NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F016605

Metagenome / Metatranscriptome Family F016605

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F016605
Family Type Metagenome / Metatranscriptome
Number of Sequences 246
Average Sequence Length 40 residues
Representative Sequence MVEKSELLRVPAFADLPDDQIAWFISQSQELHLKAGDTYA
Number of Associated Samples 203
Number of Associated Scaffolds 246

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 99.59 %
% of genes near scaffold ends (potentially truncated) 97.97 %
% of genes from short scaffolds (< 2000 bps) 89.02 %
Associated GOLD sequencing projects 195
AlphaFold2 3D model prediction Yes
3D model pTM-score0.54

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (97.561 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(15.447 % of family members)
Environment Ontology (ENVO) Unclassified
(29.268 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(56.504 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 26.47%    β-sheet: 0.00%    Coil/Unstructured: 73.53%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.54
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 246 Family Scaffolds
PF07992Pyr_redox_2 85.37
PF00070Pyr_redox 1.63
PF00027cNMP_binding 0.81
PF00072Response_reg 0.41
PF00294PfkB 0.41
PF01977UbiD 0.41
PF01070FMN_dh 0.41
PF07978NIPSNAP 0.41
PF04069OpuAC 0.41
PF02148zf-UBP 0.41
PF14559TPR_19 0.41
PF04264YceI 0.41
PF00903Glyoxalase 0.41
PF01571GCV_T 0.41
PF10017Methyltransf_33 0.41

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 246 Family Scaffolds
COG00433-polyprenyl-4-hydroxybenzoate decarboxylaseCoenzyme transport and metabolism [H] 0.41
COG0069Glutamate synthase domain 2Amino acid transport and metabolism [E] 0.41
COG1304FMN-dependent dehydrogenase, includes L-lactate dehydrogenase and type II isopentenyl diphosphate isomeraseEnergy production and conversion [C] 0.41
COG2353Polyisoprenoid-binding periplasmic protein YceIGeneral function prediction only [R] 0.41
COG5207Uncharacterized Zn-finger protein, UBP-typeGeneral function prediction only [R] 0.41


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms97.56 %
UnclassifiedrootN/A2.44 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000650|AP72_2010_repI_A1DRAFT_1017123All Organisms → cellular organisms → Bacteria610Open in IMG/M
3300000955|JGI1027J12803_104481883All Organisms → cellular organisms → Bacteria1078Open in IMG/M
3300001151|JGI12713J13577_1019834Not Available571Open in IMG/M
3300001471|JGI12712J15308_10056879All Organisms → cellular organisms → Bacteria991Open in IMG/M
3300001636|JGI20236J16297_102427All Organisms → cellular organisms → Bacteria504Open in IMG/M
3300004121|Ga0058882_1632916All Organisms → cellular organisms → Bacteria601Open in IMG/M
3300004135|Ga0058884_1343461All Organisms → cellular organisms → Bacteria507Open in IMG/M
3300004479|Ga0062595_102625765All Organisms → cellular organisms → Bacteria505Open in IMG/M
3300005175|Ga0066673_10562740All Organisms → cellular organisms → Bacteria667Open in IMG/M
3300005434|Ga0070709_10709673All Organisms → cellular organisms → Bacteria783Open in IMG/M
3300005440|Ga0070705_101357320All Organisms → cellular organisms → Bacteria591Open in IMG/M
3300005541|Ga0070733_10437804All Organisms → cellular organisms → Bacteria872Open in IMG/M
3300005542|Ga0070732_10358272All Organisms → cellular organisms → Bacteria878Open in IMG/M
3300005542|Ga0070732_10824839All Organisms → cellular organisms → Bacteria566Open in IMG/M
3300005556|Ga0066707_10967600All Organisms → cellular organisms → Bacteria520Open in IMG/M
3300005561|Ga0066699_10424090All Organisms → cellular organisms → Bacteria952Open in IMG/M
3300005602|Ga0070762_10520752All Organisms → cellular organisms → Bacteria782Open in IMG/M
3300006028|Ga0070717_11729093All Organisms → cellular organisms → Bacteria566Open in IMG/M
3300006050|Ga0075028_100148592All Organisms → cellular organisms → Bacteria1235Open in IMG/M
3300006050|Ga0075028_100823578All Organisms → cellular organisms → Bacteria567Open in IMG/M
3300006052|Ga0075029_100611659All Organisms → cellular organisms → Bacteria729Open in IMG/M
3300006059|Ga0075017_100031589All Organisms → cellular organisms → Bacteria3491Open in IMG/M
3300006102|Ga0075015_100444861All Organisms → cellular organisms → Bacteria738Open in IMG/M
3300006102|Ga0075015_100601078All Organisms → cellular organisms → Bacteria644Open in IMG/M
3300006163|Ga0070715_10473753All Organisms → cellular organisms → Bacteria711Open in IMG/M
3300006172|Ga0075018_10004071All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae5100Open in IMG/M
3300006176|Ga0070765_100361520All Organisms → cellular organisms → Bacteria1350Open in IMG/M
3300006755|Ga0079222_10367137All Organisms → cellular organisms → Bacteria982Open in IMG/M
3300006755|Ga0079222_10872762All Organisms → cellular organisms → Bacteria749Open in IMG/M
3300006797|Ga0066659_10911118All Organisms → cellular organisms → Bacteria734Open in IMG/M
3300006806|Ga0079220_10630824All Organisms → cellular organisms → Bacteria770Open in IMG/M
3300007076|Ga0075435_100070257All Organisms → cellular organisms → Bacteria2858Open in IMG/M
3300009029|Ga0066793_10538227All Organisms → cellular organisms → Bacteria667Open in IMG/M
3300009089|Ga0099828_11296946All Organisms → cellular organisms → Bacteria644Open in IMG/M
3300009090|Ga0099827_10662936All Organisms → cellular organisms → Bacteria901Open in IMG/M
3300009520|Ga0116214_1301824All Organisms → cellular organisms → Bacteria614Open in IMG/M
3300009635|Ga0116117_1052973All Organisms → cellular organisms → Bacteria999Open in IMG/M
3300009635|Ga0116117_1109846All Organisms → cellular organisms → Bacteria694Open in IMG/M
3300009641|Ga0116120_1243852All Organisms → cellular organisms → Bacteria564Open in IMG/M
3300009665|Ga0116135_1202487All Organisms → cellular organisms → Bacteria759Open in IMG/M
3300009759|Ga0116101_1016624All Organisms → cellular organisms → Bacteria1405Open in IMG/M
3300010046|Ga0126384_10579378All Organisms → cellular organisms → Bacteria979Open in IMG/M
3300010048|Ga0126373_10453626All Organisms → cellular organisms → Bacteria1317Open in IMG/M
3300010301|Ga0134070_10278702All Organisms → cellular organisms → Bacteria632Open in IMG/M
3300010335|Ga0134063_10252556All Organisms → cellular organisms → Bacteria839Open in IMG/M
3300010343|Ga0074044_11082175All Organisms → cellular organisms → Bacteria525Open in IMG/M
3300010360|Ga0126372_12545158All Organisms → cellular organisms → Bacteria563Open in IMG/M
3300010360|Ga0126372_13078166All Organisms → cellular organisms → Bacteria518Open in IMG/M
3300010361|Ga0126378_10119819All Organisms → cellular organisms → Bacteria2634Open in IMG/M
3300010361|Ga0126378_11626499All Organisms → cellular organisms → Bacteria733Open in IMG/M
3300010361|Ga0126378_11925704All Organisms → cellular organisms → Bacteria673Open in IMG/M
3300010373|Ga0134128_13022451All Organisms → cellular organisms → Bacteria517Open in IMG/M
3300010379|Ga0136449_101407177All Organisms → cellular organisms → Bacteria1076Open in IMG/M
3300010396|Ga0134126_10043868All Organisms → cellular organisms → Bacteria5624Open in IMG/M
3300010858|Ga0126345_1055085All Organisms → cellular organisms → Bacteria547Open in IMG/M
3300010876|Ga0126361_10631153All Organisms → cellular organisms → Bacteria725Open in IMG/M
3300012189|Ga0137388_10647705All Organisms → cellular organisms → Bacteria982Open in IMG/M
3300012199|Ga0137383_10587317All Organisms → cellular organisms → Bacteria815Open in IMG/M
3300012201|Ga0137365_10432246All Organisms → cellular organisms → Bacteria970Open in IMG/M
3300012202|Ga0137363_10103004All Organisms → cellular organisms → Bacteria2173Open in IMG/M
3300012202|Ga0137363_10121481All Organisms → cellular organisms → Bacteria2016Open in IMG/M
3300012207|Ga0137381_10899301All Organisms → cellular organisms → Bacteria765Open in IMG/M
