG/M |
| 3300031859|Ga0318527_10517990 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 509 | Open in IMG/M |
| 3300031942|Ga0310916_11117864 | All Organisms → cellular organisms → Bacteria | 654 | Open in IMG/M |
| 3300031949|Ga0214473_11248627 | All Organisms → cellular organisms → Bacteria | 766 | Open in IMG/M |
| 3300031962|Ga0307479_10134679 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2417 | Open in IMG/M |
| 3300031962|Ga0307479_10177968 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2091 | Open in IMG/M |
| 3300031962|Ga0307479_10806529 | All Organisms → cellular organisms → Bacteria | 914 | Open in IMG/M |
| 3300031962|Ga0307479_10982139 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 814 | Open in IMG/M |
| 3300032025|Ga0318507_10115856 | All Organisms → cellular organisms → Bacteria | 1127 | Open in IMG/M |
| 3300032180|Ga0307471_100166281 | All Organisms → cellular organisms → Bacteria | 2150 | Open in IMG/M |
| 3300032180|Ga0307471_100504672 | All Organisms → cellular organisms → Bacteria | 1358 | Open in IMG/M |
| 3300032180|Ga0307471_103764682 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 536 | Open in IMG/M |
| 3300032205|Ga0307472_100251399 | All Organisms → cellular organisms → Bacteria | 1386 | Open in IMG/M |
| 3300032892|Ga0335081_11285098 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 827 | Open in IMG/M |
| 3300032897|Ga0335071_10917715 | All Organisms → cellular organisms → Bacteria | 823 | Open in IMG/M |
| 3300032898|Ga0335072_10507650 | All Organisms → cellular organisms → Bacteria | 1247 | Open in IMG/M |
| 3300033489|Ga0299912_10595251 | All Organisms → cellular organisms → Bacteria | 875 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 21.54% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 16.26% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 7.32% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 6.91% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 6.50% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.47% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.25% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.85% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 2.85% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.44% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.03% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 2.03% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.22% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.22% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.22% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.22% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.22% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.22% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.22% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.22% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.22% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.63% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.41% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.41% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.41% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.41% |
| Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 0.41% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 0.41% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.41% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.41% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.41% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.41% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.81% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.81% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.81% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.81% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.81% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001545 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300002909 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm | Environmental | Open in IMG/M |
| 3300002911 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm | Environmental | Open in IMG/M |
| 3300002914 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm | Environmental | Open in IMG/M |
