Basic Information | |
---|---|
Family ID | F016605 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 246 |
Average Sequence Length | 40 residues |
Representative Sequence | MVEKSELLRVPAFADLPDDQIAWFISQSQELHLKAGDTYA |
Number of Associated Samples | 203 |
Number of Associated Scaffolds | 246 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 99.59 % |
% of genes near scaffold ends (potentially truncated) | 97.97 % |
% of genes from short scaffolds (< 2000 bps) | 89.02 % |
Associated GOLD sequencing projects | 195 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.54 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (97.561 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (15.447 % of family members) |
Environment Ontology (ENVO) | Unclassified (29.268 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (56.504 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 26.47% β-sheet: 0.00% Coil/Unstructured: 73.53% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.54 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 246 Family Scaffolds |
---|---|---|
PF07992 | Pyr_redox_2 | 85.37 |
PF00070 | Pyr_redox | 1.63 |
PF00027 | cNMP_binding | 0.81 |
PF00072 | Response_reg | 0.41 |
PF00294 | PfkB | 0.41 |
PF01977 | UbiD | 0.41 |
PF01070 | FMN_dh | 0.41 |
PF07978 | NIPSNAP | 0.41 |
PF04069 | OpuAC | 0.41 |
PF02148 | zf-UBP | 0.41 |
PF14559 | TPR_19 | 0.41 |
PF04264 | YceI | 0.41 |
PF00903 | Glyoxalase | 0.41 |
PF01571 | GCV_T | 0.41 |
PF10017 | Methyltransf_33 | 0.41 |
COG ID | Name | Functional Category | % Frequency in 246 Family Scaffolds |
---|---|---|---|
COG0043 | 3-polyprenyl-4-hydroxybenzoate decarboxylase | Coenzyme transport and metabolism [H] | 0.41 |
COG0069 | Glutamate synthase domain 2 | Amino acid transport and metabolism [E] | 0.41 |
COG1304 | FMN-dependent dehydrogenase, includes L-lactate dehydrogenase and type II isopentenyl diphosphate isomerase | Energy production and conversion [C] | 0.41 |
COG2353 | Polyisoprenoid-binding periplasmic protein YceI | General function prediction only [R] | 0.41 |
COG5207 | Uncharacterized Zn-finger protein, UBP-type | General function prediction only [R] | 0.41 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 97.56 % |
Unclassified | root | N/A | 2.44 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000650|AP72_2010_repI_A1DRAFT_1017123 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
3300000955|JGI1027J12803_104481883 | All Organisms → cellular organisms → Bacteria | 1078 | Open in IMG/M |
3300001151|JGI12713J13577_1019834 | Not Available | 571 | Open in IMG/M |
3300001471|JGI12712J15308_10056879 | All Organisms → cellular organisms → Bacteria | 991 | Open in IMG/M |
3300001636|JGI20236J16297_102427 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
3300004121|Ga0058882_1632916 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
3300004135|Ga0058884_1343461 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
3300004479|Ga0062595_102625765 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
3300005175|Ga0066673_10562740 | All Organisms → cellular organisms → Bacteria | 667 | Open in IMG/M |
3300005434|Ga0070709_10709673 | All Organisms → cellular organisms → Bacteria | 783 | Open in IMG/M |
3300005440|Ga0070705_101357320 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
3300005541|Ga0070733_10437804 | All Organisms → cellular organisms → Bacteria | 872 | Open in IMG/M |
3300005542|Ga0070732_10358272 | All Organisms → cellular organisms → Bacteria | 878 | Open in IMG/M |
3300005542|Ga0070732_10824839 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
3300005556|Ga0066707_10967600 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
3300005561|Ga0066699_10424090 | All Organisms → cellular organisms → Bacteria | 952 | Open in IMG/M |
3300005602|Ga0070762_10520752 | All Organisms → cellular organisms → Bacteria | 782 | Open in IMG/M |
3300006028|Ga0070717_11729093 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
3300006050|Ga0075028_100148592 | All Organisms → cellular organisms → Bacteria | 1235 | Open in IMG/M |
3300006050|Ga0075028_100823578 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
3300006052|Ga0075029_100611659 | All Organisms → cellular organisms → Bacteria | 729 | Open in IMG/M |
3300006059|Ga0075017_100031589 | All Organisms → cellular organisms → Bacteria | 3491 | Open in IMG/M |
3300006102|Ga0075015_100444861 | All Organisms → cellular organisms → Bacteria | 738 | Open in IMG/M |
3300006102|Ga0075015_100601078 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
3300006163|Ga0070715_10473753 | All Organisms → cellular organisms → Bacteria | 711 | Open in IMG/M |
3300006172|Ga0075018_10004071 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5100 | Open in IMG/M |
3300006176|Ga0070765_100361520 | All Organisms → cellular organisms → Bacteria | 1350 | Open in IMG/M |
3300006755|Ga0079222_10367137 | All Organisms → cellular organisms → Bacteria | 982 | Open in IMG/M |
3300006755|Ga0079222_10872762 | All Organisms → cellular organisms → Bacteria | 749 | Open in IMG/M |
3300006797|Ga0066659_10911118 | All Organisms → cellular organisms → Bacteria | 734 | Open in IMG/M |
3300006806|Ga0079220_10630824 | All Organisms → cellular organisms → Bacteria | 770 | Open in IMG/M |
3300007076|Ga0075435_100070257 | All Organisms → cellular organisms → Bacteria | 2858 | Open in IMG/M |
3300009029|Ga0066793_10538227 | All Organisms → cellular organisms → Bacteria | 667 | Open in IMG/M |
3300009089|Ga0099828_11296946 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
3300009090|Ga0099827_10662936 | All Organisms → cellular organisms → Bacteria | 901 | Open in IMG/M |
3300009520|Ga0116214_1301824 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
3300009635|Ga0116117_1052973 | All Organisms → cellular organisms → Bacteria | 999 | Open in IMG/M |
3300009635|Ga0116117_1109846 | All Organisms → cellular organisms → Bacteria | 694 | Open in IMG/M |
3300009641|Ga0116120_1243852 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
3300009665|Ga0116135_1202487 | All Organisms → cellular organisms → Bacteria | 759 | Open in IMG/M |
3300009759|Ga0116101_1016624 | All Organisms → cellular organisms → Bacteria | 1405 | Open in IMG/M |
3300010046|Ga0126384_10579378 | All Organisms → cellular organisms → Bacteria | 979 | Open in IMG/M |
3300010048|Ga0126373_10453626 | All Organisms → cellular organisms → Bacteria | 1317 | Open in IMG/M |
3300010301|Ga0134070_10278702 | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
3300010335|Ga0134063_10252556 | All Organisms → cellular organisms → Bacteria | 839 | Open in IMG/M |
3300010343|Ga0074044_11082175 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
3300010360|Ga0126372_12545158 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
3300010360|Ga0126372_13078166 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
3300010361|Ga0126378_10119819 | All Organisms → cellular organisms → Bacteria | 2634 | Open in IMG/M |
3300010361|Ga0126378_11626499 | All Organisms → cellular organisms → Bacteria | 733 | Open in IMG/M |
3300010361|Ga0126378_11925704 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
3300010373|Ga0134128_13022451 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
3300010379|Ga0136449_101407177 | All Organisms → cellular organisms → Bacteria | 1076 | Open in IMG/M |
3300010396|Ga0134126_10043868 | All Organisms → cellular organisms → Bacteria | 5624 | Open in IMG/M |
3300010858|Ga0126345_1055085 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