3300012361|Ga0137360_10078051All Organisms → cellular organisms → Bacteria2474Open in IMG/M
3300012361|Ga0137360_10516687All Organisms → cellular organisms → Bacteria1018Open in IMG/M
3300012925|Ga0137419_11916822All Organisms → cellular organisms → Bacteria509Open in IMG/M
3300012955|Ga0164298_11446639All Organisms → cellular organisms → Bacteria534Open in IMG/M
3300012960|Ga0164301_10563207All Organisms → cellular organisms → Bacteria834Open in IMG/M
3300012985|Ga0164308_10274083All Organisms → cellular organisms → Bacteria1327Open in IMG/M
3300013296|Ga0157374_10570791All Organisms → cellular organisms → Bacteria1140Open in IMG/M
3300013307|Ga0157372_10797439All Organisms → cellular organisms → Bacteria1097Open in IMG/M
3300013307|Ga0157372_12004147All Organisms → cellular organisms → Bacteria665Open in IMG/M
3300014155|Ga0181524_10083374Not Available1846Open in IMG/M
3300014200|Ga0181526_10797188All Organisms → cellular organisms → Bacteria595Open in IMG/M
3300014501|Ga0182024_11270595All Organisms → cellular organisms → Bacteria856Open in IMG/M
3300014654|Ga0181525_10682387All Organisms → cellular organisms → Bacteria576Open in IMG/M
3300015052|Ga0137411_1075637All Organisms → cellular organisms → Bacteria1650Open in IMG/M
3300015372|Ga0132256_101395439All Organisms → cellular organisms → Bacteria812Open in IMG/M
3300016387|Ga0182040_11731334All Organisms → cellular organisms → Bacteria534Open in IMG/M
3300016445|Ga0182038_11771878All Organisms → cellular organisms → Bacteria557Open in IMG/M
3300017930|Ga0187825_10394976All Organisms → cellular organisms → Bacteria530Open in IMG/M
3300017935|Ga0187848_10161259All Organisms → cellular organisms → Bacteria982Open in IMG/M
3300017943|Ga0187819_10305633All Organisms → cellular organisms → Bacteria924Open in IMG/M
3300017943|Ga0187819_10738969All Organisms → cellular organisms → Bacteria554Open in IMG/M
3300017946|Ga0187879_10682450All Organisms → cellular organisms → Bacteria572Open in IMG/M
3300017947|Ga0187785_10100544All Organisms → cellular organisms → Bacteria1156Open in IMG/M
3300017961|Ga0187778_10955772All Organisms → cellular organisms → Bacteria591Open in IMG/M
3300017994|Ga0187822_10136418All Organisms → cellular organisms → Bacteria778Open in IMG/M
3300017995|Ga0187816_10152970All Organisms → cellular organisms → Bacteria998Open in IMG/M
3300018006|Ga0187804_10018567All Organisms → cellular organisms → Bacteria2500Open in IMG/M
3300018016|Ga0187880_1328567All Organisms → cellular organisms → Bacteria653Open in IMG/M
3300018020|Ga0187861_10347411All Organisms → cellular organisms → Bacteria628Open in IMG/M
3300018043|Ga0187887_10623100All Organisms → cellular organisms → Bacteria637Open in IMG/M
3300018043|Ga0187887_10942678All Organisms → cellular organisms → Bacteria511Open in IMG/M
3300018088|Ga0187771_11787555All Organisms → cellular organisms → Bacteria522Open in IMG/M
3300018090|Ga0187770_11022601All Organisms → cellular organisms → Bacteria665Open in IMG/M
3300018431|Ga0066655_10275380All Organisms → cellular organisms → Bacteria1087Open in IMG/M
3300018431|Ga0066655_11419879All Organisms → cellular organisms → Bacteria505Open in IMG/M
3300019788|Ga0182028_1402050All Organisms → cellular organisms → Bacteria1557Open in IMG/M
3300019870|Ga0193746_1007371All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1071Open in IMG/M
3300019885|Ga0193747_1094100All Organisms → cellular organisms → Bacteria730Open in IMG/M
3300020021|Ga0193726_1007678All Organisms → cellular organisms → Bacteria6097Open in IMG/M
3300020034|Ga0193753_10275719All Organisms → cellular organisms → Bacteria735Open in IMG/M
3300020579|Ga0210407_10026440All Organisms → cellular organisms → Bacteria4315Open in IMG/M
3300020579|Ga0210407_10427868All Organisms → cellular organisms → Bacteria1036Open in IMG/M
3300020579|Ga0210407_10572078All Organisms → cellular organisms → Bacteria881Open in IMG/M
3300020579|Ga0210407_11061556All Organisms → cellular organisms → Bacteria615Open in IMG/M
3300020580|Ga0210403_10092972All Organisms → cellular organisms → Bacteria2441Open in IMG/M
3300020581|Ga0210399_10448409All Organisms → cellular organisms → Bacteria1075Open in IMG/M
3300020581|Ga0210399_10681192All Organisms → cellular organisms → Bacteria846Open in IMG/M
3300020581|Ga0210399_10692984All Organisms → cellular organisms → Bacteria838Open in IMG/M
3300020581|Ga0210399_10906902All Organisms → cellular organisms → Bacteria714Open in IMG/M
3300020582|Ga0210395_10834728All Organisms → cellular organisms → Bacteria686Open in IMG/M
3300020583|Ga0210401_10838250All Organisms → cellular organisms → Bacteria779Open in IMG/M
3300021086|Ga0179596_10112966All Organisms → cellular organisms → Bacteria1250Open in IMG/M
3300021088|Ga0210404_10635127All Organisms → cellular organisms → Bacteria608Open in IMG/M
3300021168|Ga0210406_11190936All Organisms → cellular organisms → Bacteria555Open in IMG/M
3300021171|Ga0210405_10818860All Organisms → cellular organisms → Bacteria712Open in IMG/M
3300021171|Ga0210405_11112642All Organisms → cellular organisms → Bacteria590Open in IMG/M
3300021180|Ga0210396_10028174All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales5196Open in IMG/M
3300021180|Ga0210396_10367215All Organisms → cellular organisms → Bacteria1268Open in IMG/M
3300021180|Ga0210396_10818368All Organisms → cellular organisms → Bacteria798Open in IMG/M
3300021181|Ga0210388_11726532All Organisms → cellular organisms → Bacteria517Open in IMG/M
3300021401|Ga0210393_10058428All Organisms → cellular organisms → Bacteria3037Open in IMG/M
3300021402|Ga0210385_10219915All Organisms → cellular organisms → Bacteria1386Open in IMG/M
3300021402|Ga0210385_11280004All Organisms → cellular organisms → Bacteria562Open in IMG/M
3300021404|Ga0210389_10218893All Organisms → cellular organisms → Bacteria1486Open in IMG/M
3300021405|Ga0210387_11485736All Organisms → cellular organisms → Bacteria580Open in IMG/M
3300021405|Ga0210387_11684618All Organisms → cellular organisms → Bacteria537Open in IMG/M
3300021420|Ga0210394_11263405All Organisms → cellular organisms → Bacteria632Open in IMG/M
3300021420|Ga0210394_11483689All Organisms → cellular organisms → Bacteria574Open in IMG/M
3300021432|Ga0210384_11067755All Organisms → cellular organisms → Bacteria710Open in IMG/M
3300021432|Ga0210384_11873426All Organisms → cellular organisms → Bacteria505Open in IMG/M
3300021433|Ga0210391_11101228All Organisms → cellular organisms → Bacteria617Open in IMG/M
3300021475|Ga0210392_10512703All Organisms → cellular organisms → Bacteria884Open in IMG/M
3300021478|Ga0210402_10473723All Organisms → cellular organisms → Bacteria1163Open in IMG/M
3300021479|Ga0210410_10330182All Organisms → cellular organisms → Bacteria1368Open in IMG/M
3300021560|Ga0126371_12816092All Organisms → cellular organisms → Bacteria590Open in IMG/M
3300021857|Ga0213849_1160680All Organisms → cellular organisms → Bacteria546Open in IMG/M
3300022515|Ga0224546_1014040All Organisms → cellular organisms → Bacteria660Open in IMG/M
3300022557|Ga0212123_10224110All Organisms → cellular organisms → Bacteria1371Open in IMG/M
3300022557|Ga0212123_10662998All Organisms → cellular organisms → Bacteria648Open in IMG/M
3300024227|Ga0228598_1093472All Organisms → cellular organisms → Bacteria606Open in IMG/M
3300024271|Ga0224564_1113190All Organisms → cellular organisms → Bacteria554Open in IMG/M
3300025412|Ga0208194_1006523All Organisms → cellular organisms → Bacteria2034Open in IMG/M
3300025434|Ga0208690_1060351All Organisms → cellular organisms → Bacteria591Open in IMG/M
3300025898|Ga0207692_10122552All Organisms → cellular organisms → Bacteria1458Open in IMG/M
3300025904|Ga0207647_10034400All Organisms → cellular organisms → Bacteria3235Open in IMG/M
3300025915|Ga0207693_10750888All Organisms → cellular organisms → Bacteria754Open in IMG/M