| 3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004136 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF214 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004139 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF230 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300004267 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 6 MoBio | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
| 3300005952 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-045 | Environmental | Open in IMG/M |
| 3300006041 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009522 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG | Environmental | Open in IMG/M |
| 3300009523 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG | Environmental | Open in IMG/M |
| 3300009524 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG | Environmental | Open in IMG/M |
| 3300009525 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG | Environmental | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010861 | Boreal forest soil eukaryotic communities from Alaska, USA - C4-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300012004 | Permafrost microbial communities from Nunavut, Canada - A30_5cm_6M | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012382 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_4_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300014201 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaG | Environmental | Open in IMG/M |
| 3300014657 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaG | Environmental | Open in IMG/M |
| 3300015052 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300016702 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
| 3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300017994 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2 | Environmental | Open in IMG/M |
| 3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
| 3300018012 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5 | Environmental | Open in IMG/M |
| 3300018079 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b1 | Environmental | Open in IMG/M |
| 3300018089 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300019284 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019788 | Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300020140 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300022510 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-14-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022512 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022522 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-11-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022532 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022712 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-32-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022715 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022720 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022724 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022873 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P3 10-14 | Environmental | Open in IMG/M |
| 3300024283 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK11 | Environmental | Open in IMG/M |
| 3300025469 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_100 (SPAdes) | Environmental | Open in IMG/M |
| 3300025498 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026296 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026314 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 (SPAdes) | Environmental | Open in IMG/M |
| 3300026317 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes) | Environmental | Open in IMG/M |
| 3300026332 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes) | Environmental | Open in IMG/M |
| 3300026333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes) | Environmental | Open in IMG/M |
| 3300026355 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-02-A | Environmental | Open in IMG/M |
| 3300026369 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-05-A | Environmental | Open in IMG/M |
| 3300026467 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-16-A | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027381 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027610 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027616 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027635 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027643 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027648 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027655 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027667 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027765 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes) | Environmental | Open in IMG/M |