3300010876|Ga0126361_10631153 | All Organisms → cellular organisms → Bacteria | 725 | Open in IMG/M |
3300012189|Ga0137388_10647705 | All Organisms → cellular organisms → Bacteria | 982 | Open in IMG/M |
3300012199|Ga0137383_10587317 | All Organisms → cellular organisms → Bacteria | 815 | Open in IMG/M |
3300012201|Ga0137365_10432246 | All Organisms → cellular organisms → Bacteria | 970 | Open in IMG/M |
3300012202|Ga0137363_10103004 | All Organisms → cellular organisms → Bacteria | 2173 | Open in IMG/M |
3300012202|Ga0137363_10121481 | All Organisms → cellular organisms → Bacteria | 2016 | Open in IMG/M |
3300012207|Ga0137381_10899301 | All Organisms → cellular organisms → Bacteria | 765 | Open in IMG/M |
3300012361|Ga0137360_10078051 | All Organisms → cellular organisms → Bacteria | 2474 | Open in IMG/M |
3300012361|Ga0137360_10516687 | All Organisms → cellular organisms → Bacteria | 1018 | Open in IMG/M |
3300012925|Ga0137419_11916822 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
3300012955|Ga0164298_11446639 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
3300012960|Ga0164301_10563207 | All Organisms → cellular organisms → Bacteria | 834 | Open in IMG/M |
3300012985|Ga0164308_10274083 | All Organisms → cellular organisms → Bacteria | 1327 | Open in IMG/M |
3300013296|Ga0157374_10570791 | All Organisms → cellular organisms → Bacteria | 1140 | Open in IMG/M |
3300013307|Ga0157372_10797439 | All Organisms → cellular organisms → Bacteria | 1097 | Open in IMG/M |
3300013307|Ga0157372_12004147 | All Organisms → cellular organisms → Bacteria | 665 | Open in IMG/M |
3300014155|Ga0181524_10083374 | Not Available | 1846 | Open in IMG/M |
3300014200|Ga0181526_10797188 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
3300014501|Ga0182024_11270595 | All Organisms → cellular organisms → Bacteria | 856 | Open in IMG/M |
3300014654|Ga0181525_10682387 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
3300015052|Ga0137411_1075637 | All Organisms → cellular organisms → Bacteria | 1650 | Open in IMG/M |
3300015372|Ga0132256_101395439 | All Organisms → cellular organisms → Bacteria | 812 | Open in IMG/M |
3300016387|Ga0182040_11731334 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
3300016445|Ga0182038_11771878 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
3300017930|Ga0187825_10394976 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
3300017935|Ga0187848_10161259 | All Organisms → cellular organisms → Bacteria | 982 | Open in IMG/M |
3300017943|Ga0187819_10305633 | All Organisms → cellular organisms → Bacteria | 924 | Open in IMG/M |
3300017943|Ga0187819_10738969 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
3300017946|Ga0187879_10682450 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
3300017947|Ga0187785_10100544 | All Organisms → cellular organisms → Bacteria | 1156 | Open in IMG/M |
3300017961|Ga0187778_10955772 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
3300017994|Ga0187822_10136418 | All Organisms → cellular organisms → Bacteria | 778 | Open in IMG/M |
3300017995|Ga0187816_10152970 | All Organisms → cellular organisms → Bacteria | 998 | Open in IMG/M |
3300018006|Ga0187804_10018567 | All Organisms → cellular organisms → Bacteria | 2500 | Open in IMG/M |
3300018016|Ga0187880_1328567 | All Organisms → cellular organisms → Bacteria | 653 | Open in IMG/M |
3300018020|Ga0187861_10347411 | All Organisms → cellular organisms → Bacteria | 628 | Open in IMG/M |
3300018043|Ga0187887_10623100 | All Organisms → cellular organisms → Bacteria | 637 | Open in IMG/M |
3300018043|Ga0187887_10942678 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
3300018088|Ga0187771_11787555 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
3300018090|Ga0187770_11022601 | All Organisms → cellular organisms → Bacteria | 665 | Open in IMG/M |
3300018431|Ga0066655_10275380 | All Organisms → cellular organisms → Bacteria | 1087 | Open in IMG/M |
3300018431|Ga0066655_11419879 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
3300019788|Ga0182028_1402050 | All Organisms → cellular organisms → Bacteria | 1557 | Open in IMG/M |
3300019870|Ga0193746_1007371 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 1071 | Open in IMG/M |
3300019885|Ga0193747_1094100 | All Organisms → cellular organisms → Bacteria | 730 | Open in IMG/M |
3300020021|Ga0193726_1007678 | All Organisms → cellular organisms → Bacteria | 6097 | Open in IMG/M |
3300020034|Ga0193753_10275719 | All Organisms → cellular organisms → Bacteria | 735 | Open in IMG/M |
3300020579|Ga0210407_10026440 | All Organisms → cellular organisms → Bacteria | 4315 | Open in IMG/M |
3300020579|Ga0210407_10427868 | All Organisms → cellular organisms → Bacteria | 1036 | Open in IMG/M |
3300020579|Ga0210407_10572078 | All Organisms → cellular organisms → Bacteria | 881 | Open in IMG/M |
3300020579|Ga0210407_11061556 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
3300020580|Ga0210403_10092972 | All Organisms → cellular organisms → Bacteria | 2441 | Open in IMG/M |
3300020581|Ga0210399_10448409 | All Organisms → cellular organisms → Bacteria | 1075 | Open in IMG/M |
3300020581|Ga0210399_10681192 | All Organisms → cellular organisms → Bacteria | 846 | Open in IMG/M |
3300020581|Ga0210399_10692984 | All Organisms → cellular organisms → Bacteria | 838 | Open in IMG/M |
3300020581|Ga0210399_10906902 | All Organisms → cellular organisms → Bacteria | 714 | Open in IMG/M |
3300020582|Ga0210395_10834728 | All Organisms → cellular organisms → Bacteria | 686 | Open in IMG/M |
3300020583|Ga0210401_10838250 | All Organisms → cellular organisms → Bacteria | 779 | Open in IMG/M |
3300021086|Ga0179596_10112966 | All Organisms → cellular organisms → Bacteria | 1250 | Open in IMG/M |
3300021088|Ga0210404_10635127 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
3300021168|Ga0210406_11190936 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
3300021171|Ga0210405_10818860 | All Organisms → cellular organisms → Bacteria | 712 | Open in IMG/M |
3300021171|Ga0210405_11112642 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
3300021180|Ga0210396_10028174 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 5196 | Open in IMG/M |
3300021180|Ga0210396_10367215 | All Organisms → cellular organisms → Bacteria | 1268 | Open in IMG/M |
3300021180|Ga0210396_10818368 | All Organisms → cellular organisms → Bacteria | 798 | Open in IMG/M |
3300021181|Ga0210388_11726532 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
3300021401|Ga0210393_10058428 | All Organisms → cellular organisms → Bacteria | 3037 | Open in IMG/M |
3300021402|Ga0210385_10219915 | All Organisms → cellular organisms → Bacteria | 1386 | Open in IMG/M |
3300021402|Ga0210385_11280004 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
3300021404|Ga0210389_10218893 | All Organisms → cellular organisms → Bacteria | 1486 | Open in IMG/M |
3300021405|Ga0210387_11485736 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
3300021405|Ga0210387_11684618 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
3300021420|Ga0210394_11263405 | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
3300021420|Ga0210394_11483689 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
3300021432|Ga0210384_11067755 | All Organisms → cellular organisms → Bacteria | 710 | Open in IMG/M |
3300021432|Ga0210384_11873426 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
3300021433|Ga0210391_11101228 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
3300021475|Ga0210392_10512703 | All Organisms → cellular organisms → Bacteria | 884 | Open in IMG/M |