3300025917|Ga0207660_10132990All Organisms → cellular organisms → Bacteria1895Open in IMG/M
3300025917|Ga0207660_11251012All Organisms → cellular organisms → Bacteria603Open in IMG/M
3300025920|Ga0207649_10278534All Organisms → cellular organisms → Bacteria1215Open in IMG/M
3300025922|Ga0207646_11085405All Organisms → cellular organisms → Bacteria705Open in IMG/M
3300025922|Ga0207646_11508711All Organisms → cellular organisms → Bacteria582Open in IMG/M
3300025928|Ga0207700_10750655All Organisms → cellular organisms → Bacteria872Open in IMG/M
3300025929|Ga0207664_10443446All Organisms → cellular organisms → Bacteria1158Open in IMG/M
3300025936|Ga0207670_10724663All Organisms → cellular organisms → Bacteria825Open in IMG/M
3300025944|Ga0207661_11798661All Organisms → cellular organisms → Bacteria558Open in IMG/M
3300026041|Ga0207639_10897191All Organisms → cellular organisms → Bacteria828Open in IMG/M
3300026291|Ga0209890_10122025All Organisms → cellular organisms → Bacteria887Open in IMG/M
3300026328|Ga0209802_1173595All Organisms → cellular organisms → Bacteria876Open in IMG/M
3300026527|Ga0209059_1217046All Organisms → cellular organisms → Bacteria643Open in IMG/M
3300026538|Ga0209056_10360879All Organisms → cellular organisms → Bacteria943Open in IMG/M
3300026551|Ga0209648_10189973All Organisms → cellular organisms → Bacteria1580Open in IMG/M
3300027076|Ga0208860_1022823All Organisms → cellular organisms → Bacteria638Open in IMG/M
3300027110|Ga0208488_1007929All Organisms → cellular organisms → Bacteria2150Open in IMG/M
3300027432|Ga0209421_1127800All Organisms → cellular organisms → Bacteria524Open in IMG/M
3300027497|Ga0208199_1129341All Organisms → cellular organisms → Bacteria515Open in IMG/M
3300027516|Ga0207761_1021718All Organisms → cellular organisms → Bacteria1289Open in IMG/M
3300027567|Ga0209115_1050473All Organisms → cellular organisms → Bacteria948Open in IMG/M
3300027591|Ga0209733_1091123All Organisms → cellular organisms → Bacteria775Open in IMG/M
3300027610|Ga0209528_1092775All Organisms → cellular organisms → Bacteria667Open in IMG/M
3300027648|Ga0209420_1013887All Organisms → cellular organisms → Bacteria2750Open in IMG/M
3300027652|Ga0209007_1110510All Organisms → cellular organisms → Bacteria689Open in IMG/M
3300027674|Ga0209118_1067710All Organisms → cellular organisms → Bacteria1033Open in IMG/M
3300027692|Ga0209530_1191788All Organisms → cellular organisms → Bacteria565Open in IMG/M
3300027706|Ga0209581_1264552All Organisms → cellular organisms → Bacteria524Open in IMG/M
3300027706|Ga0209581_1282145All Organisms → cellular organisms → Bacteria502Open in IMG/M
3300027738|Ga0208989_10102126All Organisms → cellular organisms → Bacteria976Open in IMG/M
3300027748|Ga0209689_1151012All Organisms → cellular organisms → Bacteria1114Open in IMG/M
3300027795|Ga0209139_10242454All Organisms → cellular organisms → Bacteria637Open in IMG/M
3300027812|Ga0209656_10156189All Organisms → cellular organisms → Bacteria1139Open in IMG/M
3300027821|Ga0209811_10118823All Organisms → cellular organisms → Bacteria962Open in IMG/M
3300027821|Ga0209811_10309278All Organisms → cellular organisms → Bacteria609Open in IMG/M
3300027824|Ga0209040_10104584All Organisms → cellular organisms → Bacteria1597Open in IMG/M
3300027825|Ga0209039_10258178All Organisms → cellular organisms → Bacteria694Open in IMG/M
3300027826|Ga0209060_10244759All Organisms → cellular organisms → Bacteria822Open in IMG/M
3300027842|Ga0209580_10135071All Organisms → cellular organisms → Bacteria1208Open in IMG/M
3300027842|Ga0209580_10528869All Organisms → cellular organisms → Bacteria586Open in IMG/M
3300027857|Ga0209166_10000466All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae45166Open in IMG/M
3300027867|Ga0209167_10587672All Organisms → cellular organisms → Bacteria610Open in IMG/M
3300027869|Ga0209579_10265481All Organisms → cellular organisms → Bacteria923Open in IMG/M
3300027869|Ga0209579_10302682All Organisms → cellular organisms → Bacteria862Open in IMG/M
3300027875|Ga0209283_10419446All Organisms → cellular organisms → Bacteria870Open in IMG/M
3300027879|Ga0209169_10097220Not Available1524Open in IMG/M
3300027889|Ga0209380_10009405All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae5732Open in IMG/M
3300027889|Ga0209380_10211070All Organisms → cellular organisms → Bacteria1140Open in IMG/M
3300027889|Ga0209380_10342929All Organisms → cellular organisms → Bacteria877Open in IMG/M
3300027895|Ga0209624_11004176All Organisms → cellular organisms → Bacteria541Open in IMG/M
3300027898|Ga0209067_10244744All Organisms → cellular organisms → Bacteria974Open in IMG/M
3300027903|Ga0209488_11178171All Organisms → cellular organisms → Bacteria517Open in IMG/M
3300027908|Ga0209006_10105665All Organisms → cellular organisms → Bacteria2494Open in IMG/M
3300027911|Ga0209698_10675676All Organisms → cellular organisms → Bacteria788Open in IMG/M
3300028381|Ga0268264_11036229All Organisms → cellular organisms → Bacteria828Open in IMG/M
3300028759|Ga0302224_10269041All Organisms → cellular organisms → Bacteria682Open in IMG/M
3300029636|Ga0222749_10222136All Organisms → cellular organisms → Bacteria952Open in IMG/M
3300029882|Ga0311368_10806109All Organisms → cellular organisms → Bacteria639Open in IMG/M
3300029910|Ga0311369_11391503All Organisms → cellular organisms → Bacteria531Open in IMG/M
3300029922|Ga0311363_11212099All Organisms → cellular organisms → Bacteria635Open in IMG/M
3300029993|Ga0302304_10290773All Organisms → cellular organisms → Bacteria598Open in IMG/M
3300030011|Ga0302270_10547543All Organisms → cellular organisms → Bacteria599Open in IMG/M
3300030509|Ga0302183_10212498All Organisms → cellular organisms → Bacteria754Open in IMG/M
3300030617|Ga0311356_11827949All Organisms → cellular organisms → Bacteria541Open in IMG/M
3300030618|Ga0311354_10485198All Organisms → cellular organisms → Bacteria1226Open in IMG/M
3300030730|Ga0307482_1186068All Organisms → cellular organisms → Bacteria624Open in IMG/M
3300030737|Ga0302310_10190417All Organisms → cellular organisms → Bacteria1206Open in IMG/M
3300030739|Ga0302311_10567331All Organisms → cellular organisms → Bacteria769Open in IMG/M
3300030923|Ga0138296_1457517All Organisms → cellular organisms → Bacteria957Open in IMG/M
3300031233|Ga0302307_10181609All Organisms → cellular organisms → Bacteria1088Open in IMG/M
3300031258|Ga0302318_10234475All Organisms → cellular organisms → Bacteria895Open in IMG/M
3300031525|Ga0302326_11440110All Organisms → cellular organisms → Bacteria927Open in IMG/M
3300031525|Ga0302326_13454470All Organisms → cellular organisms → Bacteria526Open in IMG/M
3300031590|Ga0307483_1020755All Organisms → cellular organisms → Bacteria642Open in IMG/M
3300031708|Ga0310686_104190031All Organisms → cellular organisms → Bacteria555Open in IMG/M
3300031715|Ga0307476_10004119All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → unclassified Granulicella → Granulicella sp. GAS4668727Open in IMG/M
3300031715|Ga0307476_10085093All Organisms → cellular organisms → Bacteria2212Open in IMG/M
3300031715|Ga0307476_10373200All Organisms → cellular organisms → Bacteria1052Open in IMG/M
3300031718|Ga0307474_10572153All Organisms → cellular organisms → Bacteria889Open in IMG/M
3300031754|Ga0307475_10417064All Organisms → cellular organisms → Bacteria1079Open in IMG/M
3300031820|Ga0307473_10515248All Organisms → cellular organisms → Bacteria810Open in IMG/M
3300031879|Ga0306919_10990763All Organisms → cellular organisms → Bacteria643Open in IMG/M
3300032041|Ga0318549_10327713All Organisms → cellular organisms → Bacteria690Open in IMG/M
3300032059|Ga0318533_10481337All Organisms → cellular organisms → Bacteria909Open in IMG/M
3300032076|Ga0306924_11520689All Organisms → cellular organisms → Bacteria709Open in IMG/M