| 3300027817 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027824 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027857 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027910 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028746 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_1 | Environmental | Open in IMG/M |
| 3300028747 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_2 | Environmental | Open in IMG/M |
| 3300028792 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S | Environmental | Open in IMG/M |
| 3300028795 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_1 | Environmental | Open in IMG/M |
| 3300029993 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E2_2 | Environmental | Open in IMG/M |
| 3300030520 | III_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300030730 | Metatranscriptome of hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030743 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VCO Co-assembly | Environmental | Open in IMG/M |
| 3300030935 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OA7 SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031859 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031949 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032897 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5 | Environmental | Open in IMG/M |
| 3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
| 3300033489 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT95D214 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12630J15595_100845591 | 3300001545 | Forest Soil | MNPNLKWKAVFIAVVIIGCVYGLLGLPTFPTSVADVKSNFAHQ |
| JGIcombinedJ26739_1010886202 | 3300002245 | Forest Soil | MNPNLKWKALFILAVILLCIYFVLGLPNFPTSLTALRDNFEHQI |
| JGIcombinedJ26739_1012776861 | 3300002245 | Forest Soil | MNPNLKWKAVFIAVVIIGCVYGLLGLPTFPTSXADVKSNFAHQIKL |
| JGI25388J43891_100006719 | 3300002909 | Grasslands Soil | MNPNLKWKALFIFSVILFCIYFLFGYPVFPTSVAQVKDNFGKQIKLGL |
| JGI25390J43892_100462451 | 3300002911 | Grasslands Soil | MNPNLKWKALFILAVILFCIYFLFGYPVFPTSLAQVKDNFSKQIKLGL |
| JGI25617J43924_100878173 | 3300002914 | Grasslands Soil | MNPNXKWRALSILAIILFCIYFLFGYPVFPTSIAQVKDNFSRQIKLGL |
| Ga0062385_105546552 | 3300004080 | Bog Forest Soil | MNPNLKWKALFILLVILGCIYGLIGLPTFPTSVADLKNNFSQQIKL |
| Ga0062389_1018539891 | 3300004092 | Bog Forest Soil | MNSNLTWKLVFILAVVVICLYSIFGIPNFPTSLATIKDNFAHQIKLG |
| Ga0058889_14070171 | 3300004136 | Forest Soil | MNPNLKWRALSVIAIIIFCLYFLIGYPTFPTSFAQVKDNFGRQIKLGL |
| Ga0058897_100002142 | 3300004139 | Forest Soil | MNPNLKWKAVFILVVILGCIYGLFGVPTFPTSAADLKSNFAHQIKL |
| Ga0062386_1004248173 | 3300004152 | Bog Forest Soil | MNPNLKWKVISIVAIVLLCLYFIFGLPNFPTSFAVLKNNFA |
| Ga0066396_101149561 | 3300004267 | Tropical Forest Soil | MNPNLKWKVVFIVFVILLSIYVLIGYPTFPTSVAQMKDNFSRQIKLG |
| Ga0066672_103692982 | 3300005167 | Soil | MNPNVKWKALFIAIVIVFCLYFLFGYPTFPTSLAQVKDNFK |
| Ga0066677_102444613 | 3300005171 | Soil | MNPNLKWKALFIFVVILFCIYFLFGYPVFPTSVAQIKDNFSKQIKL |
| Ga0066675_102043034 | 3300005187 | Soil | MNPNLKWRALFILAVILFCLYFLFGYPTFPTSFAQVKENFGKQIKL |
| Ga0066388_1001005456 | 3300005332 | Tropical Forest Soil | MNPNLKWKALFIAAVIIVCIAFVLCLPNFPTSLTALKDNFTHQIKLGLDL |
| Ga0066388_1072812632 | 3300005332 | Tropical Forest Soil | MNPNLKWKALFILIVIALCLYSLFGYPTFPTSFAQVKENFRNEIKLGLD |
| Ga0070708_1001672381 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MNPNLKWKALFILAIVLLCFYGLAGLPNPPSSWAQAKANFSRQIKL |
| Ga0070706_1013082782 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MNPNLKWKALFILVVILLCIYGLLGLPTFPTSLAQVKDNFSRQI |
| Ga0073909_102136453 | 3300005526 | Surface Soil | MNPNLKWKAVFIAVVILGCIYGLVGLPTFPTSIAD |
| Ga0073909_102556544 | 3300005526 | Surface Soil | MNPNLKWKVVFIAAVILVCIYGLIGLPTFPTSVKQIKDN |
| Ga0073909_105938261 | 3300005526 | Surface Soil | MNPNLKWKALFILAVILLCIYSVIGYPDFPTSLTALKTNFEHQIKLGLD |
| Ga0070731_107181471 | 3300005538 | Surface Soil | MNPNLKWQALFIVVVIVLCIYFVVGIPNFPTSLTTLKDNFAHQIRLG |
| Ga0070695_1004246343 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | MNPNLKWKAVFIVVVILACVYGLLGLPTFPTSAADVKSNFGHQIRLGLDL |