3300021478|Ga0210402_10473723 | All Organisms → cellular organisms → Bacteria | 1163 | Open in IMG/M |
3300021479|Ga0210410_10330182 | All Organisms → cellular organisms → Bacteria | 1368 | Open in IMG/M |
3300021560|Ga0126371_12816092 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
3300021857|Ga0213849_1160680 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
3300022515|Ga0224546_1014040 | All Organisms → cellular organisms → Bacteria | 660 | Open in IMG/M |
3300022557|Ga0212123_10224110 | All Organisms → cellular organisms → Bacteria | 1371 | Open in IMG/M |
3300022557|Ga0212123_10662998 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
3300024227|Ga0228598_1093472 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
3300024271|Ga0224564_1113190 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
3300025412|Ga0208194_1006523 | All Organisms → cellular organisms → Bacteria | 2034 | Open in IMG/M |
3300025434|Ga0208690_1060351 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
3300025898|Ga0207692_10122552 | All Organisms → cellular organisms → Bacteria | 1458 | Open in IMG/M |
3300025904|Ga0207647_10034400 | All Organisms → cellular organisms → Bacteria | 3235 | Open in IMG/M |
3300025915|Ga0207693_10750888 | All Organisms → cellular organisms → Bacteria | 754 | Open in IMG/M |
3300025917|Ga0207660_10132990 | All Organisms → cellular organisms → Bacteria | 1895 | Open in IMG/M |
3300025917|Ga0207660_11251012 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
3300025920|Ga0207649_10278534 | All Organisms → cellular organisms → Bacteria | 1215 | Open in IMG/M |
3300025922|Ga0207646_11085405 | All Organisms → cellular organisms → Bacteria | 705 | Open in IMG/M |
3300025922|Ga0207646_11508711 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
3300025928|Ga0207700_10750655 | All Organisms → cellular organisms → Bacteria | 872 | Open in IMG/M |
3300025929|Ga0207664_10443446 | All Organisms → cellular organisms → Bacteria | 1158 | Open in IMG/M |
3300025936|Ga0207670_10724663 | All Organisms → cellular organisms → Bacteria | 825 | Open in IMG/M |
3300025944|Ga0207661_11798661 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
3300026041|Ga0207639_10897191 | All Organisms → cellular organisms → Bacteria | 828 | Open in IMG/M |
3300026291|Ga0209890_10122025 | All Organisms → cellular organisms → Bacteria | 887 | Open in IMG/M |
3300026328|Ga0209802_1173595 | All Organisms → cellular organisms → Bacteria | 876 | Open in IMG/M |
3300026527|Ga0209059_1217046 | All Organisms → cellular organisms → Bacteria | 643 | Open in IMG/M |
3300026538|Ga0209056_10360879 | All Organisms → cellular organisms → Bacteria | 943 | Open in IMG/M |
3300026551|Ga0209648_10189973 | All Organisms → cellular organisms → Bacteria | 1580 | Open in IMG/M |
3300027076|Ga0208860_1022823 | All Organisms → cellular organisms → Bacteria | 638 | Open in IMG/M |
3300027110|Ga0208488_1007929 | All Organisms → cellular organisms → Bacteria | 2150 | Open in IMG/M |
3300027432|Ga0209421_1127800 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
3300027497|Ga0208199_1129341 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
3300027516|Ga0207761_1021718 | All Organisms → cellular organisms → Bacteria | 1289 | Open in IMG/M |
3300027567|Ga0209115_1050473 | All Organisms → cellular organisms → Bacteria | 948 | Open in IMG/M |
3300027591|Ga0209733_1091123 | All Organisms → cellular organisms → Bacteria | 775 | Open in IMG/M |
3300027610|Ga0209528_1092775 | All Organisms → cellular organisms → Bacteria | 667 | Open in IMG/M |
3300027648|Ga0209420_1013887 | All Organisms → cellular organisms → Bacteria | 2750 | Open in IMG/M |
3300027652|Ga0209007_1110510 | All Organisms → cellular organisms → Bacteria | 689 | Open in IMG/M |
3300027674|Ga0209118_1067710 | All Organisms → cellular organisms → Bacteria | 1033 | Open in IMG/M |
3300027692|Ga0209530_1191788 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
3300027706|Ga0209581_1264552 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
3300027706|Ga0209581_1282145 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
3300027738|Ga0208989_10102126 | All Organisms → cellular organisms → Bacteria | 976 | Open in IMG/M |
3300027748|Ga0209689_1151012 | All Organisms → cellular organisms → Bacteria | 1114 | Open in IMG/M |
3300027795|Ga0209139_10242454 | All Organisms → cellular organisms → Bacteria | 637 | Open in IMG/M |
3300027812|Ga0209656_10156189 | All Organisms → cellular organisms → Bacteria | 1139 | Open in IMG/M |
3300027821|Ga0209811_10118823 | All Organisms → cellular organisms → Bacteria | 962 | Open in IMG/M |
3300027821|Ga0209811_10309278 | All Organisms → cellular organisms → Bacteria | 609 | Open in IMG/M |
3300027824|Ga0209040_10104584 | All Organisms → cellular organisms → Bacteria | 1597 | Open in IMG/M |
3300027825|Ga0209039_10258178 | All Organisms → cellular organisms → Bacteria | 694 | Open in IMG/M |
3300027826|Ga0209060_10244759 | All Organisms → cellular organisms → Bacteria | 822 | Open in IMG/M |
3300027842|Ga0209580_10135071 | All Organisms → cellular organisms → Bacteria | 1208 | Open in IMG/M |
3300027842|Ga0209580_10528869 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
3300027857|Ga0209166_10000466 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 45166 | Open in IMG/M |
3300027867|Ga0209167_10587672 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
3300027869|Ga0209579_10265481 | All Organisms → cellular organisms → Bacteria | 923 | Open in IMG/M |
3300027869|Ga0209579_10302682 | All Organisms → cellular organisms → Bacteria | 862 | Open in IMG/M |
3300027875|Ga0209283_10419446 | All Organisms → cellular organisms → Bacteria | 870 | Open in IMG/M |
3300027879|Ga0209169_10097220 | Not Available | 1524 | Open in IMG/M |
3300027889|Ga0209380_10009405 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae | 5732 | Open in IMG/M |
3300027889|Ga0209380_10211070 | All Organisms → cellular organisms → Bacteria | 1140 | Open in IMG/M |
3300027889|Ga0209380_10342929 | All Organisms → cellular organisms → Bacteria | 877 | Open in IMG/M |
3300027895|Ga0209624_11004176 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
3300027898|Ga0209067_10244744 | All Organisms → cellular organisms → Bacteria | 974 | Open in IMG/M |
3300027903|Ga0209488_11178171 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
3300027908|Ga0209006_10105665 | All Organisms → cellular organisms → Bacteria | 2494 | Open in IMG/M |
3300027911|Ga0209698_10675676 | All Organisms → cellular organisms → Bacteria | 788 | Open in IMG/M |
3300028381|Ga0268264_11036229 | All Organisms → cellular organisms → Bacteria | 828 | Open in IMG/M |
3300028759|Ga0302224_10269041 | All Organisms → cellular organisms → Bacteria | 682 | Open in IMG/M |
3300029636|Ga0222749_10222136 | All Organisms → cellular organisms → Bacteria | 952 | Open in IMG/M |
3300029882|Ga0311368_10806109 | All Organisms → cellular organisms → Bacteria | 639 | Open in IMG/M |
3300029910|Ga0311369_11391503 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
3300029922|Ga0311363_11212099 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
3300029993|Ga0302304_10290773 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
3300030011|Ga0302270_10547543 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
3300030509|Ga0302183_10212498 | All Organisms → cellular organisms → Bacteria | 754 | Open in IMG/M |
3300030617|Ga0311356_11827949 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
3300030618|Ga0311354_10485198 | All Organisms → cellular organisms → Bacteria | 1226 | Open in IMG/M |