3300032126|Ga0307415_100482773All Organisms → cellular organisms → Bacteria1079Open in IMG/M
3300032160|Ga0311301_11821909All Organisms → cellular organisms → Bacteria723Open in IMG/M
3300032180|Ga0307471_100239275All Organisms → cellular organisms → Bacteria1857Open in IMG/M
3300032180|Ga0307471_100549631All Organisms → cellular organisms → Bacteria1309Open in IMG/M
3300032180|Ga0307471_100721446All Organisms → cellular organisms → Bacteria1162Open in IMG/M
3300032180|Ga0307471_102194152All Organisms → cellular organisms → Bacteria695Open in IMG/M
3300032205|Ga0307472_101091522All Organisms → cellular organisms → Bacteria754Open in IMG/M
3300033289|Ga0310914_10277930All Organisms → cellular organisms → Bacteria1508Open in IMG/M
3300033412|Ga0310810_10217594All Organisms → cellular organisms → Bacteria2138Open in IMG/M
3300033513|Ga0316628_102630744All Organisms → cellular organisms → Bacteria663Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil15.45%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil7.32%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil6.10%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil5.69%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil5.28%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa4.88%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil4.06%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds3.66%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil3.66%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere3.66%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil3.25%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland2.85%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland2.44%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment2.44%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil2.44%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog1.22%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.22%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.22%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere1.22%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil1.63%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil1.63%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.63%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland1.63%
WatershedsEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds0.41%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.41%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.41%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil0.41%
Permafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil0.41%
FenEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Fen0.41%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Soil0.41%
Prmafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil0.41%
PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost0.41%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.41%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.41%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.41%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.41%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil0.41%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen0.41%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.41%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.41%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.41%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.41%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.41%
Iron-Sulfur Acid SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring0.81%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.81%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.81%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.81%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog0.81%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.81%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.81%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.81%
Boreal Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil0.81%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000650Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A1EnvironmentalOpen in IMG/M
3300000955Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300001151Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O3EnvironmentalOpen in IMG/M
3300001471Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2EnvironmentalOpen in IMG/M
3300001636Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF002EnvironmentalOpen in IMG/M
3300004121Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF109 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004135Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF204 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300005175Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122EnvironmentalOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005440Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaGEnvironmentalOpen in IMG/M
3300005541Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1EnvironmentalOpen in IMG/M
3300005542Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1EnvironmentalOpen in IMG/M
3300005556Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156EnvironmentalOpen in IMG/M
3300005561Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148EnvironmentalOpen in IMG/M
3300005602Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2EnvironmentalOpen in IMG/M
3300005952Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-045EnvironmentalOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006050Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014EnvironmentalOpen in IMG/M
3300006052Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013EnvironmentalOpen in IMG/M
3300006059Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012EnvironmentalOpen in IMG/M
3300006102Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013EnvironmentalOpen in IMG/M
3300006163Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaGEnvironmentalOpen in IMG/M
3300006172Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014EnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300009029Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 1 DNA2013-189EnvironmentalOpen in IMG/M
3300009089Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaGEnvironmentalOpen in IMG/M
3300009090Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaGEnvironmentalOpen in IMG/M
3300009520Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaGEnvironmentalOpen in IMG/M
3300009635Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_10EnvironmentalOpen in IMG/M
3300009641Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_150EnvironmentalOpen in IMG/M
3300009665Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10EnvironmentalOpen in IMG/M
3300009759Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_10EnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010301Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015EnvironmentalOpen in IMG/M
3300010335Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015EnvironmentalOpen in IMG/M
3300010343Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300010858Boreal forest soil eukaryotic communities from Alaska, USA - C3-2 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300010876Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300012189Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaGEnvironmentalOpen in IMG/M
3300012199Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012201Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012207Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaGEnvironmentalOpen in IMG/M
3300012361Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaGEnvironmentalOpen in IMG/M