| Ga0070695_1006505391 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | MNPNTKWKALFILAVILLCVYGLIGLPKFPTSLAQLKDNFSQ |
| Ga0066692_104357393 | 3300005555 | Soil | MNPNLKWKALFIFAVIVFCIYFLIGYPVFPTSLAQVKDN |
| Ga0066670_100604394 | 3300005560 | Soil | MNPNLKWKALFILAVIVFCLYFLFGYPTFPTSFAQAKDNFKKQIKLGLDLQG |
| Ga0066703_105962382 | 3300005568 | Soil | MNPNLKWKAVFIVVVIVGCIYGLLGLPTFPTSAADVKS |
| Ga0070764_110511851 | 3300005712 | Soil | MNPNLKWKFIFIVLVVLGCIYGLVGLPTFPTSLAQLKDNFS |
| Ga0080026_101771172 | 3300005952 | Permafrost Soil | MTPNLKWKALFILAVILLCIYFLVGYPTFPTSIAGIKD |
| Ga0075023_1003431123 | 3300006041 | Watersheds | MNPNLKWKALFILAVIIACIYGLIGVPTFPTSLAIIKDNF |
| Ga0075017_1013094651 | 3300006059 | Watersheds | MNPNLKWKIIFILAVVLICLYTIFCYPTFPTSFAQLK |
| Ga0070715_101079583 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | MTPNLKWKGLFILAVILLCIYGLIGLPNFPTSVARMR |
| Ga0070765_1020504701 | 3300006176 | Soil | MNPNLKWKALFIVAVILVCIYVLIGMPKFPTSLADIKDNFSHQI |
| Ga0079222_105634422 | 3300006755 | Agricultural Soil | MNPNLKWKALFIVVAIVFCIYFLFGLPTLPTSFAQV |
| Ga0066659_115334311 | 3300006797 | Soil | MNPNVKWKALFIAIVIVFCLYFLFGYPTFPTSLAQVKDNFKRQIKLG |
| Ga0079220_103350041 | 3300006806 | Agricultural Soil | MNPNLKWKALFIFGVILFCIYFLFGYPVFPTSLAQVKDNF |
| Ga0075426_109524481 | 3300006903 | Populus Rhizosphere | MNPNLKWKAIFIVLVVLGCVYGLVCLPVFPTSLAQLRD |
| Ga0075424_1016866462 | 3300006904 | Populus Rhizosphere | MNPNLKWKALFIVAVILVCIYGLIGLPTFPTSLAQIKDNFSK |
| Ga0099795_100520303 | 3300007788 | Vadose Zone Soil | MNPNLKWKALFILVVILLCIYGLLGLPTFPTSVAQIKDNF |
| Ga0099829_111184251 | 3300009038 | Vadose Zone Soil | MNPNLKWKALFIFAVILFCIYFLVGYPVFPTSLAQVKDNFSKQIK |
| Ga0099830_102008883 | 3300009088 | Vadose Zone Soil | MNPNLKWKALFILAVILFCIYFLFGYPVFPTSVAQMKDNFSRQ |
| Ga0099830_105984253 | 3300009088 | Vadose Zone Soil | MNPNLKWKALFILAIVLLCFYGLVGLPNPPSSWAQAKANISRQIKLGLDLQ |
| Ga0099830_116376581 | 3300009088 | Vadose Zone Soil | MNPNLKWKTLFILAVILFCIYFLFGYPTFPTSLAQV |
| Ga0099828_107085351 | 3300009089 | Vadose Zone Soil | MNPNLKWKTLLILAIILLCFYGLVGLPNPPSSWAQAKANFSRQIKLG |
| Ga0099827_100802615 | 3300009090 | Vadose Zone Soil | MNPNLKWKTLLILAIILLCFYGLVGLPNPPSSWAQAKANFSRQIKLGLDLQ |
| Ga0099827_104393813 | 3300009090 | Vadose Zone Soil | MNPNLKWKALFIFAVILFCIYFLLGYPVFPTSLAQVKENFGKQIKLGLDLQ |
| Ga0099827_109582521 | 3300009090 | Vadose Zone Soil | MNPNLKWKSLFILAVILFCIYFLFGYPTFPTSLAQVKDNFGKQIKLGLD |
| Ga0066709_1040589552 | 3300009137 | Grasslands Soil | MNPNLKWKALFIFAVILFCIYFLFGYPVFPTSVARMKDNFSKQ |
| Ga0105243_105140013 | 3300009148 | Miscanthus Rhizosphere | MNPNLKWKALFIVAVILVCIYGLIGLPTFPTSLAQ |
| Ga0116218_13990741 | 3300009522 | Peatlands Soil | MNPNLKWKALFILGVILICIFFIFGLPTLPTSFAQ |
| Ga0116221_13478192 | 3300009523 | Peatlands Soil | MNPNLKWKASFILGVILICIFFIFGLPTFPTSFAQIKDNFT |
| Ga0116225_12962341 | 3300009524 | Peatlands Soil | MNPNLKWKVLFILAVILACIFFVFGLPTLPTSLAQIKDNFA |
| Ga0116220_101491861 | 3300009525 | Peatlands Soil | MNPNLKWKAVFIFGVILICIFFIFGLPTFPTSLAQIKDN |
| Ga0116220_102991502 | 3300009525 | Peatlands Soil | MNPNLKWKAVFILAVILFCIYFLFSYPTFPTSVAAMKDNFNKQIKLGLDLQGGT |
| Ga0116217_105359741 | 3300009700 | Peatlands Soil | MNPNLKWKVVFILVVVVFCLYSIFGLPTFPTSFAQIKD |
| Ga0116219_100219011 | 3300009824 | Peatlands Soil | MNPNLKWKASFILGVILICIFFIFGLPTFPTSFAQIK |
| Ga0126380_111812272 | 3300010043 | Tropical Forest Soil | MNPNLKWKVIFIALVILGCIYGLIGLPVFPTSRAQLRDNFSHQIKLGL |
| Ga0126382_109519513 | 3300010047 | Tropical Forest Soil | MNPNLKWKVLFIAAVILLCIYGLIGLPTFPTSVAQIKD |
| Ga0126373_103228511 | 3300010048 | Tropical Forest Soil | MNPNLKWKALFIVAVIVLCIAFVAGMPNLPTSLTALKDNFAHQ |
| Ga0134088_103873302 | 3300010304 | Grasslands Soil | MNPNLKWKALFIFTVILFCIYFLFGYPVFPTSVAQVKD |
| Ga0074046_101989551 | 3300010339 | Bog Forest Soil | MNPNLKWKVLFILAVILICIFFVFGLPTLPTSLAQ |
| Ga0074044_107900811 | 3300010343 | Bog Forest Soil | MNPNLKWKVVFILVVVVFCVYSIVGLPSFPTSFTL |
| Ga0126376_105302961 | 3300010359 | Tropical Forest Soil | MNPNLKWKALFILVVILVCVYGLIGLPTFPTSLAQIK |
| Ga0126372_101199474 | 3300010360 | Tropical Forest Soil | MNPNLKWKALFILAVIVLCIAFVAGIPNLPTSLTTLKDNFA |
| Ga0126372_113973611 | 3300010360 | Tropical Forest Soil | MNPNLKWKVVFIVFVILLSIYVLIGYPTFPTSVAQMKDNFSRQI |
| Ga0126372_126951011 | 3300010360 | Tropical Forest Soil | MNPNLKWKALFILAVILFCIYFLFGYPAFPTSPAA |