3300030730|Ga0307482_1186068 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
3300030737|Ga0302310_10190417 | All Organisms → cellular organisms → Bacteria | 1206 | Open in IMG/M |
3300030739|Ga0302311_10567331 | All Organisms → cellular organisms → Bacteria | 769 | Open in IMG/M |
3300030923|Ga0138296_1457517 | All Organisms → cellular organisms → Bacteria | 957 | Open in IMG/M |
3300031233|Ga0302307_10181609 | All Organisms → cellular organisms → Bacteria | 1088 | Open in IMG/M |
3300031258|Ga0302318_10234475 | All Organisms → cellular organisms → Bacteria | 895 | Open in IMG/M |
3300031525|Ga0302326_11440110 | All Organisms → cellular organisms → Bacteria | 927 | Open in IMG/M |
3300031525|Ga0302326_13454470 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
3300031590|Ga0307483_1020755 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
3300031708|Ga0310686_104190031 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
3300031715|Ga0307476_10004119 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → unclassified Granulicella → Granulicella sp. GAS466 | 8727 | Open in IMG/M |
3300031715|Ga0307476_10085093 | All Organisms → cellular organisms → Bacteria | 2212 | Open in IMG/M |
3300031715|Ga0307476_10373200 | All Organisms → cellular organisms → Bacteria | 1052 | Open in IMG/M |
3300031718|Ga0307474_10572153 | All Organisms → cellular organisms → Bacteria | 889 | Open in IMG/M |
3300031754|Ga0307475_10417064 | All Organisms → cellular organisms → Bacteria | 1079 | Open in IMG/M |
3300031820|Ga0307473_10515248 | All Organisms → cellular organisms → Bacteria | 810 | Open in IMG/M |
3300031879|Ga0306919_10990763 | All Organisms → cellular organisms → Bacteria | 643 | Open in IMG/M |
3300032041|Ga0318549_10327713 | All Organisms → cellular organisms → Bacteria | 690 | Open in IMG/M |
3300032059|Ga0318533_10481337 | All Organisms → cellular organisms → Bacteria | 909 | Open in IMG/M |
3300032076|Ga0306924_11520689 | All Organisms → cellular organisms → Bacteria | 709 | Open in IMG/M |
3300032126|Ga0307415_100482773 | All Organisms → cellular organisms → Bacteria | 1079 | Open in IMG/M |
3300032160|Ga0311301_11821909 | All Organisms → cellular organisms → Bacteria | 723 | Open in IMG/M |
3300032180|Ga0307471_100239275 | All Organisms → cellular organisms → Bacteria | 1857 | Open in IMG/M |
3300032180|Ga0307471_100549631 | All Organisms → cellular organisms → Bacteria | 1309 | Open in IMG/M |
3300032180|Ga0307471_100721446 | All Organisms → cellular organisms → Bacteria | 1162 | Open in IMG/M |
3300032180|Ga0307471_102194152 | All Organisms → cellular organisms → Bacteria | 695 | Open in IMG/M |
3300032205|Ga0307472_101091522 | All Organisms → cellular organisms → Bacteria | 754 | Open in IMG/M |
3300033289|Ga0310914_10277930 | All Organisms → cellular organisms → Bacteria | 1508 | Open in IMG/M |
3300033412|Ga0310810_10217594 | All Organisms → cellular organisms → Bacteria | 2138 | Open in IMG/M |
3300033513|Ga0316628_102630744 | All Organisms → cellular organisms → Bacteria | 663 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 15.45% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 7.32% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.10% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 5.69% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 5.28% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 4.88% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.06% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 3.66% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.66% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.66% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.25% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 2.85% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 2.44% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.44% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.44% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.22% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.22% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.22% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.22% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.63% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.63% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.63% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.63% |
Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 0.41% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.41% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.41% |
Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.41% |
Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 0.41% |
Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 0.41% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.41% |
Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.41% |
Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.41% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.41% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.41% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.41% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.41% |
Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.41% |
Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.41% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.41% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.41% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.41% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.41% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.41% |
Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.81% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.81% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.81% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.81% |
Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.81% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.81% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.81% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.81% |
Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.81% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000650 | Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A1 | Environmental | Open in IMG/M |
3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300001151 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O3 | Environmental | Open in IMG/M |
3300001471 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 | Environmental | Open in IMG/M |
3300001636 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF002 | Environmental | Open in IMG/M |
3300004121 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF109 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300004135 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF204 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
3300005952 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-045 | Environmental | Open in IMG/M |
3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
3300009029 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 1 DNA2013-189 | Environmental | Open in IMG/M |
3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
3300009635 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_10 | Environmental | Open in IMG/M |
3300009641 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_150 | Environmental | Open in IMG/M |
3300009665 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 | Environmental | Open in IMG/M |