3300012925Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012955Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MGEnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300012985Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MGEnvironmentalOpen in IMG/M
3300013296Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaGHost-AssociatedOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300014155Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_60_metaGEnvironmentalOpen in IMG/M
3300014200Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaGEnvironmentalOpen in IMG/M
3300014501Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014654Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaGEnvironmentalOpen in IMG/M
3300015052Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300016387Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176EnvironmentalOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300017930Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5EnvironmentalOpen in IMG/M
3300017935Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_40EnvironmentalOpen in IMG/M
3300017943Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4EnvironmentalOpen in IMG/M
3300017946Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10EnvironmentalOpen in IMG/M
3300017947Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MGEnvironmentalOpen in IMG/M
3300017961Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MGEnvironmentalOpen in IMG/M
3300017994Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2EnvironmentalOpen in IMG/M
3300017995Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1EnvironmentalOpen in IMG/M
3300018006Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4EnvironmentalOpen in IMG/M
3300018016Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_40EnvironmentalOpen in IMG/M
3300018020Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_100EnvironmentalOpen in IMG/M
3300018043Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10EnvironmentalOpen in IMG/M
3300018088Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MGEnvironmentalOpen in IMG/M
3300018090Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300018431Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104EnvironmentalOpen in IMG/M
3300019788Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (PacBio error correction)EnvironmentalOpen in IMG/M
3300019870Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1m1EnvironmentalOpen in IMG/M
3300019885Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1m2EnvironmentalOpen in IMG/M
3300020021Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c1EnvironmentalOpen in IMG/M
3300020034Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1c2EnvironmentalOpen in IMG/M
3300020579Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-MEnvironmentalOpen in IMG/M
3300020580Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-MEnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300020582Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-OEnvironmentalOpen in IMG/M
3300020583Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-MEnvironmentalOpen in IMG/M
3300021086Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300021088Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-MEnvironmentalOpen in IMG/M
3300021168Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-MEnvironmentalOpen in IMG/M
3300021171Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-MEnvironmentalOpen in IMG/M
3300021180Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-OEnvironmentalOpen in IMG/M
3300021181Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-OEnvironmentalOpen in IMG/M
3300021401Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-OEnvironmentalOpen in IMG/M
3300021402Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-OEnvironmentalOpen in IMG/M
3300021404Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-OEnvironmentalOpen in IMG/M
3300021405Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-OEnvironmentalOpen in IMG/M
3300021420Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-MEnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021433Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-OEnvironmentalOpen in IMG/M
3300021475Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-OEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300021479Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300021857Metatranscriptome of freshwater microbial communities from pre-fracked creek in Pennsylvania, United States - WE:C (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022515Peat soil microbial communities from Stordalen Mire, Sweden - 717 P2 1-5EnvironmentalOpen in IMG/M
3300022557Paint Pots_combined assemblyEnvironmentalOpen in IMG/M
3300024227Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4Host-AssociatedOpen in IMG/M
3300024271Soil microbial communities from Bohemian Forest, Czech Republic ? CSU5EnvironmentalOpen in IMG/M
3300025412Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10 (SPAdes)EnvironmentalOpen in IMG/M
3300025434Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_10 (SPAdes)EnvironmentalOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025904Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025917Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025920Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025936Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025944Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026041Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026291Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049 (SPAdes)EnvironmentalOpen in IMG/M
3300026328Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes)EnvironmentalOpen in IMG/M
3300026527Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 (SPAdes)EnvironmentalOpen in IMG/M
3300026538Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes)EnvironmentalOpen in IMG/M
3300026551Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes)EnvironmentalOpen in IMG/M
3300027076Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF012 (SPAdes)EnvironmentalOpen in IMG/M
3300027110Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF001 (SPAdes)EnvironmentalOpen in IMG/M
3300027432Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300027497Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027516Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 34 (SPAdes)EnvironmentalOpen in IMG/M
3300027567Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300027591Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027610Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027648Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300027652Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300027674Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027692Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300027706Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen15_06102014_R2 (SPAdes)EnvironmentalOpen in IMG/M
3300027738Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027748Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes)EnvironmentalOpen in IMG/M
3300027795Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM3 (SPAdes)EnvironmentalOpen in IMG/M
3300027812Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes)EnvironmentalOpen in IMG/M
3300027821Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027824Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes)EnvironmentalOpen in IMG/M
3300027825Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 (SPAdes)EnvironmentalOpen in IMG/M
3300027826Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027842Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027857Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027867Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027869Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027875Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027879Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes)EnvironmentalOpen in IMG/M