| Ga0126378_130228802 | 3300010361 | Tropical Forest Soil | MNPNLKWKALFILIVIALCLYSLFGYPTFPTSFAQV |
| Ga0126378_130822591 | 3300010361 | Tropical Forest Soil | MNPNLKWKALFILAVIVFCLYFLFDYPTFPTSFAQ |
| Ga0126377_125868552 | 3300010362 | Tropical Forest Soil | MNPNLKWKALFILAVILLCIYGLIGLPTFPTSVAQMKSNFS |
| Ga0126377_126906281 | 3300010362 | Tropical Forest Soil | MNPNLKWKVVFIAAVILVCIYGLIGIPTFPTSLAQIKANFNKQIKLGLD |
| Ga0126381_10000121724 | 3300010376 | Tropical Forest Soil | MNPNLKWKALFILAVIFFCLYFLFGYPTFPTSFAQVKDNF |
| Ga0126381_1011057981 | 3300010376 | Tropical Forest Soil | MNPNLKWKAVFIVAVIVLCIYWVVGIPNFPTSLIALKDNFAHQIKLGLD |
| Ga0126381_1018494233 | 3300010376 | Tropical Forest Soil | MNPNLKWKALFIFTVILFCIYFLFGYPTFPTSFAQLKGNFRNQIQLG |
| Ga0126381_1041274501 | 3300010376 | Tropical Forest Soil | MNPNLKWKVIFIAAVILICIYGLIGLPTFPTSLGLI |
| Ga0126383_111212793 | 3300010398 | Tropical Forest Soil | MNPNLKWKALFILAVIVFCLYFLFGYPTFPTSFAQVKDNFKSQIKLGL |
| Ga0126349_11536401 | 3300010861 | Boreal Forest Soil | MNPNLKWKALFILVVILFCIYFLVGYPVFPTSVAQLRDNFSKQIKLGLDLQ |
| Ga0150983_111728482 | 3300011120 | Forest Soil | MNPNLKWKAVFIALVVVGCIYGLIGVPTFPTSLAQIKDNFSHQIKLG |
| Ga0150983_125753572 | 3300011120 | Forest Soil | MNPNLKWKAVFIVVVILGCIYGLLGLPTFPTSAADVKSNFAH |
| Ga0137392_100265277 | 3300011269 | Vadose Zone Soil | MNPNLKWKAVFILVVILGCIYGLFGLPTFPTSVADLKSNFAQQ |
| Ga0137392_107595442 | 3300011269 | Vadose Zone Soil | MNPNLKWKALFIFAVILFCIYFLVGYPVFPTSLAQVKDNFSK |
| Ga0120134_10128032 | 3300012004 | Permafrost | MNPNLKWKALFILAVILICVYVLIGTPTFPTSVQQIK |
| Ga0137383_105004143 | 3300012199 | Vadose Zone Soil | MNPNLKWKAVFIVFVILASIYLLIGYPTFPTSVAQIKDNFSHQIKLGLDLQGG |
| Ga0137382_104552463 | 3300012200 | Vadose Zone Soil | MNPNLKWKALFIFAVILFCIYFLFGYPVFPTSVAQV |
| Ga0137363_100085171 | 3300012202 | Vadose Zone Soil | MNPNLKWKALFILVVILLCIYGLLGLPTFPTSLAQVKDNFSKQIHLG |
| Ga0137363_104749821 | 3300012202 | Vadose Zone Soil | MNPNLKWKALFILAVILLCIYGLIGLPTFPTSVAQVRDNFS |
| Ga0137362_101285204 | 3300012205 | Vadose Zone Soil | MNPNLKWKALFILAVILLCIYGLLGLPTFPTSVAQI |
| Ga0137379_106575651 | 3300012209 | Vadose Zone Soil | MNPNLKWKGLFIAAVIVFCFYFLFGYPTFPTSFAQVKDNFNKQIKLGLDLQ |
| Ga0137378_112629661 | 3300012210 | Vadose Zone Soil | MNPNLKWKTLFILAVILFCIYFLFGYPTFPTSLAQVKDNFGKQIKL |
| Ga0137377_116335391 | 3300012211 | Vadose Zone Soil | MNPNLKWKALFIFAVILFCIYFLFGYPVFPTSLAQVKDNFGKQIKLG |
| Ga0137385_106671941 | 3300012359 | Vadose Zone Soil | MNPNLKWKALFISAVIVFCLYFLFGYPAFPTSFAQVKDNFKKQIKL |
| Ga0137360_111426082 | 3300012361 | Vadose Zone Soil | MNPNLKWKAVFILVVILGCIYGLFGVPTFPTSSADLKSNFAHQIKLG |
| Ga0137360_117708121 | 3300012361 | Vadose Zone Soil | MNPNLKWKAVFIVVVILGCIYGLFGVPTFPTSAADLKSNFAHQIK |
| Ga0137390_103064211 | 3300012363 | Vadose Zone Soil | MNPNLKWKALFILAVILFCIYFLFGYPVFPTSVAQMKDNFSRQIKLGLDLQ |
| Ga0137390_106115541 | 3300012363 | Vadose Zone Soil | MNPNLKWRALFIFIVILFCIYFLIGYPGFPTSVAQMKD |
| Ga0134038_10820712 | 3300012382 | Grasslands Soil | MNPNLKWKALFIFSVILFCIYFLFGYPVFPTSVAQVKDNF |
| Ga0137358_101476263 | 3300012582 | Vadose Zone Soil | MNPNLKWKALFILLVVLACIYTLVGLPTFPTSLAELKDNFRHQIKLGLDL |
| Ga0137395_109276723 | 3300012917 | Vadose Zone Soil | MNPNLKWKALLILAVILFCIYFLFGYPVFPTSLAQVKDNFSKQIKLGL |
| Ga0137395_112833663 | 3300012917 | Vadose Zone Soil | MNPNLKWKALFILVVILLCIYGLLGLPTFPTSLAQVKDNFSK |
| Ga0137396_102356841 | 3300012918 | Vadose Zone Soil | MNPNLKWKAVFIAVVILGCIYGLRRLPPFPTSIADVKSNFAHQIKLGLD |
| Ga0137359_109631071 | 3300012923 | Vadose Zone Soil | MHPNLKWKAVFIVVVILGCIYGLFGVPTFPTSTADLKSNFAHQIK |
| Ga0137413_100165151 | 3300012924 | Vadose Zone Soil | MNPNLKWKALFILAVILLCIYGLLGLPTFPTSVAQIRDNFSKQIHLGLDLQ |
| Ga0137413_109099132 | 3300012924 | Vadose Zone Soil | MNPNLKWKALFILLVILICIYGLIGLPTFPTSVATIKDNFSKQIKL |
| Ga0137419_109989191 | 3300012925 | Vadose Zone Soil | MNPNLKWKALFIVAVILICVYSLIGYPTFPTSVAQLKDNFSHQ |
| Ga0137419_115769781 | 3300012925 | Vadose Zone Soil | MNPNLKWKALFILAVILFCIYYLIGLPEFPKSFAQVKNNFSHQIK |
| Ga0137404_105966284 | 3300012929 | Vadose Zone Soil | MNPNLKWKALFILVVILLCIYGLIGLPTFPTSVATIKDNFSKQIK |
| Ga0137404_115552991 | 3300012929 | Vadose Zone Soil | MNPNLKWKALFILAVILLCIYGLFGLPTFPTSLAQVKDNLSKQIHLGLDL |
| Ga0137407_104501501 | 3300012930 | Vadose Zone Soil | MNPNLKWKALFIFAVILFCIYFLFGYPVFPTSVAQVKDNFSKQIKLGLD |
| Ga0137410_108852272 | 3300012944 | Vadose Zone Soil | MNSNLKWKALFILAVILLCIYAVIGYPDFPTSFTAL |
| Ga0126375_117119152 | 3300012948 | Tropical Forest Soil | MNPNLKWKALFILAIVLLCLYGLFGLPQFPTSLAAAKQNFSRQI |