3300009759 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_10 | Environmental | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015 | Environmental | Open in IMG/M |
3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
3300010858 | Boreal forest soil eukaryotic communities from Alaska, USA - C3-2 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300010876 | Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
3300014155 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_60_metaG | Environmental | Open in IMG/M |
3300014200 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaG | Environmental | Open in IMG/M |
3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300014654 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaG | Environmental | Open in IMG/M |
3300015052 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
3300017930 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5 | Environmental | Open in IMG/M |
3300017935 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_40 | Environmental | Open in IMG/M |
3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
3300017947 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG | Environmental | Open in IMG/M |
3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
3300017994 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2 | Environmental | Open in IMG/M |
3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
3300018016 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_40 | Environmental | Open in IMG/M |
3300018020 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_100 | Environmental | Open in IMG/M |
3300018043 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10 | Environmental | Open in IMG/M |
3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
3300019788 | Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (PacBio error correction) | Environmental | Open in IMG/M |
3300019870 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1m1 | Environmental | Open in IMG/M |
3300019885 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1m2 | Environmental | Open in IMG/M |
3300020021 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c1 | Environmental | Open in IMG/M |
3300020034 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1c2 | Environmental | Open in IMG/M |
3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300021857 | Metatranscriptome of freshwater microbial communities from pre-fracked creek in Pennsylvania, United States - WE:C (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300022515 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P2 1-5 | Environmental | Open in IMG/M |
3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Host-Associated | Open in IMG/M |
3300024271 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSU5 | Environmental | Open in IMG/M |
3300025412 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10 (SPAdes) | Environmental | Open in IMG/M |
3300025434 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_10 (SPAdes) | Environmental | Open in IMG/M |
3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026291 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049 (SPAdes) | Environmental | Open in IMG/M |
3300026328 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes) | Environmental | Open in IMG/M |
3300026527 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 (SPAdes) | Environmental | Open in IMG/M |
3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
3300027076 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF012 (SPAdes) | Environmental | Open in IMG/M |
3300027110 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF001 (SPAdes) | Environmental | Open in IMG/M |
3300027432 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O2 (SPAdes) | Environmental | Open in IMG/M |
3300027497 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG (SPAdes) | Environmental | Open in IMG/M |
3300027516 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 34 (SPAdes) | Environmental | Open in IMG/M |
3300027567 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O2 (SPAdes) | Environmental | Open in IMG/M |
3300027591 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027610 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027648 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O1 (SPAdes) | Environmental | Open in IMG/M |
3300027652 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O2 (SPAdes) | Environmental | Open in IMG/M |
3300027674 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027692 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O1 (SPAdes) | Environmental | Open in IMG/M |
3300027706 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen15_06102014_R2 (SPAdes) | Environmental | Open in IMG/M |
3300027738 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027748 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes) | Environmental | Open in IMG/M |
3300027795 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM3 (SPAdes) | Environmental | Open in IMG/M |
3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
3300027821 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027824 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes) | Environmental | Open in IMG/M |
3300027825 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 (SPAdes) | Environmental | Open in IMG/M |
3300027826 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027857 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
3300027898 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes) | Environmental | Open in IMG/M |
3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028759 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_1 | Environmental | Open in IMG/M |
3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300029882 | III_Palsa_E1 coassembly | Environmental | Open in IMG/M |
3300029910 | III_Palsa_E2 coassembly | Environmental | Open in IMG/M |
3300029922 | III_Fen_E1 coassembly | Environmental | Open in IMG/M |
3300029993 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E2_2 | Environmental | Open in IMG/M |
3300030011 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_E2_3 | Environmental | Open in IMG/M |
3300030509 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_2 | Environmental | Open in IMG/M |
3300030617 | II_Palsa_N2 coassembly | Environmental | Open in IMG/M |
3300030618 | II_Palsa_E3 coassembly | Environmental | Open in IMG/M |
3300030730 | Metatranscriptome of hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030737 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_2 | Environmental | Open in IMG/M |
3300030739 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_3 | Environmental | Open in IMG/M |
3300030923 | Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A3_MS_autumn Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300031233 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_2 | Environmental | Open in IMG/M |
3300031258 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_1 | Environmental | Open in IMG/M |
3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
3300031590 | Metatranscriptome of hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
3300032041 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22 | Environmental | Open in IMG/M |
3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Host-Associated | Open in IMG/M |
3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
3300033513 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_C | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
AP72_2010_repI_A1DRAFT_10171232 | 3300000650 | Forest Soil | MAEARELLRRVPVFADTPDDQIEWFLSESQDVLLKAG |