3300027889Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes)EnvironmentalOpen in IMG/M
3300027895Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300027898Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes)EnvironmentalOpen in IMG/M
3300027903Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes)EnvironmentalOpen in IMG/M
3300027908Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300027911Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes)EnvironmentalOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028759Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_1EnvironmentalOpen in IMG/M
3300029636Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300029882III_Palsa_E1 coassemblyEnvironmentalOpen in IMG/M
3300029910III_Palsa_E2 coassemblyEnvironmentalOpen in IMG/M
3300029922III_Fen_E1 coassemblyEnvironmentalOpen in IMG/M
3300029993Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E2_2EnvironmentalOpen in IMG/M
3300030011Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_E2_3EnvironmentalOpen in IMG/M
3300030509Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_2EnvironmentalOpen in IMG/M
3300030617II_Palsa_N2 coassemblyEnvironmentalOpen in IMG/M
3300030618II_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030730Metatranscriptome of hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030737Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_2EnvironmentalOpen in IMG/M
3300030739Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_3EnvironmentalOpen in IMG/M
3300030923Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A3_MS_autumn Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300031233Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_2EnvironmentalOpen in IMG/M
3300031258Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_1EnvironmentalOpen in IMG/M
3300031525Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3EnvironmentalOpen in IMG/M
3300031590Metatranscriptome of hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031715Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05EnvironmentalOpen in IMG/M
3300031718Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05EnvironmentalOpen in IMG/M
3300031754Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515EnvironmentalOpen in IMG/M
3300031820Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515EnvironmentalOpen in IMG/M
3300031879Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2)EnvironmentalOpen in IMG/M
3300032041Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22EnvironmentalOpen in IMG/M
3300032059Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032126Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2Host-AssociatedOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300033158Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1EnvironmentalOpen in IMG/M
3300033289Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108EnvironmentalOpen in IMG/M
3300033412Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NCEnvironmentalOpen in IMG/M
3300033513Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_CEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
AP72_2010_repI_A1DRAFT_101712323300000650Forest SoilMAEARELLRRVPVFADTPDDQIEWFLSESQDVLLKAG
JGI1027J12803_10448188323300000955SoilMVESSELLRLPVFADLPEDQIAWFIGQSQELALKPD
JGI12713J13577_101983413300001151Forest SoilMVDKSELRRAPVFADLPDDQLDWFLANSQELRLTEGDTY
JGI12712J15308_1005687913300001471Forest SoilMTENSELLRAPAFAGLPDDQLTWFISQGEELHMKA
JGI20236J16297_10242723300001636Forest SoilMVEKSELLRVPVFADLPDDQLDWFISQSEELHLKAGEGYAR
Ga0058882_163291623300004121Forest SoilMANKSELLGVPAFADLPDDQIEWFLTQALEIHAKPGDAYYHQ
Ga0058884_134346123300004135Forest SoilMVEKSELLRVPVFADLPDDQLDWFISQSQEMNLKAGDTYSR
Ga0062595_10262576513300004479SoilMVEKSELRKVAAFAGLPDDQLDWFLSQSQELLLKSGDISVR
Ga0066673_1056274013300005175SoilMATKAELLKVPVFADLPDDQVEWFLSQAPELPLKAGEVYF
Ga0070709_1070967313300005434Corn, Switchgrass And Miscanthus RhizosphereMVEKSELRKVAAFAGLPDDQLDWFLSQSQELLLKSGDISVRQ
Ga0070705_10135732023300005440Corn, Switchgrass And Miscanthus RhizosphereMIDKSELLRVPVFADLPEDQIAWFLSQTQDVRLKPGDIYMRV
Ga0070733_1043780413300005541Surface SoilMVEKSDLRAVPAFADLPDDQLDWFLANSQELQVTAGD
Ga0070732_1035827223300005542Surface SoilMAEAAELLRVNAFAGLPGDQIAWFLSQAQELHFKGGETF
Ga0070732_1082483913300005542Surface SoilMAETSELLRRVPAFLDLPDDQITWFLSQSQELHLSPGDTY
Ga0066707_1096760023300005556SoilMIEKSELLRVPAFADLPDDQISWFLSQSQEMHLKAGET
Ga0066699_1042409023300005561SoilMAEKSELLRIPVFADVPDDQLEWFLSQCQEEFLKPGDTYV
Ga0070762_1052075223300005602SoilMVENSELLRVPIFADLPDDQIAWFISQSQELHLKAG
Ga0080026_1005457213300005952Permafrost SoilMVEDSELLKVPAFAGLPDYQIAWFISQSKEMNMVAGDMAFRQDDPADAMYV
Ga0070717_1172909323300006028Corn, Switchgrass And Miscanthus RhizosphereMVDKAELRGVSAFADLPDDQLDWFLGHSQEVRVATGETYVRQ
Ga0075028_10014859213300006050WatershedsMMEKAELHRIPVFADLPDDQIEWFLSQAEDLQFKAGDILI
Ga0075028_10082357823300006050WatershedsMVDKSELLRVPVFADLPDDQIVWFISQSQELRLKAGDT
Ga0075029_10061165923300006052WatershedsMVETSDLLRRVPVFEGLPDDQIAWFLSQSQEMRLKAGDVY
Ga0075017_10003158913300006059WatershedsMVEKSELLRVPVFADLPDDQIEWFLSQSEEMLFKA
Ga0075015_10044486113300006102WatershedsMIEKSELLRVPAFADLPDDQITWFLSQSQELVVKAGDT
Ga0075015_10060107823300006102WatershedsMVEKSELRAVPAFADSSDDQLDWFIGQAQEIRFQAGDTYLRAG
Ga0070715_1047375323300006163Corn, Switchgrass And Miscanthus RhizosphereMAEKSELLRIPVFADVPDDQLEWFLSQCQEEFLKPGDTYVQQGDPAEN
Ga0075018_1000407143300006172WatershedsMIENAKLLNVPVFVGLPEDQITWFISQSEELVFKAGD
Ga0070765_10036152023300006176SoilMVTPSELSRFPAFADLPDDQIAWFLGQSQEKSLKAGEIY
Ga0079222_1036713723300006755Agricultural SoilMVEKSELLHVPVFADLPDDQIDWFISQSQELHIKEGE
Ga0079222_1087276213300006755Agricultural SoilMIDKSELIRLPVFADLPDDQLAWFLSQTLDVQLKAG
Ga0066659_1091111813300006797SoilMVDKSELLRVPAFADLPDDQIAWFLSQAQETHIKA
Ga0079220_1063082413300006806Agricultural SoilMVDKSELRGVPAFADLPDDQLNWFLAHSQEILVGAADVDQ
Ga0075435_10007025713300007076Populus RhizosphereMATSQELLQVPAFAGLPDDQIAWFLSQSKEVSLKAGEI
Ga0066793_1053822713300009029Prmafrost SoilMVDNSELLLVPAFIDLPVDQIAWFISQAQELRYKAGDTY
Ga0099828_1129694623300009089Vadose Zone SoilMADKAELLRVPAFADLPEDQIEWFLSQCQEQILKPGDTY
Ga0099827_1066293623300009090Vadose Zone SoilMVEKSELIRVPAFADLPDDQLDWFLNQAQELHLKAGETYLRAGDPANAMF
Ga0116214_130182413300009520Peatlands SoilMADKSELLRVPVFADLPDDQIAWFLSQAQELNYKAG
Ga0116117_105297323300009635PeatlandMIEKSELLEAPAFAGLPDDQIAWFISQSEELLFKAG
Ga0116117_110984623300009635PeatlandMAEIAELKRVSLFADQPDDQIAWFLSQSQEMHLKAGET
Ga0116120_124385223300009641PeatlandMVDKSELLRVPAFADLPDDQLNWFISQSQELNLKAGDVYSR
Ga0116135_120248713300009665PeatlandMVEESELLRIPAFADLPNDQIAWFLSQSQELHVKAGDTYALQG
Ga0116101_101662423300009759PeatlandMADTSELLRKVPAFEGLPDDQIAWFLSKAQEIRLKAGEAY
Ga0126384_1057937813300010046Tropical Forest SoilMVETSELLRLPLFEGLPADQIAWFISQSQELALKP
Ga0126373_1045362623300010048Tropical Forest SoilMTNSTELLRVPTFADLPEDQIAWFLSQSQEVNLKAGDVYA
Ga0134070_1027870223300010301Grasslands SoilMIDKSELIRVPAFADLPEEQIAWFLSQSQEVHLKAGD
Ga0134063_1025255613300010335Grasslands SoilMIEKSELLRVPVFVDLPDDQIAWFLSEVQELRLQAGETYL
Ga0074044_1108217523300010343Bog Forest SoilMVEKSELLLVPAVADLPEDQIAGFISQAQELRYKAGDTYLRP
Ga0126372_1254515813300010360Tropical Forest SoilMATAEELLRFPTFAELPEDQIAWFLSQSEEVNLKTGEVY
Ga0126372_1307816623300010360Tropical Forest SoilMVDKSELRRVPAFADLPDDQLDWFLGHTQEMHLAVG
Ga0126378_1011981933300010361Tropical Forest SoilMVSPSELERLPVFADLPADQIAWFLEQAREIHLKAGETYTR
Ga0126378_1162649923300010361Tropical Forest SoilMAEILELLRQVPVFAGIPDDQMAWFLGNSQELHLAPGDFYARQ
Ga0126378_1192570423300010361Tropical Forest SoilMVESSELLRVPVFADLPNEQISWFISQSHELVLEPDEI
Ga0134128_1302245113300010373Terrestrial SoilMIQKSELLKVPVFADLPDDQIAWFLSQSEEIRLSVGETYVRQ
Ga0136449_10140717723300010379Peatlands SoilMAEAAELLQVPAFAGLPDDQIAWFLSQAQELCVKRGE