| Ga0164302_108965611 | 3300012961 | Soil | MNPNTKWKALFILAVILLCVYGLIGLPKFPTSLAQLKDNFSQQIKL |
| Ga0126369_134197401 | 3300012971 | Tropical Forest Soil | MNPNLKWKVIFIVLVVVGCIYGLIGLPTFPTSLTQI |
| Ga0164309_114261102 | 3300012984 | Soil | MNSNLKWKALCIAIVILFCVYFLLGYAVFPTSLAQVKDNF |
| Ga0134078_105931002 | 3300014157 | Grasslands Soil | MNPNLKWRALFILAVILFCLYFLFGYPTFPTSFAQVKENFGKQIKLGL |
| Ga0181537_100309551 | 3300014201 | Bog | MNPNLKWRVVFIALIILGCIYGLIGVPTFPTSLAQIKDNFAHQIKLGLDL |
| Ga0181537_100716684 | 3300014201 | Bog | MTPNLKYKAVFILLVILVCIYVLVGYPTFPTSLAQLKDNFSK |
| Ga0181522_101157801 | 3300014657 | Bog | MNPNLKWRVVFIALIILGCIYGLIGVPTFPTSLAQIKDNFAHQIK |
| Ga0137411_11991201 | 3300015052 | Vadose Zone Soil | MNPNLKWKALFIFAVILFCIYFLFGYPVFPTSVAQVRDNFSRQIKLGL |
| Ga0137420_10364263 | 3300015054 | Vadose Zone Soil | MNPNLKWKAVFIVVVILACVYGLLGLPTFPTSAADVKSN |
| Ga0137420_11232221 | 3300015054 | Vadose Zone Soil | MNPNLKWKAVFIVVVILACVYGLLGLPTFPTSAGGREIEF |
| Ga0137420_13502302 | 3300015054 | Vadose Zone Soil | MNPNLKWKALFILAVILLCIYAVIGYPDLPTSLTALRN |
| Ga0137418_106841291 | 3300015241 | Vadose Zone Soil | MNPNLKWKAVFIAVVILGCIYGLVGLPTFPTSIADVKSNFAHQIKL |
| Ga0137403_1001578110 | 3300015264 | Vadose Zone Soil | MNPNLKWKALFIFAVIVFCIYFLIGYPVFPTSLAQVKDNFS |
| Ga0137403_115925162 | 3300015264 | Vadose Zone Soil | MNPNLKWKALFIFAVIVFCIYFLIGYPVFPTSLAQVKDNFSKQIKL |
| Ga0182032_104631033 | 3300016357 | Soil | MNPNLKWKALFILAVIVVCIYGLVGLPTFPTSVAQLKSNFSNQIRLGL |
| Ga0182034_113207021 | 3300016371 | Soil | MKSNIQWKVIFIVVVILFSIYMLIGYPTFPTSVAQIKENFNRQIKLGLDLQ |
| Ga0182039_105138943 | 3300016422 | Soil | MTPNLKWKTLFILAVILLCIYGLIGLPNFPTSVAQ |
| Ga0181511_10057471 | 3300016702 | Peatland | MNPNLKYKVIFILVVILFCLYFIFGYPTFPTSLAQIKANF |
| Ga0181511_14962982 | 3300016702 | Peatland | MNPNLKWKVVFILVVVVFCLYSIFGLPTFPTSFALIKDNFAHQIKLG |
| Ga0187802_101500201 | 3300017822 | Freshwater Sediment | MNPNLKWRALFILVLILFCIYFLVGYPTFPTSVAQ |
| Ga0187801_100664943 | 3300017933 | Freshwater Sediment | MNPNLKWKAAFILGVILICIFFIFGLPTFPTSFAQIKDNFTHQIKLG |
| Ga0187801_103952132 | 3300017933 | Freshwater Sediment | MNPNLKWKIVFILAVVVFCLYSVFGLPTFPTSFVQLKDNFGHQIKLGLDL |
| Ga0187778_108389121 | 3300017961 | Tropical Peatland | MAPDPVNMNPNLKYKVLFIAAVVVICLYFVLGLPTFPTSLAQLKSNFTNQIKLGLDL |
| Ga0187822_101051921 | 3300017994 | Freshwater Sediment | MNPNLKWKFVFIAAVLLVCVYGIIGLPNFPTSAATLK |
| Ga0187816_101309471 | 3300017995 | Freshwater Sediment | MNPNLKWKIVFILAVVVFCLYSVFGLPTFPTSFAQLKDNFAHQIKLGL |
| Ga0187810_103970191 | 3300018012 | Freshwater Sediment | MNPNLKWKALFIFVAILLCVYFVVGIPNSPTSLSAFKDN |
| Ga0187810_105010381 | 3300018012 | Freshwater Sediment | MNPNLKYKIGFIIAVVVVCVYFTVGLPTFPTSFAQFKQNFEHQIKL |
| Ga0184627_104758772 | 3300018079 | Groundwater Sediment | MNANLKWKAVFIAGVILACIYGLFGRPKFPTSVADIK |
| Ga0187774_100509743 | 3300018089 | Tropical Peatland | MNPNLKWKIIFIFAVILLCTYFILGMPTFPTSLAQIKDNFTQQIKLGL |
| Ga0066662_128147952 | 3300018468 | Grasslands Soil | MNPNLKWKALFIFSVILFCIYFLFGYPVFPTSVAQVKDNFGKQIKL |
| Ga0187797_11598862 | 3300019284 | Peatland | MNPNLKWRALFIVFVIVFCIYFLLGYPTFPTSLAQVKDNFS |
| Ga0182028_12316713 | 3300019788 | Fen | MNPNLKWKAVFILGVILICIFFIFGLPTFPTSLAQIKDNFTRQIKLG |
| Ga0137408_11193363 | 3300019789 | Vadose Zone Soil | MNPNLKWKALFIFAVIVFCIYFLIGYPVFPTSLAQVKDNFSNQIKLG |
| Ga0137408_14733371 | 3300019789 | Vadose Zone Soil | NHESYLKWKAVFIVFVILASIYLLIGYPTFPTSVAQIKDNFSHQIKLGP |
| Ga0179590_11156331 | 3300020140 | Vadose Zone Soil | MNPNLKWKAFFILAVVFVCIYSLIGLPTFPTSIAQIKENFGH |
| Ga0179594_101156043 | 3300020170 | Vadose Zone Soil | MNPNLKWKALFILAVILFCIYFLFGYPVFPTSVAQVKDNFGK |
| Ga0210407_105699523 | 3300020579 | Soil | MNPNLKWKVVFIVLVILGCIYGLVGLPVFPTSVAQ |
| Ga0210407_112586011 | 3300020579 | Soil | MNPNLKWKALFIVLVILGCIYGLVGLPTFPTSVAQLKDNFSHQIKLG |
| Ga0210403_104287633 | 3300020580 | Soil | MNPNLKWKALFILLVILWCIYFLIGYPVFPTSVAQMKDNCSKQ |
| Ga0210399_100617591 | 3300020581 | Soil | MNPNLKWKALFILLVILWCIYFLIGYPVFPTSVAQMKDNFSKQIKL |
| Ga0210395_110770822 | 3300020582 | Soil | MNPNLKWKVLFILLVILGCIYGLIGLPTFPTSVADLKNNFSQ |
| Ga0210404_103548211 | 3300021088 | Soil | MNPNLKWKAVFIVVVILGCVYGLFGLPTFPTSTAD |
| Ga0210406_102409693 | 3300021168 | Soil | MNPNLKWKAVFILAVILFCIYFLFGYPTFPTSVAAMKD |
| Ga0210400_103408933 | 3300021170 | Soil | MNPNLKWKALFILLVILGCIYGLMCLPTFPTSLAEL |