JGI1027J12803_1044818832 | 3300000955 | Soil | MVESSELLRLPVFADLPEDQIAWFIGQSQELALKPD |
JGI12713J13577_10198341 | 3300001151 | Forest Soil | MVDKSELRRAPVFADLPDDQLDWFLANSQELRLTEGDTY |
JGI12712J15308_100568791 | 3300001471 | Forest Soil | MTENSELLRAPAFAGLPDDQLTWFISQGEELHMKA |
JGI20236J16297_1024272 | 3300001636 | Forest Soil | MVEKSELLRVPVFADLPDDQLDWFISQSEELHLKAGEGYAR |
Ga0058882_16329162 | 3300004121 | Forest Soil | MANKSELLGVPAFADLPDDQIEWFLTQALEIHAKPGDAYYHQ |
Ga0058884_13434612 | 3300004135 | Forest Soil | MVEKSELLRVPVFADLPDDQLDWFISQSQEMNLKAGDTYSR |
Ga0062595_1026257651 | 3300004479 | Soil | MVEKSELRKVAAFAGLPDDQLDWFLSQSQELLLKSGDISVR |
Ga0066673_105627401 | 3300005175 | Soil | MATKAELLKVPVFADLPDDQVEWFLSQAPELPLKAGEVYF |
Ga0070709_107096731 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MVEKSELRKVAAFAGLPDDQLDWFLSQSQELLLKSGDISVRQ |
Ga0070705_1013573202 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | MIDKSELLRVPVFADLPEDQIAWFLSQTQDVRLKPGDIYMRV |
Ga0070733_104378041 | 3300005541 | Surface Soil | MVEKSDLRAVPAFADLPDDQLDWFLANSQELQVTAGD |
Ga0070732_103582722 | 3300005542 | Surface Soil | MAEAAELLRVNAFAGLPGDQIAWFLSQAQELHFKGGETF |
Ga0070732_108248391 | 3300005542 | Surface Soil | MAETSELLRRVPAFLDLPDDQITWFLSQSQELHLSPGDTY |
Ga0066707_109676002 | 3300005556 | Soil | MIEKSELLRVPAFADLPDDQISWFLSQSQEMHLKAGET |
Ga0066699_104240902 | 3300005561 | Soil | MAEKSELLRIPVFADVPDDQLEWFLSQCQEEFLKPGDTYV |
Ga0070762_105207522 | 3300005602 | Soil | MVENSELLRVPIFADLPDDQIAWFISQSQELHLKAG |
Ga0080026_100545721 | 3300005952 | Permafrost Soil | MVEDSELLKVPAFAGLPDYQIAWFISQSKEMNMVAGDMAFRQDDPADAMYV |
Ga0070717_117290932 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MVDKAELRGVSAFADLPDDQLDWFLGHSQEVRVATGETYVRQ |
Ga0075028_1001485921 | 3300006050 | Watersheds | MMEKAELHRIPVFADLPDDQIEWFLSQAEDLQFKAGDILI |
Ga0075028_1008235782 | 3300006050 | Watersheds | MVDKSELLRVPVFADLPDDQIVWFISQSQELRLKAGDT |
Ga0075029_1006116592 | 3300006052 | Watersheds | MVETSDLLRRVPVFEGLPDDQIAWFLSQSQEMRLKAGDVY |
Ga0075017_1000315891 | 3300006059 | Watersheds | MVEKSELLRVPVFADLPDDQIEWFLSQSEEMLFKA |
Ga0075015_1004448611 | 3300006102 | Watersheds | MIEKSELLRVPAFADLPDDQITWFLSQSQELVVKAGDT |
Ga0075015_1006010782 | 3300006102 | Watersheds | MVEKSELRAVPAFADSSDDQLDWFIGQAQEIRFQAGDTYLRAG |
Ga0070715_104737532 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | MAEKSELLRIPVFADVPDDQLEWFLSQCQEEFLKPGDTYVQQGDPAEN |
Ga0075018_100040714 | 3300006172 | Watersheds | MIENAKLLNVPVFVGLPEDQITWFISQSEELVFKAGD |
Ga0070765_1003615202 | 3300006176 | Soil | MVTPSELSRFPAFADLPDDQIAWFLGQSQEKSLKAGEIY |
Ga0079222_103671372 | 3300006755 | Agricultural Soil | MVEKSELLHVPVFADLPDDQIDWFISQSQELHIKEGE |
Ga0079222_108727621 | 3300006755 | Agricultural Soil | MIDKSELIRLPVFADLPDDQLAWFLSQTLDVQLKAG |
Ga0066659_109111181 | 3300006797 | Soil | MVDKSELLRVPAFADLPDDQIAWFLSQAQETHIKA |
Ga0079220_106308241 | 3300006806 | Agricultural Soil | MVDKSELRGVPAFADLPDDQLNWFLAHSQEILVGAADVDQ |
Ga0075435_1000702571 | 3300007076 | Populus Rhizosphere | MATSQELLQVPAFAGLPDDQIAWFLSQSKEVSLKAGEI |
Ga0066793_105382271 | 3300009029 | Prmafrost Soil | MVDNSELLLVPAFIDLPVDQIAWFISQAQELRYKAGDTY |
Ga0099828_112969462 | 3300009089 | Vadose Zone Soil | MADKAELLRVPAFADLPEDQIEWFLSQCQEQILKPGDTY |
Ga0099827_106629362 | 3300009090 | Vadose Zone Soil | MVEKSELIRVPAFADLPDDQLDWFLNQAQELHLKAGETYLRAGDPANAMF |
Ga0116214_13018241 | 3300009520 | Peatlands Soil | MADKSELLRVPVFADLPDDQIAWFLSQAQELNYKAG |
Ga0116117_10529732 | 3300009635 | Peatland | MIEKSELLEAPAFAGLPDDQIAWFISQSEELLFKAG |
Ga0116117_11098462 | 3300009635 | Peatland | MAEIAELKRVSLFADQPDDQIAWFLSQSQEMHLKAGET |
Ga0116120_12438522 | 3300009641 | Peatland | MVDKSELLRVPAFADLPDDQLNWFISQSQELNLKAGDVYSR |
Ga0116135_12024871 | 3300009665 | Peatland | MVEESELLRIPAFADLPNDQIAWFLSQSQELHVKAGDTYALQG |
Ga0116101_10166242 | 3300009759 | Peatland | MADTSELLRKVPAFEGLPDDQIAWFLSKAQEIRLKAGEAY |
Ga0126384_105793781 | 3300010046 | Tropical Forest Soil | MVETSELLRLPLFEGLPADQIAWFISQSQELALKP |
Ga0126373_104536262 | 3300010048 | Tropical Forest Soil | MTNSTELLRVPTFADLPEDQIAWFLSQSQEVNLKAGDVYA |
Ga0134070_102787022 | 3300010301 | Grasslands Soil | MIDKSELIRVPAFADLPEEQIAWFLSQSQEVHLKAGD |
Ga0134063_102525561 | 3300010335 | Grasslands Soil | MIEKSELLRVPVFVDLPDDQIAWFLSEVQELRLQAGETYL |
Ga0074044_110821752 | 3300010343 | Bog Forest Soil | MVEKSELLLVPAVADLPEDQIAGFISQAQELRYKAGDTYLRP |
Ga0126372_125451581 | 3300010360 | Tropical Forest Soil | MATAEELLRFPTFAELPEDQIAWFLSQSEEVNLKTGEVY |
Ga0126372_130781662 | 3300010360 | Tropical Forest Soil | MVDKSELRRVPAFADLPDDQLDWFLGHTQEMHLAVG |
Ga0126378_101198193 | 3300010361 | Tropical Forest Soil | MVSPSELERLPVFADLPADQIAWFLEQAREIHLKAGETYTR |
Ga0126378_116264992 | 3300010361 | Tropical Forest Soil | MAEILELLRQVPVFAGIPDDQMAWFLGNSQELHLAPGDFYARQ |
Ga0126378_119257042 | 3300010361 | Tropical Forest Soil | MVESSELLRVPVFADLPNEQISWFISQSHELVLEPDEI |
Ga0134128_130224511 | 3300010373 | Terrestrial Soil | MIQKSELLKVPVFADLPDDQIAWFLSQSEEIRLSVGETYVRQ |
Ga0136449_1014071772 | 3300010379 | Peatlands Soil | MAEAAELLQVPAFAGLPDDQIAWFLSQAQELCVKRGE |
Ga0134126_100438681 | 3300010396 | Terrestrial Soil | MVEKSELLMVPVFSDLPDDQIAWFLSQSEEVRLAVGETYVR |
Ga0126345_10550852 | 3300010858 | Boreal Forest Soil | MVEKSELIRVLAFADLPDDQLAWFLSQSQELHLKAGETYLRAGDPANA |
Ga0126361_106311531 | 3300010876 | Boreal Forest Soil | MVETSELLRVPVFADLPDDQLAWFLSQSQELHLKA |
Ga0137388_106477051 | 3300012189 | Vadose Zone Soil | MVEKSELRRVTEFADLPDDQLDWFISQSQEMNLKAG |
Ga0137383_105873172 | 3300012199 | Vadose Zone Soil | MINKSELLRVPTFADLPDDQLEWFLSQSHEQLLKPGDTYIR |
Ga0137365_104322462 | 3300012201 | Vadose Zone Soil | MAEALELLRKVPVFSDIPDDQIAWFMSQSRELRLEAGNTYVRQG |
Ga0137363_101030043 | 3300012202 | Vadose Zone Soil | MVDKSELLRVPAFADLPDYLIAWFLSQAQETPIKACDTFVRQ |
Ga0137363_101214811 | 3300012202 | Vadose Zone Soil | MIEKSELLHVPTFADLPDEQLEWFLSQCQEQLLQPGDT |
Ga0137381_108993012 | 3300012207 | Vadose Zone Soil | MVDKSELLRVPAFADLPEDQVAWFLSNSEEVRVAAGDT* |
Ga0137360_100780514 | 3300012361 | Vadose Zone Soil | MTDKSELLHVPVFADLPDDQIAWFLGQSQEVHIKAG |
Ga0137360_105166871 | 3300012361 | Vadose Zone Soil | MVDKSELLRVPAFADLPDDQIAWFLGHSQEVRLAAGDI |
Ga0137419_119168222 | 3300012925 | Vadose Zone Soil | MIAKSELLRVPAFADLPDDQITWFLSQSQEMHLKA |
Ga0164298_114466392 | 3300012955 | Soil | MVEKSELLQVPVFADLPDDQIGWFISQSQELHIKEGE |
Ga0164301_105632071 | 3300012960 | Soil | MATKAELLKVPVFADLPDDQVEWFLSQAPELPLKAG |
Ga0164308_102740832 | 3300012985 | Soil | MVQKSELLRVPVFAVPPADRGDWFIGQSKELNVKAGETYIHQGDPADS |
Ga0157374_105707911 | 3300013296 | Miscanthus Rhizosphere | MVDKSQLLRVPVFADLPDEQIDWFISQSHEMSLKAGDVYA |
Ga0157372_107974392 | 3300013307 | Corn Rhizosphere | MIDKSELRRLPAFADLPDDQISWFLANSQEAHLAA |
Ga0157372_120041472 | 3300013307 | Corn Rhizosphere | MIDKAELLRVPAFNELPDDQIEWFISQAEEMVLNAGDV |
Ga0181524_100833742 | 3300014155 | Bog | MVEQSELLRVPVFADLPDDQIAWFISQSQEMNLKAG |
Ga0181526_107971881 | 3300014200 | Bog | MVKNSELLRVPAFADLPDDQLAWFISQAEEFHYKAGDTYLRQGTPADAM |
Ga0182024_112705951 | 3300014501 | Permafrost | MVEHSELLRVPVFASLPDDQIAWFIAQAEELALKAGES |
Ga0181525_106823871 | 3300014654 | Bog | MVDKSELRRVPVFADLPDDQLDWFLSQAQEMSLKAGDTYARPGDPAD |
Ga0137411_10756371 | 3300015052 | Vadose Zone Soil | MAEKSELLRVPAFADLPDDQIAWFIGQSEELHLKQSEELHLKGG |
Ga0132256_1013954392 | 3300015372 | Arabidopsis Rhizosphere | MIDKAELLRVPAFNELPDDQIEWFISQAEEMVLNAGDVIFRP |
Ga0182040_117313342 | 3300016387 | Soil | MAKKSELQRVPAFADLPDDQLDWFLRQVEELRVKAGDT |
Ga0182038_117718782 | 3300016445 | Soil | MVDKAELLRVPAFADLPDDQLDWFLSNSQELHVAVGD |
Ga0187825_103949762 | 3300017930 | Freshwater Sediment | MAENSELLRVPAFADLPDDQISWFIGQAEELRLTVGEMYFRE |