Ga0134126_1004386813300010396Terrestrial SoilMVEKSELLMVPVFSDLPDDQIAWFLSQSEEVRLAVGETYVR
Ga0126345_105508523300010858Boreal Forest SoilMVEKSELIRVLAFADLPDDQLAWFLSQSQELHLKAGETYLRAGDPANA
Ga0126361_1063115313300010876Boreal Forest SoilMVETSELLRVPVFADLPDDQLAWFLSQSQELHLKA
Ga0137388_1064770513300012189Vadose Zone SoilMVEKSELRRVTEFADLPDDQLDWFISQSQEMNLKAG
Ga0137383_1058731723300012199Vadose Zone SoilMINKSELLRVPTFADLPDDQLEWFLSQSHEQLLKPGDTYIR
Ga0137365_1043224623300012201Vadose Zone SoilMAEALELLRKVPVFSDIPDDQIAWFMSQSRELRLEAGNTYVRQG
Ga0137363_1010300433300012202Vadose Zone SoilMVDKSELLRVPAFADLPDYLIAWFLSQAQETPIKACDTFVRQ
Ga0137363_1012148113300012202Vadose Zone SoilMIEKSELLHVPTFADLPDEQLEWFLSQCQEQLLQPGDT
Ga0137381_1089930123300012207Vadose Zone SoilMVDKSELLRVPAFADLPEDQVAWFLSNSEEVRVAAGDT*
Ga0137360_1007805143300012361Vadose Zone SoilMTDKSELLHVPVFADLPDDQIAWFLGQSQEVHIKAG
Ga0137360_1051668713300012361Vadose Zone SoilMVDKSELLRVPAFADLPDDQIAWFLGHSQEVRLAAGDI
Ga0137419_1191682223300012925Vadose Zone SoilMIAKSELLRVPAFADLPDDQITWFLSQSQEMHLKA
Ga0164298_1144663923300012955SoilMVEKSELLQVPVFADLPDDQIGWFISQSQELHIKEGE
Ga0164301_1056320713300012960SoilMATKAELLKVPVFADLPDDQVEWFLSQAPELPLKAG
Ga0164308_1027408323300012985SoilMVQKSELLRVPVFAVPPADRGDWFIGQSKELNVKAGETYIHQGDPADS
Ga0157374_1057079113300013296Miscanthus RhizosphereMVDKSQLLRVPVFADLPDEQIDWFISQSHEMSLKAGDVYA
Ga0157372_1079743923300013307Corn RhizosphereMIDKSELRRLPAFADLPDDQISWFLANSQEAHLAA
Ga0157372_1200414723300013307Corn RhizosphereMIDKAELLRVPAFNELPDDQIEWFISQAEEMVLNAGDV
Ga0181524_1008337423300014155BogMVEQSELLRVPVFADLPDDQIAWFISQSQEMNLKAG
Ga0181526_1079718813300014200BogMVKNSELLRVPAFADLPDDQLAWFISQAEEFHYKAGDTYLRQGTPADAM
Ga0182024_1127059513300014501PermafrostMVEHSELLRVPVFASLPDDQIAWFIAQAEELALKAGES
Ga0181525_1068238713300014654BogMVDKSELRRVPVFADLPDDQLDWFLSQAQEMSLKAGDTYARPGDPAD
Ga0137411_107563713300015052Vadose Zone SoilMAEKSELLRVPAFADLPDDQIAWFIGQSEELHLKQSEELHLKGG
Ga0132256_10139543923300015372Arabidopsis RhizosphereMIDKAELLRVPAFNELPDDQIEWFISQAEEMVLNAGDVIFRP
Ga0182040_1173133423300016387SoilMAKKSELQRVPAFADLPDDQLDWFLRQVEELRVKAGDT
Ga0182038_1177187823300016445SoilMVDKAELLRVPAFADLPDDQLDWFLSNSQELHVAVGD
Ga0187825_1039497623300017930Freshwater SedimentMAENSELLRVPAFADLPDDQISWFIGQAEELRLTVGEMYFRE
Ga0187848_1016125923300017935PeatlandMVENSELLLVPAFADLPEDQIAWFITQAQELRYKAG
Ga0187819_1030563323300017943Freshwater SedimentMVEKSELVRVPAFADLPDDQIEWFLSQAEEMHLKAG
Ga0187819_1073896923300017943Freshwater SedimentMVENSELLGVPVFAGLPDDQITWFIGQARDMLVKAG
Ga0187879_1068245013300017946PeatlandMVKNSELLRVPAFADLPDDQLAWFISQAEEFHYKA
Ga0187785_1010054413300017947Tropical PeatlandMVSPADLSRFPAFADLPEDQIAWFLSKTQEVCLKAGE
Ga0187778_1095577213300017961Tropical PeatlandMVEPAELRRVPVFGDLPDDQIAWFLSQSQELRAKAGDIY
Ga0187822_1013641813300017994Freshwater SedimentMIEKTQLLRIPSFADLPDDQIEWFLSQAEDLRFKGGDILINP
Ga0187816_1015297013300017995Freshwater SedimentMVEISELLRVPAFAALPEDQLTWFLSQSEELHLKPGDTFVRQNDPADAMFVV
Ga0187804_1001856713300018006Freshwater SedimentMADTLELLRKVPAFAGTPDDQLAWFLSKAQEVQVQAGDVYARQA
Ga0187880_132856713300018016PeatlandMVENSELLRVPVFADLPDDQLAWFLSQSQELRYKAGDTYL
Ga0187861_1034741113300018020PeatlandMVENSELLRVPVFADLPDDQLAWFLSQSQELRYKAGDTYLRQGT
Ga0187887_1062310023300018043PeatlandMIEPSELRRVPAFADLPDEQIAWFIGEAGELHLNAGETY
Ga0187887_1094267813300018043PeatlandMVDKLELRRVPTFADLPDDQLDWFISQSQELILKAGDVYAQ
Ga0187771_1178755523300018088Tropical PeatlandMADSTELLRRVPVFTDLPDDQIAWFLSRSQDLRLKAGESYSRQ
Ga0187770_1102260113300018090Tropical PeatlandMVETSELLRIPVFAGLPDDQIGWFISQAVEVPLKAGETYFR
Ga0066655_1027538023300018431Grasslands SoilMVEKSELLRVPAFADLPDDQITWFLAQSQAVHLSA
Ga0066655_1141987913300018431Grasslands SoilMMIEKFDLLRVPTFANLPDDQLEWFISQCHEQLLNPGDTYIRQ
Ga0182028_140205043300019788FenMVENSGLLLVPAFTDLPDDQIAWFISQAQELRYKAGDTYVR
Ga0193746_100737113300019870SoilMAEKSELLRIPVFADVPDDQLEWFLSQCQEEFLKPGDTYVR
Ga0193747_109410023300019885SoilMIDKSELLRVPVFADLPDDQLAWFLSQTQEVHLKAGDIYMRVGEPAEFM
Ga0193726_100767873300020021SoilMANRAELLHVSTFADLPDDQIEWFLSQSQEMSIKAGETYT
Ga0193753_1027571913300020034SoilMTTNSELLQVPVFADLPEDQIAWFLSQSQEMNLKAGET
Ga0210407_1002644053300020579SoilMVTPSELLRFPAFADLPDDQIAWFLGQSQEKSLKAG
Ga0210407_1042786823300020579SoilMVDKSELIRVPAFAGLPDDQIAWFLGNSQEVHFAAGDV
Ga0210407_1057207813300020579SoilMAEISELLARVPVFEGLPDDQIAWFLSQAQELQLKAGDVYAR
Ga0210407_1106155613300020579SoilMVTPSELLRFPAFAGLPDDQIAWFLGQSQEKSLKAGE
Ga0210403_1009297233300020580SoilMAEKSELLRVPVFADLPDDQIEWFLSQSQELHLKAGE
Ga0210399_1044840923300020581SoilMAEAIELLRAVPAFAGLPDDQIDWFLSQAQEVRLKAGEP
Ga0210399_1068119223300020581SoilMVEKSDLLRVPVFADLPDDQLDWFISQSQELHLKAGEGYARQ
Ga0210399_1069298413300020581SoilMADKAELRRVPVFTDLPDEQLDWFLSKSEEVRAKR
Ga0210399_1090690213300020581SoilMVENSELLRVPAFADLPNDQLAWFLSQAQELHLKAGETYLRAGDPANV
Ga0210395_1083472813300020582SoilMVDKTELRRVTEFADLPDDQLDWFLSQSQEMHLKAGEMY
Ga0210401_1083825023300020583SoilMVEKSELLRVPAFADLPDDQIAWFINQSQELHLKAGDT
Ga0179596_1011296613300021086Vadose Zone SoilMAEKSELLRVPAFADLPDEQIAWFISQSEEVRLKPGDINIREGDLADTMFVV
Ga0210404_1063512723300021088SoilMVDKSELRRVQEFADLPDDQLDWFLSQAKELNLKAGDTYARQGD
Ga0210406_1119093623300021168SoilMADKSELLKVPVFADLPDDQLDWFLSQSTELQLKSGQSYSRQ
Ga0210405_1081886013300021171SoilMVEKSELLRVPVFADLPDDQIAWFISQSQELHLKAGDSSTRQ
Ga0210405_1111264223300021171SoilMTAKTELLRVPVFADLPEDQISWFLSQAEELRFKAGDT
Ga0210396_1002817413300021180SoilMVETSELLHRIPAFDGLPDDQIAWFLSQSKELHLKQGDSYA
Ga0210396_1036721513300021180SoilMATPEELLRFPAFADLPEDQIAWFLSQSREVTLKAGEI
Ga0210396_1081836813300021180SoilMVDKSELLRFPIFADLPDDQIEWFISQSQELDVKSGEI
Ga0210388_1172653213300021181SoilMADISELKRVPAFADLPDDQLVWFLSQSQELNLKA
Ga0210393_1005842813300021401SoilMADKSELLRVPAFVDLPDDQLDWFLSQSHELHLKA
Ga0210385_1021991523300021402SoilMVEKSELLRVPVFADLPDDQIAWFISQSQELHLKAGDNSTRQ
Ga0210385_1128000413300021402SoilMVDKSELRRVTIFADLPDDQVDWFLSQTQEMNLKAGDT
Ga0210389_1021889313300021404SoilMVEKSDLRRVPAFADLPDDQLDWFLGNSQELHTAVGDT
Ga0210387_1148573623300021405SoilMVEKSELLKVPAFADLPDDQITWFLSQAKEINIKAG
Ga0210387_1168461823300021405SoilMIDKSELRHVPVFADLPDDQLDWFISESQEMNLKAGDVYS
Ga0210394_1126340523300021420SoilMAENSELLRVPVFAGLPDDQISWFISQAVDLPLRAGE
Ga0210394_1148368923300021420SoilMVEKSELLRVPVFADLPDDQLDWFISQAQELHLKAG
Ga0210384_1106775523300021432SoilMVEKSELLRVPAFAGLPDDQISWFLDNSQEIRVAAG
Ga0210384_1187342623300021432SoilMVENSELLRVPVFADLPDDQIAWFLSHTEDMHLKA
Ga0210391_1110122813300021433SoilMVENSELLRVPVFAGLPDDQISWFISQAIEAPLKAGE
Ga0210392_1051270323300021475SoilMVEIPELRRVAPFADSTDDQLSWFLSQAQELNLKPGDTYVRPGSPAAT
Ga0210402_1047372313300021478SoilMIDKSELRHVPVFADLPDDQLDWFISESQEMNLKAGDIYSRQG
Ga0210410_1033018213300021479SoilMADKSELLRVPVFADLPDDQIDWFISQSQELHLKAGD
Ga0126371_1209390813300021560Tropical Forest SoilMADQSELLRFPAFADLPEDQVAWFLGQSQELKLKAGEI
Ga0126371_1281609213300021560Tropical Forest SoilMVDKSELLRVPAFAGLPDDQIAWFLDNSQELRLAPGDFYAH
Ga0213849_116068023300021857WatershedsMVEKSELRAVPAFADSSDDQLDWFIGQAQEIRFQAGDTYLRA
Ga0224546_101404023300022515SoilMVEKSELLRVPVFSDLPDDQIEWFISQSRELFYKAGDIYSR
Ga0212123_1022411023300022557Iron-Sulfur Acid SpringMVEKSELIRVAAFADLPDDQLAWFLSQSQELHLKAGETYLRAGDPANA
Ga0212123_1066299813300022557Iron-Sulfur Acid SpringMVEKSEILRVPVFADLPDDQLDWFISQSQEMNLKAGDVYAHEGD
Ga0228598_109347223300024227RhizosphereMVEKSQLLRVPVFADLPDDQLDWFISQSEELHLKA
Ga0224564_111319023300024271SoilMVEKSELLRVPVFVDLPGDQIAWFIGNAEELRLKA
Ga0208194_100652333300025412PeatlandMVDKSELLRVPAFADLPDDQLNWFISQSQELNLKA
Ga0208690_106035123300025434PeatlandMADKSELLRVPAFADLPDDQLEWFLSQSQELNYKAGDTYLRQGTP
Ga0207692_1012255223300025898Corn, Switchgrass And Miscanthus RhizosphereMVEASELGRLPIFADLPEDQIAWFISQSQELTLKADEF
Ga0207647_1003440043300025904Corn RhizosphereMIDKSELRRLPAFADLPDDQISWFLANSQEAHLAAG
Ga0207693_1075088813300025915Corn, Switchgrass And Miscanthus RhizosphereMVDKSELLRVPAFAGLPDDQLAWFLSQAQELHLKAGEMYLRAGD
Ga0207660_1013299023300025917Corn RhizosphereMADKTELRKVSEFTDLPDDQLDWFLGVTEELHLKA