| Ga0210400_104804603 | 3300021170 | Soil | MNPNLKWKAVFIVVVILGCIYGLFGLPTFPTSVADLKSN |
| Ga0210393_103678431 | 3300021401 | Soil | MNPNLKWKVIFILAVVVLCVYSIFGMPTFPTSFAQVK |
| Ga0210387_100436225 | 3300021405 | Soil | MTPNLKWKALFILAVILFCIYFLVGYPTFPTSVATIKDNFAHQ |
| Ga0210394_107427253 | 3300021420 | Soil | MNPNLKWRALSVIAIIIFCLYFLVGYPTFPTSFAQVKDNFGRQIKLGL |
| Ga0210394_111627412 | 3300021420 | Soil | MNPNLKWKVVFIVLVILGCIYGLVGLPVFPTSVAQLKDNFSHQIKLGLDLQ |
| Ga0210384_114588901 | 3300021432 | Soil | MNPNLKWKALFILVVILFCIYFLLGLPTFPTSFAQVKDNFSHQIKLGL |
| Ga0210409_108973191 | 3300021559 | Soil | MNPNLKWKALFILAVILACFIGLIGFPAFPPTSLAQL |
| Ga0210409_113449571 | 3300021559 | Soil | MNPNLKWKALFILAVILFCIYFLFGYPVFPTSLAQVKDNFSK |
| Ga0210409_116649702 | 3300021559 | Soil | MNPNLKWKAVFILAVIVFCIYFLFGYPTFPTSTAAVKDNFSKQIKLG |
| Ga0242652_10196231 | 3300022510 | Soil | MNPNLKWKVVFIVLVILGCIYGLVGLPTFPTSVAQLKDNY |
| Ga0242676_10205632 | 3300022512 | Soil | MNPNLKWKALFILSVILLCIYSVIGYPDFPTSLTALKTNFEHQIKLGLDLQPART |
| Ga0242676_10439262 | 3300022512 | Soil | MNPNLKWKALFIVLVILGCIYGLVGLPTFPTSVAQLKDN |
| Ga0242659_10562821 | 3300022522 | Soil | MNLNLKWKFVFIVLVILGCIYGLVGLPTFPTSGAQLK |
| Ga0242655_102943702 | 3300022532 | Soil | MNPNLKWKALFILVVILGCVYGLLGLPTFPTSLAQLKDNLCHQIKLGLDLH |
| Ga0242653_10702322 | 3300022712 | Soil | MNPNLKWKALFILVVILFCIYFLLGLPTFPTSLAQVKDNFSHQIKLGLDLQG |
| Ga0242653_10724211 | 3300022712 | Soil | MNPNLKWKAVFIVAVILFSIYFLFGYPTFPTSMAAVKDNF |
| Ga0242678_10302002 | 3300022715 | Soil | MNPNLKWKALFIVLVILGCIYGLVGLPTFPTSVAQLKDNFSHRIKLG |
| Ga0242672_11222201 | 3300022720 | Soil | MNPNLKWKIIFILAAVLICLYSIFCYPTFPTSFAQ |
| Ga0242665_100220383 | 3300022724 | Soil | MNPNLKWKVLFISLVILGCIYGLIGLPTFPTSVAELKDNFSRQINLVWTCRAART |
| Ga0224550_10143761 | 3300022873 | Soil | MTPNLKYKATFILIVILACIYVLVGYPVFPTSIAQIKD |
| Ga0247670_10641311 | 3300024283 | Soil | MNPNLKWKAVFIVFVILFSIYLLIGYPTFPTSVAQIKDNFGRQIKRGLDL |
| Ga0208687_10765242 | 3300025469 | Peatland | MSPNLKWKALFIAGVILACVYGLLGLPTFPTSLAQVKENFSRQIK |
| Ga0208819_10641991 | 3300025498 | Peatland | MNPNLKWKSLFILGVILICVFFVFGLPTFPTSLAQIKDNFTRQIK |
| Ga0207646_108084331 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MNPNLKWKAVFIIFVILFSIYLLIGYPTFPTSVAQI |
| Ga0209235_12194342 | 3300026296 | Grasslands Soil | MNPNLKWKALFIFAVILFCIYFLFGYPVFPTSVAQVKDNFGKQIKLGLDLQG |
| Ga0209239_10946093 | 3300026310 | Grasslands Soil | MNPNLKWRALFIFAVILFCVYFLFGYPVFPTSVAQVKDN |
| Ga0209268_11825341 | 3300026314 | Soil | MNPNLKWRALFILAVILFCLYFLFGYPTFPTSFAQVKENFAKQIK |
| Ga0209154_10605443 | 3300026317 | Soil | MKPHLKWKALFILVVIVLCIYFLFGYPTFPTSFAQVKDNF |
| Ga0209154_12148553 | 3300026317 | Soil | MNPNVKWKALFIAIVIVFCLYFLFGYPTFPTSLAQVKDNFKRQI |
| Ga0209803_10381371 | 3300026332 | Soil | MNPNLKWKALFIFAVILFCIYFLFGYPVFPTSVAQVK |
| Ga0209158_11527753 | 3300026333 | Soil | MNPNLKWKALFIFAVIVFCIYFLIGYPVFPTSLAQVK |
| Ga0257149_10132951 | 3300026355 | Soil | MNPNLKWKALFIFAVILFCIYFLFGYPVFPTSVAQVKDNFSRQI |
| Ga0257152_10322981 | 3300026369 | Soil | MNPNLKWKALFIFAVILFCIYFLIGYPVFPTSLAQVKDNFS |
| Ga0257154_10564631 | 3300026467 | Soil | MNPNLKWKALFIVLVILGCIYGLVGLPTFPTSVAQFRDNFSHQIKL |
| Ga0209648_102431983 | 3300026551 | Grasslands Soil | MNPNLKWKALFIFAVILFCIYFLVGYPVFPTSLAQVKDNFGKQIKLGLDL |
| Ga0179587_105172383 | 3300026557 | Vadose Zone Soil | MNPNLKWKALFILAVILFCIYFLFGYPVFPTSLAQVK |
| Ga0208983_10269733 | 3300027381 | Forest Soil | MNPNLKWKALFIVAVILVCIYVLIGTPKFPTSIQDIK |
| Ga0209528_11238661 | 3300027610 | Forest Soil | MNPNLKWKALFIVAVILVCIYVLIGTPKFPTSLQDIKDNFSHQIRLGLDL |
| Ga0209106_10557311 | 3300027616 | Forest Soil | MNPNLKWKALFIVAVILVCIYVLIGTPKFPTSIQDIKDNF |
| Ga0209625_10000421 | 3300027635 | Forest Soil | MNPNLKWKALFIVAVILVCIYVLIGTPKFPTSLQDIKD |
| Ga0209076_10832863 | 3300027643 | Vadose Zone Soil | MNPNLKWKAVFIVVVILACVYGLLGLPTFPTSAADVKSNFAHQIKLG |
| Ga0209420_11939022 | 3300027648 | Forest Soil | MNPNLKWKVIFIVLVVVGCIYGLIGLPVFPTSLAQLK |
| Ga0209388_10859173 | 3300027655 | Vadose Zone Soil | MHPNLKWKAVFIVVVILGCIYGLFGVPTFPTSTADLKSNFAHQIKLGLDLQ |
| Ga0209009_10304201 | 3300027667 | Forest Soil | MNPNLKWKALFILAVILFCIYYLIGPPEFPKSFAQVKENFS |
| Ga0209009_10526553 | 3300027667 | Forest Soil | MNPNLKWKALFIVAVILVCIYVLIGTPKFPTSAQDLKDNFDHQIKL |
| Ga0209073_101007361 | 3300027765 | Agricultural Soil | MNPNLKWKALFILAVILFCIYFLFGYPVFPTSLAQVKDNFSKQIK |
| Ga0209112_100303671 | 3300027817 | Forest Soil | MNPNLKWKVIFIVLVVVGCIYGLIGLPVFPTSLAQLKDNFSHQ |