Ga0187848_101612592 | 3300017935 | Peatland | MVENSELLLVPAFADLPEDQIAWFITQAQELRYKAG |
Ga0187819_103056332 | 3300017943 | Freshwater Sediment | MVEKSELVRVPAFADLPDDQIEWFLSQAEEMHLKAG |
Ga0187819_107389692 | 3300017943 | Freshwater Sediment | MVENSELLGVPVFAGLPDDQITWFIGQARDMLVKAG |
Ga0187879_106824501 | 3300017946 | Peatland | MVKNSELLRVPAFADLPDDQLAWFISQAEEFHYKA |
Ga0187785_101005441 | 3300017947 | Tropical Peatland | MVSPADLSRFPAFADLPEDQIAWFLSKTQEVCLKAGE |
Ga0187778_109557721 | 3300017961 | Tropical Peatland | MVEPAELRRVPVFGDLPDDQIAWFLSQSQELRAKAGDIY |
Ga0187822_101364181 | 3300017994 | Freshwater Sediment | MIEKTQLLRIPSFADLPDDQIEWFLSQAEDLRFKGGDILINP |
Ga0187816_101529701 | 3300017995 | Freshwater Sediment | MVEISELLRVPAFAALPEDQLTWFLSQSEELHLKPGDTFVRQNDPADAMFVV |
Ga0187804_100185671 | 3300018006 | Freshwater Sediment | MADTLELLRKVPAFAGTPDDQLAWFLSKAQEVQVQAGDVYARQA |
Ga0187880_13285671 | 3300018016 | Peatland | MVENSELLRVPVFADLPDDQLAWFLSQSQELRYKAGDTYL |
Ga0187861_103474111 | 3300018020 | Peatland | MVENSELLRVPVFADLPDDQLAWFLSQSQELRYKAGDTYLRQGT |
Ga0187887_106231002 | 3300018043 | Peatland | MIEPSELRRVPAFADLPDEQIAWFIGEAGELHLNAGETY |
Ga0187887_109426781 | 3300018043 | Peatland | MVDKLELRRVPTFADLPDDQLDWFISQSQELILKAGDVYAQ |
Ga0187771_117875552 | 3300018088 | Tropical Peatland | MADSTELLRRVPVFTDLPDDQIAWFLSRSQDLRLKAGESYSRQ |
Ga0187770_110226011 | 3300018090 | Tropical Peatland | MVETSELLRIPVFAGLPDDQIGWFISQAVEVPLKAGETYFR |
Ga0066655_102753802 | 3300018431 | Grasslands Soil | MVEKSELLRVPAFADLPDDQITWFLAQSQAVHLSA |
Ga0066655_114198791 | 3300018431 | Grasslands Soil | MMIEKFDLLRVPTFANLPDDQLEWFISQCHEQLLNPGDTYIRQ |
Ga0182028_14020504 | 3300019788 | Fen | MVENSGLLLVPAFTDLPDDQIAWFISQAQELRYKAGDTYVR |
Ga0193746_10073711 | 3300019870 | Soil | MAEKSELLRIPVFADVPDDQLEWFLSQCQEEFLKPGDTYVR |
Ga0193747_10941002 | 3300019885 | Soil | MIDKSELLRVPVFADLPDDQLAWFLSQTQEVHLKAGDIYMRVGEPAEFM |
Ga0193726_10076787 | 3300020021 | Soil | MANRAELLHVSTFADLPDDQIEWFLSQSQEMSIKAGETYT |
Ga0193753_102757191 | 3300020034 | Soil | MTTNSELLQVPVFADLPEDQIAWFLSQSQEMNLKAGET |
Ga0210407_100264405 | 3300020579 | Soil | MVTPSELLRFPAFADLPDDQIAWFLGQSQEKSLKAG |
Ga0210407_104278682 | 3300020579 | Soil | MVDKSELIRVPAFAGLPDDQIAWFLGNSQEVHFAAGDV |
Ga0210407_105720781 | 3300020579 | Soil | MAEISELLARVPVFEGLPDDQIAWFLSQAQELQLKAGDVYAR |
Ga0210407_110615561 | 3300020579 | Soil | MVTPSELLRFPAFAGLPDDQIAWFLGQSQEKSLKAGE |
Ga0210403_100929723 | 3300020580 | Soil | MAEKSELLRVPVFADLPDDQIEWFLSQSQELHLKAGE |
Ga0210399_104484092 | 3300020581 | Soil | MAEAIELLRAVPAFAGLPDDQIDWFLSQAQEVRLKAGEP |
Ga0210399_106811922 | 3300020581 | Soil | MVEKSDLLRVPVFADLPDDQLDWFISQSQELHLKAGEGYARQ |
Ga0210399_106929841 | 3300020581 | Soil | MADKAELRRVPVFTDLPDEQLDWFLSKSEEVRAKR |
Ga0210399_109069021 | 3300020581 | Soil | MVENSELLRVPAFADLPNDQLAWFLSQAQELHLKAGETYLRAGDPANV |
Ga0210395_108347281 | 3300020582 | Soil | MVDKTELRRVTEFADLPDDQLDWFLSQSQEMHLKAGEMY |
Ga0210401_108382502 | 3300020583 | Soil | MVEKSELLRVPAFADLPDDQIAWFINQSQELHLKAGDT |
Ga0179596_101129661 | 3300021086 | Vadose Zone Soil | MAEKSELLRVPAFADLPDEQIAWFISQSEEVRLKPGDINIREGDLADTMFVV |
Ga0210404_106351272 | 3300021088 | Soil | MVDKSELRRVQEFADLPDDQLDWFLSQAKELNLKAGDTYARQGD |
Ga0210406_111909362 | 3300021168 | Soil | MADKSELLKVPVFADLPDDQLDWFLSQSTELQLKSGQSYSRQ |
Ga0210405_108188601 | 3300021171 | Soil | MVEKSELLRVPVFADLPDDQIAWFISQSQELHLKAGDSSTRQ |
Ga0210405_111126422 | 3300021171 | Soil | MTAKTELLRVPVFADLPEDQISWFLSQAEELRFKAGDT |
Ga0210396_100281741 | 3300021180 | Soil | MVETSELLHRIPAFDGLPDDQIAWFLSQSKELHLKQGDSYA |
Ga0210396_103672151 | 3300021180 | Soil | MATPEELLRFPAFADLPEDQIAWFLSQSREVTLKAGEI |
Ga0210396_108183681 | 3300021180 | Soil | MVDKSELLRFPIFADLPDDQIEWFISQSQELDVKSGEI |
Ga0210388_117265321 | 3300021181 | Soil | MADISELKRVPAFADLPDDQLVWFLSQSQELNLKA |
Ga0210393_100584281 | 3300021401 | Soil | MADKSELLRVPAFVDLPDDQLDWFLSQSHELHLKA |
Ga0210385_102199152 | 3300021402 | Soil | MVEKSELLRVPVFADLPDDQIAWFISQSQELHLKAGDNSTRQ |
Ga0210385_112800041 | 3300021402 | Soil | MVDKSELRRVTIFADLPDDQVDWFLSQTQEMNLKAGDT |
Ga0210389_102188931 | 3300021404 | Soil | MVEKSDLRRVPAFADLPDDQLDWFLGNSQELHTAVGDT |
Ga0210387_114857362 | 3300021405 | Soil | MVEKSELLKVPAFADLPDDQITWFLSQAKEINIKAG |
Ga0210387_116846182 | 3300021405 | Soil | MIDKSELRHVPVFADLPDDQLDWFISESQEMNLKAGDVYS |
Ga0210394_112634052 | 3300021420 | Soil | MAENSELLRVPVFAGLPDDQISWFISQAVDLPLRAGE |
Ga0210394_114836892 | 3300021420 | Soil | MVEKSELLRVPVFADLPDDQLDWFISQAQELHLKAG |
Ga0210384_110677552 | 3300021432 | Soil | MVEKSELLRVPAFAGLPDDQISWFLDNSQEIRVAAG |
Ga0210384_118734262 | 3300021432 | Soil | MVENSELLRVPVFADLPDDQIAWFLSHTEDMHLKA |
Ga0210391_111012281 | 3300021433 | Soil | MVENSELLRVPVFAGLPDDQISWFISQAIEAPLKAGE |
Ga0210392_105127032 | 3300021475 | Soil | MVEIPELRRVAPFADSTDDQLSWFLSQAQELNLKPGDTYVRPGSPAAT |
Ga0210402_104737231 | 3300021478 | Soil | MIDKSELRHVPVFADLPDDQLDWFISESQEMNLKAGDIYSRQG |
Ga0210410_103301821 | 3300021479 | Soil | MADKSELLRVPVFADLPDDQIDWFISQSQELHLKAGD |
Ga0126371_120939081 | 3300021560 | Tropical Forest Soil | MADQSELLRFPAFADLPEDQVAWFLGQSQELKLKAGEI |
Ga0126371_128160921 | 3300021560 | Tropical Forest Soil | MVDKSELLRVPAFAGLPDDQIAWFLDNSQELRLAPGDFYAH |
Ga0213849_11606802 | 3300021857 | Watersheds | MVEKSELRAVPAFADSSDDQLDWFIGQAQEIRFQAGDTYLRA |
Ga0224546_10140402 | 3300022515 | Soil | MVEKSELLRVPVFSDLPDDQIEWFISQSRELFYKAGDIYSR |
Ga0212123_102241102 | 3300022557 | Iron-Sulfur Acid Spring | MVEKSELIRVAAFADLPDDQLAWFLSQSQELHLKAGETYLRAGDPANA |
Ga0212123_106629981 | 3300022557 | Iron-Sulfur Acid Spring | MVEKSEILRVPVFADLPDDQLDWFISQSQEMNLKAGDVYAHEGD |
Ga0228598_10934722 | 3300024227 | Rhizosphere | MVEKSQLLRVPVFADLPDDQLDWFISQSEELHLKA |
Ga0224564_11131902 | 3300024271 | Soil | MVEKSELLRVPVFVDLPGDQIAWFIGNAEELRLKA |
Ga0208194_10065233 | 3300025412 | Peatland | MVDKSELLRVPAFADLPDDQLNWFISQSQELNLKA |
Ga0208690_10603512 | 3300025434 | Peatland | MADKSELLRVPAFADLPDDQLEWFLSQSQELNYKAGDTYLRQGTP |
Ga0207692_101225522 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | MVEASELGRLPIFADLPEDQIAWFISQSQELTLKADEF |
Ga0207647_100344004 | 3300025904 | Corn Rhizosphere | MIDKSELRRLPAFADLPDDQISWFLANSQEAHLAAG |
Ga0207693_107508881 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MVDKSELLRVPAFAGLPDDQLAWFLSQAQELHLKAGEMYLRAGD |
Ga0207660_101329902 | 3300025917 | Corn Rhizosphere | MADKTELRKVSEFTDLPDDQLDWFLGVTEELHLKA |
Ga0207660_112510121 | 3300025917 | Corn Rhizosphere | MIDKAELLRVPAFSELPDDQIEWFISQAEEMVLNAG |
Ga0207649_102785341 | 3300025920 | Corn Rhizosphere | MATKAELLKVPVFADLPDDQVEWFLSQAPELPLKAGETYF |
Ga0207646_110854051 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MIEKSELLRIPTFADLPDEQLEWFLSQCQEQFLKAGDTYIRQG |
Ga0207646_115087111 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MVDKSELLRVPAFVDLPDDQIAWFLSQSQETHIKAGDT |
Ga0207700_107506552 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MADKSELRRVVVFNDLPDDQIDWFLSQSKEVHLNAGD |
Ga0207664_104434462 | 3300025929 | Agricultural Soil | MAEKSELLRIPVFADVPDDQLEWFLSQCQEEFLKPGDTYA |
Ga0207670_107246632 | 3300025936 | Switchgrass Rhizosphere | MATKAELLKVPVFADLPDDQVEWFLSQAPELPLKAGETYFRQGDP |
Ga0207661_117986612 | 3300025944 | Corn Rhizosphere | MADKTELRKVSEFTDLPDDQLDWFLGVTEELHLKAGE |
Ga0207639_108971911 | 3300026041 | Corn Rhizosphere | MATKAELLKVPVFADLPDDQVEWFLSQAPELPLKAGETY |
Ga0209890_101220252 | 3300026291 | Soil | MVENSELLRVPAFSGLPDDQISWFISQAQEIHMRA |
Ga0209802_11735951 | 3300026328 | Soil | MADKAELLRVPTFADLPEDQLDWFLSRCQEQLLKPGDTY |
Ga0209059_12170462 | 3300026527 | Soil | MAEKSELLRIPVFADVPDDQLEWFLSQCQEEFLKPG |
Ga0209056_103608791 | 3300026538 | Soil | MIDKSELLRVPVFADLPDDQLAWFLSQTQEVQLNAGDIYMRVGEPA |