Ga0207660_1125101213300025917Corn RhizosphereMIDKAELLRVPAFSELPDDQIEWFISQAEEMVLNAG
Ga0207649_1027853413300025920Corn RhizosphereMATKAELLKVPVFADLPDDQVEWFLSQAPELPLKAGETYF
Ga0207646_1108540513300025922Corn, Switchgrass And Miscanthus RhizosphereMIEKSELLRIPTFADLPDEQLEWFLSQCQEQFLKAGDTYIRQG
Ga0207646_1150871113300025922Corn, Switchgrass And Miscanthus RhizosphereMVDKSELLRVPAFVDLPDDQIAWFLSQSQETHIKAGDT
Ga0207700_1075065523300025928Corn, Switchgrass And Miscanthus RhizosphereMADKSELRRVVVFNDLPDDQIDWFLSQSKEVHLNAGD
Ga0207664_1044344623300025929Agricultural SoilMAEKSELLRIPVFADVPDDQLEWFLSQCQEEFLKPGDTYA
Ga0207670_1072466323300025936Switchgrass RhizosphereMATKAELLKVPVFADLPDDQVEWFLSQAPELPLKAGETYFRQGDP
Ga0207661_1179866123300025944Corn RhizosphereMADKTELRKVSEFTDLPDDQLDWFLGVTEELHLKAGE
Ga0207639_1089719113300026041Corn RhizosphereMATKAELLKVPVFADLPDDQVEWFLSQAPELPLKAGETY
Ga0209890_1012202523300026291SoilMVENSELLRVPAFSGLPDDQISWFISQAQEIHMRA
Ga0209802_117359513300026328SoilMADKAELLRVPTFADLPEDQLDWFLSRCQEQLLKPGDTY
Ga0209059_121704623300026527SoilMAEKSELLRIPVFADVPDDQLEWFLSQCQEEFLKPG
Ga0209056_1036087913300026538SoilMIDKSELLRVPVFADLPDDQLAWFLSQTQEVQLNAGDIYMRVGEPA
Ga0209648_1018997323300026551Grasslands SoilMADKSELLRIPAFANLPDDQIAWFLSQSQELSLKPDGI
Ga0208860_102282313300027076Forest SoilMVDKSELLRVPVFNDLPDDQIAWFISQSQEMKLKAGES
Ga0208488_100792913300027110Forest SoilMAEISELLRRVPVFADLPDDQISWFLNQTQDLQLKTGEHYT
Ga0209421_112780013300027432Forest SoilMVEISELARVPAFEGLPEDQLAWFLSQSQELHLQPGEIYVRQNDP
Ga0208199_112934123300027497Peatlands SoilMAEAAELLQVPAFAGLPDDQIAWFLSQAQELCVKGGET
Ga0207761_102171813300027516Tropical Forest SoilMVDSSELLQRVPVFAGLPEDLLAWFLSRAQELQLE
Ga0209115_105047313300027567Forest SoilMVEKSELLKVPAFADLPDDQITWFISQAQELNLKA
Ga0209733_109112313300027591Forest SoilMVETSELLGVPLFADLPDDQLAWFLSQSQELRLKAGEVYSRQGDP
Ga0209528_109277523300027610Forest SoilMIDKSELLRVPVFADLPDDQIAWFISQSQEMKLKAGDVY
Ga0209420_101388713300027648Forest SoilMVDKSELLRVPAFADLPDDQLDWFLSQSQELNLKAGEVYAQQGTP
Ga0209007_111051013300027652Forest SoilMVDKAELLRVPIFADLPEDQIEWFLSQSQELNLKAGE
Ga0209118_106771023300027674Forest SoilMVEKSELIRVPAFADLPDDQLDWFLSQAQELHLKAGETYLRAGDPANAM
Ga0209530_119178813300027692Forest SoilMVEKSELFTVPAFAGLPDDQIAWFISQSEEIRAKAGDTSFRE
Ga0209581_126455213300027706Surface SoilMMDKSDLRHVSIFADLPEDQLAWFLSQSQEQILRAGETYIR
Ga0209581_128214513300027706Surface SoilMDKSDLRHVPVFADLPDDQISWFLSQCQEHTLQPGETYI
Ga0208989_1010212623300027738Forest SoilMVDKSELLRVPVFADLPDDQLAWFISQSQEMKLKA
Ga0209689_115101223300027748SoilMVEKSELIRVPAFADLPDDQLAWFLSQAQELHLKAGETYLRAGDPA
Ga0209139_1024245413300027795Bog Forest SoilMVTNSELLAVPAFAGLPDDQITWFISRSEELVVKAG
Ga0209656_1015618913300027812Bog Forest SoilMVDKSELLRLPVFADLPDDQIDWFIGQSQEMTLKAGEV
Ga0209811_1011882313300027821Surface SoilMIDKSELRRVPAFADLPDDQIAWFLSQSLETHVAAGETY
Ga0209811_1030927813300027821Surface SoilMIDKSELRRLPAFADLPDDQISWFLANSQETHLAAG
Ga0209040_1010458423300027824Bog Forest SoilMVDKSELLRVPVFADLPDEQLDWFISQSQEMHLKAGDAYSRQG
Ga0209039_1025817813300027825Bog Forest SoilMVDKSELVRVPEFADLPEDQLDWFISQSQEVNTKAG
Ga0209060_1024475923300027826Surface SoilMSSIEELLKVPVFAGLPEEQIEWFLSRTEELRFKAGDT
Ga0209580_1013507113300027842Surface SoilMIEKLELLRVPAFADLPDDQIAWFIAHSEELRLNSGDT
Ga0209580_1052886923300027842Surface SoilMAEAAELLRVNAFAGLPGDQIAWFLSQAQELHFKDGE
Ga0209166_10000466453300027857Surface SoilMTDARELLRRVPAFVGLPDDQVEWFLSQSQELRLNAGDPYARRGD
Ga0209167_1058767213300027867Surface SoilMIENAALLGIPVFAGLPDDQIAWFLSQAEELRFKAGDIL
Ga0209579_1026548113300027869Surface SoilMVDKSELLRIPIFADLPDNQLDWFISQSQELHLKAGEGY
Ga0209579_1030268233300027869Surface SoilMVEKSELRKAPVFADLPDDQLDWFISQSEELQLKAGDTY
Ga0209283_1041944613300027875Vadose Zone SoilMINKSELLRVPTFADLPDDQLEWFLSQSHEQLLKPGDTY
Ga0209169_1009722013300027879SoilMVDKSELRRVQEFADLPDDQLDWFLSQAQELKLKAGDVYSRPGDPADTM
Ga0209380_1000940513300027889SoilMADKSELLRVPVFADLPDDQLEWFLSQSQELNYKAGDTYLRQGTPA
Ga0209380_1021107023300027889SoilMVDKSELRRVQEFADLPDDQLDWFLSRAQELHLKA
Ga0209380_1034292923300027889SoilMVEKSDLRRVPAFADLPDDQLDWFLGNSRELNVAVGDTYIRQGDP
Ga0209624_1100417623300027895Forest SoilMVDKSELLRVAEFADLPDDQIAWFLSQSQEMNLKAGDI
Ga0209067_1024474423300027898WatershedsMAEISELLGRVPVFESLPDDQIAWFLSHAQELHLKAGD
Ga0209488_1117817123300027903Vadose Zone SoilMVEKSELIRVPAFADLPDDQLDWFLSQAQELHLKAGETYLRAGDPANAMFVI
Ga0209006_1010566533300027908Forest SoilMADKSELRSVPVFNDLPDDQLTWFLGNSQELQVTPGDV
Ga0209698_1067567613300027911WatershedsMVEKSELLRVSAFADLPDDQLAWFISQSEELRLKAGDT
Ga0268264_1103622923300028381Switchgrass RhizosphereMVDKSELRRVPAFEGLPDDQLDWFLSQSNEIHMKAGDILVR
Ga0302224_1026904113300028759PalsaMVEKSEILRVPAFADLPDDQISWFLANSQEMRVAAGDVY
Ga0222749_1022213613300029636SoilMIEKTQLLRVPAFADLPDDQIEWFLSQAEELRFKAGETLI
Ga0311368_1080610923300029882PalsaMVEKSELLRVPAFADLPDDQIAWFISQSQELHLKAGDTYA
Ga0311369_1139150313300029910PalsaMVETSELLRVPVFADLPVDQIEWFLSQAQEMHLKAGDT
Ga0311363_1121209923300029922FenMVEKSELQRVAEFADLPDDQLDWFISQAQEINVKAGSVLSHQGEPA
Ga0302304_1029077323300029993PalsaMVDKSELRRVPVFADLPDDQLDWFLSQAQEMNLKAGDTYARPGDPADAMF
Ga0302270_1054754313300030011BogMIEKSELLEAPAFAGLPDDQIAWFISQSEELLFKAGDYYS
Ga0302183_1021249823300030509PalsaMIENKELLRVPVFAGLPDDQVAWFISQSEERHYKAGETYSH
Ga0311356_1182794923300030617PalsaMVDKSELRRVPVFADLPDDQLDWFLSQAQEMNLKAGDTYARPGDPAD
Ga0311354_1048519823300030618PalsaMIENSELLGVPAFAGLPDDQLTWFIGQSQEIALKAGDSYFREGDP
Ga0307482_118606813300030730Hardwood Forest SoilMTDKEELLRVPAFAGLPDDQLDWFLSQVEDLRFNA
Ga0302310_1019041723300030737PalsaMTELSELLRRVPVFADLPDDQISWFLSQSQDLQLKAGEYYT
Ga0302311_1056733123300030739PalsaMVENSALLKVPAFVDLPEDQITWFISHTNEMNLRAGET
Ga0138296_145751713300030923SoilMVEKSELVRVPAFADLPDDQLDWFLSQAQELHLKPGETYLRAGDPANAM
Ga0302307_1018160923300031233PalsaMVDKSELRRVPVFADLPDDQLDWFLSQAQEMNLKAGDTY
Ga0302318_1023447513300031258BogMIEKSELLEAPAFAGLPDDQIAWFISQSEELLFKAGDY
Ga0302326_1144011023300031525PalsaMVDKSELLSFPIFADLPDDQINWFIGKSQELQLKAGLSYTRQG
Ga0302326_1345447013300031525PalsaMVDKSELLRVPVFADLPDDQIAWFISQAQELRLKVG
Ga0307483_102075513300031590Hardwood Forest SoilMVEKSELLRIPAFADLPDDQIEWFLSQSQELNLKAGE
Ga0310686_10419003113300031708SoilMVEKADLRRVPAFADLPDDQLDWFLGNSQELHVAAGDSYI
Ga0307476_1000411913300031715Hardwood Forest SoilMVDNSELLRVPVFADLPDDQLAWFISQSQEMNLKAGDVYARQGD
Ga0307476_1008509313300031715Hardwood Forest SoilMVEKSDLRRVPAFADLPDDQLDWFLGNSQELRVAVGDTYIRQGD
Ga0307476_1037320013300031715Hardwood Forest SoilMIEKSELLRAPAFAGLPDDQIAWFISQSQEVHLKAGEIYSRE
Ga0307474_1057215313300031718Hardwood Forest SoilMVEKSELNRVPAFADLPDDQLDWFLSQAQELHLKAGEAYLRAGDPANAMFV
Ga0307475_1041706413300031754Hardwood Forest SoilMVEKSELLRVPAFADLPDDQIAWFLSESEEMHLKAGD
Ga0307473_1051524813300031820Hardwood Forest SoilMVEKSELLRVPVFVDLPDDQIAWFIGNTEEIRLKAGDAY
Ga0306919_1099076323300031879SoilMVSPSELERLPVFADLPADQIAWFLEQAREIHLKA
Ga0318549_1032771313300032041SoilMVDKSELLRVPAFAGLPDDQIAWFLSNSRELHLAPG
Ga0318533_1048133723300032059SoilMVDKSELLRVPAFAGLPDDQIAWFLGNSQELRLAPGD
Ga0306924_1152068913300032076SoilMVEASELRRITVFADLPDDQIAWFLGQSEEVVLKPDDVYVHVG
Ga0307415_10048277323300032126RhizosphereMIRKEELLRVPAFAGLPDDQLEWFLAQSQELNVKAGETVF
Ga0311301_1182190913300032160Peatlands SoilMAETVDLLRRVPVFADLPNDQMAWFLSESQEMRLKAGE
Ga0307471_10023927533300032180Hardwood Forest SoilMVENSELLRVPVFAGLPDDQIAWFLGQAEELRLKAGD
Ga0307471_10054963113300032180Hardwood Forest SoilMIAKSELLRVPAFADLPDDQITWFLSQSQEIHLKAG
Ga0307471_10072144613300032180Hardwood Forest SoilMVEKSELIRVPAFADLPDDQLDWFLSQAQELHLKPGETYLRAGDP
Ga0307471_10219415223300032180Hardwood Forest SoilMVENSELLRVPAFVDLPDEQIAWFLSQAQELHLKAGETYLRAGDPANVMFV
Ga0307472_10109152223300032205Hardwood Forest SoilMIDKSELLRVPVFADLPDDQIAWFLSQCQEQILKPGDTYI
Ga0335077_1112645313300033158SoilMATSTELMRFPAFAGLPEEQITWFLSQSREQSLKAGEIFARQGDPP
Ga0310914_1027793023300033289SoilMVDQSELARFPIFADLPVDQIEWFLANGKEIQLKAGEIYARQG
Ga0310810_1021759413300033412SoilMVEKSELRKVAAFAGLPDDQLDWFLSQSQELLLKSG
Ga0316628_10263074413300033513SoilMVGPSELLRVPAFADLPENQLTWFIGQSQELHLKAGDILSNQGDPA


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.