| Ga0209040_101482741 | 3300027824 | Bog Forest Soil | MNPNLKWKVIFIVLVILGCIYGLVGLPTFPTSVAQLKDNFSHQI |
| Ga0209166_102070821 | 3300027857 | Surface Soil | MNPNLKWKALFIAAVILICVYGLIGLPTFPTSVAQIKDNFGKQIKLG |
| Ga0209283_103306981 | 3300027875 | Vadose Zone Soil | MNPNLKWKALFILAVILFCLYFLFGYPTFPTSLAQVKDNFSK |
| Ga0209169_104186711 | 3300027879 | Soil | MNPNLKWKVIFIALVIVGCIYGLIGFPVFPTSIAQIKENFAHQIKLGL |
| Ga0209006_102374441 | 3300027908 | Forest Soil | MTPNLKWKALFILAVILFCIYFLVGYPTFPTSVAT |
| Ga0209583_107356902 | 3300027910 | Watersheds | MNPNLKWKALFIFAVILLCIYSVIGYPNFPTSLTA |
| Ga0209526_104831641 | 3300028047 | Forest Soil | MNPNLKWKALFIVLVILACIYGLVGLPTFPTSVAQLKDNFSHQIKL |
| Ga0137415_100984391 | 3300028536 | Vadose Zone Soil | MNPNLKWKAVFIVVVILGCIYGLFGLPTFPTSVADLKSNFAHQI |
| Ga0302233_103973591 | 3300028746 | Palsa | MNPNLKWKAVAIFVVIVLCIYSLIGFPTFPTSLAQLKE |
| Ga0302219_100362003 | 3300028747 | Palsa | MTPNLKYKVTFILIVVLLCIYVLVGYPTFPTSIAQIKD |
| Ga0307504_100352883 | 3300028792 | Soil | MTSQLKWKVIFIAGVILLCLFGLLGLPDLPTSLAGIKNNFAQRI |
| Ga0302227_102337192 | 3300028795 | Palsa | MNPNLKWKAVAIFVVIVLCIYSLIGFPTFPTSLAQLKENFAHQIKLGLD |
| Ga0302304_102276221 | 3300029993 | Palsa | MNPNLKWKAVAIFVVIVLCIYSLIGFPTFPTSLAQLKENFAHQIKLGL |
| Ga0311372_102379941 | 3300030520 | Palsa | MTPNLKWKALFILAVILGCIVFLIGLPKFPPTSLADIKDNFAHQIKLGLDLQGG |
| Ga0307482_10785383 | 3300030730 | Hardwood Forest Soil | MNPNLKWRALFILFLILFCIYFLLGYPTFPTSVAQVKD |
| Ga0265461_119579981 | 3300030743 | Soil | MNPNLKWKALFIVLVILGCIYGLVGLPTFPTSVAQLKDNFSH |
| Ga0075401_109021071 | 3300030935 | Soil | MNPNLKWKALFILAVILLCIYGLLGLPTFPTSVAQIRDNFSKQIQIPIQ |
| Ga0170824_1073893741 | 3300031231 | Forest Soil | MNPNLKWKALFILFVILFSIYLLIGLPTSPTSVAQIKDNFRHQIK |
| Ga0318534_103705573 | 3300031544 | Soil | MNPNLKWKALFISAVIVFCLYFLFGYPTFPTSYAQVKDN |
| Ga0318541_100231871 | 3300031545 | Soil | MNPNLKWKALFISAVIVFCLYFLFGYPTFPTSYAQVK |
| Ga0307476_101375583 | 3300031715 | Hardwood Forest Soil | MNPNLKFKALFIALVILGCIYGLVGLPTFPTSGAQLKDNFSHRIKLG |
| Ga0307476_102562553 | 3300031715 | Hardwood Forest Soil | MNPNLKWKFVFILLVILGCVYGLVGLPTFPTSVALLKDNFSHQI |
| Ga0307474_112955312 | 3300031718 | Hardwood Forest Soil | MNPNLKWKALFIVAVILVCIYVLIGTPKFPTSVQDIKDNFSHQ |
| Ga0307468_1004805711 | 3300031740 | Hardwood Forest Soil | MNPNLKWKALFILAVILLCIYAVVGYPDFPTSLTALKNNFERQIKLGLDL |
| Ga0307468_1021170442 | 3300031740 | Hardwood Forest Soil | MNPNLKWKVIFIVVVILGCIYGLFGLPTFPTSVADLKSNFAQQIKLGL |
| Ga0307475_100100798 | 3300031754 | Hardwood Forest Soil | MNPNLKWKVLFIVALVLICLYMVVGLPTFPTSPAQVKE |
| Ga0318567_108933702 | 3300031821 | Soil | MNPNLKWKVLFIIAVVLICLYMVVGLPNFPTSLTQIKDNFARQIKLG |
| Ga0307478_100985404 | 3300031823 | Hardwood Forest Soil | MNPNLKWKAVFILAVILFCIYFLFGYPTFPTSVAAMKDNFNKQIK |
| Ga0310917_109371091 | 3300031833 | Soil | MNPNLKWKALFIVAVIVVCIYGLIGLPTFPTSLAQLKSN |
| Ga0318527_105179902 | 3300031859 | Soil | MNPNLKWKALFILAVILLCLYSIIGMPNFPTSLAAIKENFAHQIK |
| Ga0310916_111178642 | 3300031942 | Soil | MNPNLKWKIIFILAAVLICLYSIFCYPTFPTSLAQLKSNFANQIKLGL |
| Ga0214473_112486271 | 3300031949 | Soil | MNPNLKWKVLFIAGVILLCVYGLIGLPEFPTSPAAIKHNF |
| Ga0307479_101346794 | 3300031962 | Hardwood Forest Soil | MNPNLKWKAVFIVVVILGCIYGLFGVPTFPTSAADLKSN |
| Ga0307479_101779684 | 3300031962 | Hardwood Forest Soil | MNPNLKWKVLFIAAVIVFCLYFLFGYPTLPTSFAQVK |
| Ga0307479_108065291 | 3300031962 | Hardwood Forest Soil | MNPNLKWKALFILIVILFCIYFLVGYPVFPTSVAQMKDNFSKQIKLGL |
| Ga0307479_109821393 | 3300031962 | Hardwood Forest Soil | MNPNLKWKALFIVLVILGCIFGLVGLPTFPTSVAQLKDNFSH |
| Ga0318507_101158561 | 3300032025 | Soil | MNPNLKWKAVFIAAVILVCIYGLVGLPNFPTSVAQIKDNFSRQIKLG |
| Ga0307471_1001662811 | 3300032180 | Hardwood Forest Soil | MNPNLKWKALFILAVILLCIYSVIGYPDFPTSLTALKTNFEHQIKLGL |
| Ga0307471_1005046723 | 3300032180 | Hardwood Forest Soil | MNPNLKWKALFIVAVILVCIYVLIGTPKFPTSVQDIKD |
| Ga0307471_1037646821 | 3300032180 | Hardwood Forest Soil | MNPNLKWKVVFIVFVILFSIYLLIGLPTFPTSVAQMK |
| Ga0307472_1002513991 | 3300032205 | Hardwood Forest Soil | MNPNLKWRALSILLIILFCVYYLVGLPDFPKSFAQMKDN |
| Ga0335081_112850981 | 3300032892 | Soil | MNPNLKYRILFIVIVIVGCLYGLFGLPTFPTSLAQL |
| Ga0335071_109177153 | 3300032897 | Soil | MNPNLKWKALFILVAILVCIYAVVGYPNFPTSLSA |
| Ga0335072_105076503 | 3300032898 | Soil | MNPNLKWRAVFIVLVIVGCIYGLIGLPTFPTSLAQIRDNFAHQIKL |
| Ga0299912_105952511 | 3300033489 | Soil | MNPNLKWKFLFIAGVILICIFGLIGTPTSWKHVKDNLGDR |
| ⦗Top⦘ |