Ga0209648_101899732 | 3300026551 | Grasslands Soil | MADKSELLRIPAFANLPDDQIAWFLSQSQELSLKPDGI |
Ga0208860_10228231 | 3300027076 | Forest Soil | MVDKSELLRVPVFNDLPDDQIAWFISQSQEMKLKAGES |
Ga0208488_10079291 | 3300027110 | Forest Soil | MAEISELLRRVPVFADLPDDQISWFLNQTQDLQLKTGEHYT |
Ga0209421_11278001 | 3300027432 | Forest Soil | MVEISELARVPAFEGLPEDQLAWFLSQSQELHLQPGEIYVRQNDP |
Ga0208199_11293412 | 3300027497 | Peatlands Soil | MAEAAELLQVPAFAGLPDDQIAWFLSQAQELCVKGGET |
Ga0207761_10217181 | 3300027516 | Tropical Forest Soil | MVDSSELLQRVPVFAGLPEDLLAWFLSRAQELQLE |
Ga0209115_10504731 | 3300027567 | Forest Soil | MVEKSELLKVPAFADLPDDQITWFISQAQELNLKA |
Ga0209733_10911231 | 3300027591 | Forest Soil | MVETSELLGVPLFADLPDDQLAWFLSQSQELRLKAGEVYSRQGDP |
Ga0209528_10927752 | 3300027610 | Forest Soil | MIDKSELLRVPVFADLPDDQIAWFISQSQEMKLKAGDVY |
Ga0209420_10138871 | 3300027648 | Forest Soil | MVDKSELLRVPAFADLPDDQLDWFLSQSQELNLKAGEVYAQQGTP |
Ga0209007_11105101 | 3300027652 | Forest Soil | MVDKAELLRVPIFADLPEDQIEWFLSQSQELNLKAGE |
Ga0209118_10677102 | 3300027674 | Forest Soil | MVEKSELIRVPAFADLPDDQLDWFLSQAQELHLKAGETYLRAGDPANAM |
Ga0209530_11917881 | 3300027692 | Forest Soil | MVEKSELFTVPAFAGLPDDQIAWFISQSEEIRAKAGDTSFRE |
Ga0209581_12645521 | 3300027706 | Surface Soil | MMDKSDLRHVSIFADLPEDQLAWFLSQSQEQILRAGETYIR |
Ga0209581_12821451 | 3300027706 | Surface Soil | MDKSDLRHVPVFADLPDDQISWFLSQCQEHTLQPGETYI |
Ga0208989_101021262 | 3300027738 | Forest Soil | MVDKSELLRVPVFADLPDDQLAWFISQSQEMKLKA |
Ga0209689_11510122 | 3300027748 | Soil | MVEKSELIRVPAFADLPDDQLAWFLSQAQELHLKAGETYLRAGDPA |
Ga0209139_102424541 | 3300027795 | Bog Forest Soil | MVTNSELLAVPAFAGLPDDQITWFISRSEELVVKAG |
Ga0209656_101561891 | 3300027812 | Bog Forest Soil | MVDKSELLRLPVFADLPDDQIDWFIGQSQEMTLKAGEV |
Ga0209811_101188231 | 3300027821 | Surface Soil | MIDKSELRRVPAFADLPDDQIAWFLSQSLETHVAAGETY |
Ga0209811_103092781 | 3300027821 | Surface Soil | MIDKSELRRLPAFADLPDDQISWFLANSQETHLAAG |
Ga0209040_101045842 | 3300027824 | Bog Forest Soil | MVDKSELLRVPVFADLPDEQLDWFISQSQEMHLKAGDAYSRQG |
Ga0209039_102581781 | 3300027825 | Bog Forest Soil | MVDKSELVRVPEFADLPEDQLDWFISQSQEVNTKAG |
Ga0209060_102447592 | 3300027826 | Surface Soil | MSSIEELLKVPVFAGLPEEQIEWFLSRTEELRFKAGDT |
Ga0209580_101350711 | 3300027842 | Surface Soil | MIEKLELLRVPAFADLPDDQIAWFIAHSEELRLNSGDT |
Ga0209580_105288692 | 3300027842 | Surface Soil | MAEAAELLRVNAFAGLPGDQIAWFLSQAQELHFKDGE |
Ga0209166_1000046645 | 3300027857 | Surface Soil | MTDARELLRRVPAFVGLPDDQVEWFLSQSQELRLNAGDPYARRGD |
Ga0209167_105876721 | 3300027867 | Surface Soil | MIENAALLGIPVFAGLPDDQIAWFLSQAEELRFKAGDIL |
Ga0209579_102654811 | 3300027869 | Surface Soil | MVDKSELLRIPIFADLPDNQLDWFISQSQELHLKAGEGY |
Ga0209579_103026823 | 3300027869 | Surface Soil | MVEKSELRKAPVFADLPDDQLDWFISQSEELQLKAGDTY |
Ga0209283_104194461 | 3300027875 | Vadose Zone Soil | MINKSELLRVPTFADLPDDQLEWFLSQSHEQLLKPGDTY |
Ga0209169_100972201 | 3300027879 | Soil | MVDKSELRRVQEFADLPDDQLDWFLSQAQELKLKAGDVYSRPGDPADTM |
Ga0209380_100094051 | 3300027889 | Soil | MADKSELLRVPVFADLPDDQLEWFLSQSQELNYKAGDTYLRQGTPA |
Ga0209380_102110702 | 3300027889 | Soil | MVDKSELRRVQEFADLPDDQLDWFLSRAQELHLKA |
Ga0209380_103429292 | 3300027889 | Soil | MVEKSDLRRVPAFADLPDDQLDWFLGNSRELNVAVGDTYIRQGDP |
Ga0209624_110041762 | 3300027895 | Forest Soil | MVDKSELLRVAEFADLPDDQIAWFLSQSQEMNLKAGDI |
Ga0209067_102447442 | 3300027898 | Watersheds | MAEISELLGRVPVFESLPDDQIAWFLSHAQELHLKAGD |
Ga0209488_111781712 | 3300027903 | Vadose Zone Soil | MVEKSELIRVPAFADLPDDQLDWFLSQAQELHLKAGETYLRAGDPANAMFVI |
Ga0209006_101056653 | 3300027908 | Forest Soil | MADKSELRSVPVFNDLPDDQLTWFLGNSQELQVTPGDV |
Ga0209698_106756761 | 3300027911 | Watersheds | MVEKSELLRVSAFADLPDDQLAWFISQSEELRLKAGDT |
Ga0268264_110362292 | 3300028381 | Switchgrass Rhizosphere | MVDKSELRRVPAFEGLPDDQLDWFLSQSNEIHMKAGDILVR |
Ga0302224_102690411 | 3300028759 | Palsa | MVEKSEILRVPAFADLPDDQISWFLANSQEMRVAAGDVY |
Ga0222749_102221361 | 3300029636 | Soil | MIEKTQLLRVPAFADLPDDQIEWFLSQAEELRFKAGETLI |
Ga0311368_108061092 | 3300029882 | Palsa | MVEKSELLRVPAFADLPDDQIAWFISQSQELHLKAGDTYA |
Ga0311369_113915031 | 3300029910 | Palsa | MVETSELLRVPVFADLPVDQIEWFLSQAQEMHLKAGDT |
Ga0311363_112120992 | 3300029922 | Fen | MVEKSELQRVAEFADLPDDQLDWFISQAQEINVKAGSVLSHQGEPA |
Ga0302304_102907732 | 3300029993 | Palsa | MVDKSELRRVPVFADLPDDQLDWFLSQAQEMNLKAGDTYARPGDPADAMF |
Ga0302270_105475431 | 3300030011 | Bog | MIEKSELLEAPAFAGLPDDQIAWFISQSEELLFKAGDYYS |
Ga0302183_102124982 | 3300030509 | Palsa | MIENKELLRVPVFAGLPDDQVAWFISQSEERHYKAGETYSH |
Ga0311356_118279492 | 3300030617 | Palsa | MVDKSELRRVPVFADLPDDQLDWFLSQAQEMNLKAGDTYARPGDPAD |
Ga0311354_104851982 | 3300030618 | Palsa | MIENSELLGVPAFAGLPDDQLTWFIGQSQEIALKAGDSYFREGDP |
Ga0307482_11860681 | 3300030730 | Hardwood Forest Soil | MTDKEELLRVPAFAGLPDDQLDWFLSQVEDLRFNA |
Ga0302310_101904172 | 3300030737 | Palsa | MTELSELLRRVPVFADLPDDQISWFLSQSQDLQLKAGEYYT |
Ga0302311_105673312 | 3300030739 | Palsa | MVENSALLKVPAFVDLPEDQITWFISHTNEMNLRAGET |
Ga0138296_14575171 | 3300030923 | Soil | MVEKSELVRVPAFADLPDDQLDWFLSQAQELHLKPGETYLRAGDPANAM |
Ga0302307_101816092 | 3300031233 | Palsa | MVDKSELRRVPVFADLPDDQLDWFLSQAQEMNLKAGDTY |
Ga0302318_102344751 | 3300031258 | Bog | MIEKSELLEAPAFAGLPDDQIAWFISQSEELLFKAGDY |
Ga0302326_114401102 | 3300031525 | Palsa | MVDKSELLSFPIFADLPDDQINWFIGKSQELQLKAGLSYTRQG |
Ga0302326_134544701 | 3300031525 | Palsa | MVDKSELLRVPVFADLPDDQIAWFISQAQELRLKVG |
Ga0307483_10207551 | 3300031590 | Hardwood Forest Soil | MVEKSELLRIPAFADLPDDQIEWFLSQSQELNLKAGE |
Ga0310686_1041900311 | 3300031708 | Soil | MVEKADLRRVPAFADLPDDQLDWFLGNSQELHVAAGDSYI |
Ga0307476_100041191 | 3300031715 | Hardwood Forest Soil | MVDNSELLRVPVFADLPDDQLAWFISQSQEMNLKAGDVYARQGD |
Ga0307476_100850931 | 3300031715 | Hardwood Forest Soil | MVEKSDLRRVPAFADLPDDQLDWFLGNSQELRVAVGDTYIRQGD |
Ga0307476_103732001 | 3300031715 | Hardwood Forest Soil | MIEKSELLRAPAFAGLPDDQIAWFISQSQEVHLKAGEIYSRE |
Ga0307474_105721531 | 3300031718 | Hardwood Forest Soil | MVEKSELNRVPAFADLPDDQLDWFLSQAQELHLKAGEAYLRAGDPANAMFV |
Ga0307475_104170641 | 3300031754 | Hardwood Forest Soil | MVEKSELLRVPAFADLPDDQIAWFLSESEEMHLKAGD |
Ga0307473_105152481 | 3300031820 | Hardwood Forest Soil | MVEKSELLRVPVFVDLPDDQIAWFIGNTEEIRLKAGDAY |
Ga0306919_109907632 | 3300031879 | Soil | MVSPSELERLPVFADLPADQIAWFLEQAREIHLKA |
Ga0318549_103277131 | 3300032041 | Soil | MVDKSELLRVPAFAGLPDDQIAWFLSNSRELHLAPG |
Ga0318533_104813372 | 3300032059 | Soil | MVDKSELLRVPAFAGLPDDQIAWFLGNSQELRLAPGD |
Ga0306924_115206891 | 3300032076 | Soil | MVEASELRRITVFADLPDDQIAWFLGQSEEVVLKPDDVYVHVG |
Ga0307415_1004827732 | 3300032126 | Rhizosphere | MIRKEELLRVPAFAGLPDDQLEWFLAQSQELNVKAGETVF |
Ga0311301_118219091 | 3300032160 | Peatlands Soil | MAETVDLLRRVPVFADLPNDQMAWFLSESQEMRLKAGE |
Ga0307471_1002392753 | 3300032180 | Hardwood Forest Soil | MVENSELLRVPVFAGLPDDQIAWFLGQAEELRLKAGD |
Ga0307471_1005496311 | 3300032180 | Hardwood Forest Soil | MIAKSELLRVPAFADLPDDQITWFLSQSQEIHLKAG |
Ga0307471_1007214461 | 3300032180 | Hardwood Forest Soil | MVEKSELIRVPAFADLPDDQLDWFLSQAQELHLKPGETYLRAGDP |
Ga0307471_1021941522 | 3300032180 | Hardwood Forest Soil | MVENSELLRVPAFVDLPDEQIAWFLSQAQELHLKAGETYLRAGDPANVMFV |
Ga0307472_1010915222 | 3300032205 | Hardwood Forest Soil | MIDKSELLRVPVFADLPDDQIAWFLSQCQEQILKPGDTYI |
Ga0335077_111264531 | 3300033158 | Soil | MATSTELMRFPAFAGLPEEQITWFLSQSREQSLKAGEIFARQGDPP |
Ga0310914_102779302 | 3300033289 | Soil | MVDQSELARFPIFADLPVDQIEWFLANGKEIQLKAGEIYARQG |
Ga0310810_102175941 | 3300033412 | Soil | MVEKSELRKVAAFAGLPDDQLDWFLSQSQELLLKSG |
Ga0316628_1026307441 | 3300033513 | Soil | MVGPSELLRVPAFADLPENQLTWFIGQSQELHLKAGDILSNQGDPA |
⦗Top⦘ |