Basic Information | |
---|---|
Family ID | F016553 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 246 |
Average Sequence Length | 42 residues |
Representative Sequence | LGRARLTGNTTIDQKIPLKGLKDKPRRAVLNYYDDVLASPN |
Number of Associated Samples | 209 |
Number of Associated Scaffolds | 246 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 0.42 % |
% of genes near scaffold ends (potentially truncated) | 94.31 % |
% of genes from short scaffolds (< 2000 bps) | 89.02 % |
Associated GOLD sequencing projects | 199 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.20 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (92.276 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (15.854 % of family members) |
Environment Ontology (ENVO) | Unclassified (21.951 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (52.846 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 5.80% β-sheet: 0.00% Coil/Unstructured: 94.20% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.20 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 246 Family Scaffolds |
---|---|---|
PF00756 | Esterase | 4.07 |
PF13393 | tRNA-synt_His | 3.25 |
PF13602 | ADH_zinc_N_2 | 2.44 |
PF02410 | RsfS | 1.63 |
PF01641 | SelR | 1.22 |
PF07593 | UnbV_ASPIC | 0.81 |
PF12543 | DUF3738 | 0.81 |
PF01467 | CTP_transf_like | 0.81 |
PF13517 | FG-GAP_3 | 0.81 |
PF00005 | ABC_tran | 0.81 |
PF13456 | RVT_3 | 0.41 |
PF07885 | Ion_trans_2 | 0.41 |
PF07589 | PEP-CTERM | 0.41 |
PF01547 | SBP_bac_1 | 0.41 |
PF07676 | PD40 | 0.41 |
PF01618 | MotA_ExbB | 0.41 |
PF13683 | rve_3 | 0.41 |
PF05580 | Peptidase_S55 | 0.41 |
PF12704 | MacB_PCD | 0.41 |
PF02687 | FtsX | 0.41 |
PF08240 | ADH_N | 0.41 |
PF13231 | PMT_2 | 0.41 |
PF03928 | HbpS-like | 0.41 |
PF14310 | Fn3-like | 0.41 |
PF01841 | Transglut_core | 0.41 |
PF02151 | UVR | 0.41 |
PF01765 | RRF | 0.41 |
PF04389 | Peptidase_M28 | 0.41 |
PF06123 | CreD | 0.41 |
PF03544 | TonB_C | 0.41 |
PF00899 | ThiF | 0.41 |
PF00571 | CBS | 0.41 |
PF00107 | ADH_zinc_N | 0.41 |
PF13489 | Methyltransf_23 | 0.41 |
PF13474 | SnoaL_3 | 0.41 |
PF14492 | EFG_III | 0.41 |
PF03551 | PadR | 0.41 |
PF00364 | Biotin_lipoyl | 0.41 |
PF00497 | SBP_bac_3 | 0.41 |
PF07617 | DUF1579 | 0.41 |
COG ID | Name | Functional Category | % Frequency in 246 Family Scaffolds |
---|---|---|---|
COG0799 | Ribosomal silencing factor RsfS, regulates association of 30S and 50S subunits | Translation, ribosomal structure and biogenesis [J] | 1.63 |
COG0229 | Peptide methionine sulfoxide reductase MsrB | Posttranslational modification, protein turnover, chaperones [O] | 1.22 |
COG0233 | Ribosome recycling factor | Translation, ribosomal structure and biogenesis [J] | 0.41 |
COG0810 | Periplasmic protein TonB, links inner and outer membranes | Cell wall/membrane/envelope biogenesis [M] | 0.41 |
COG1695 | DNA-binding transcriptional regulator, PadR family | Transcription [K] | 0.41 |
COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 0.41 |
COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 0.41 |
COG4452 | Inner membrane protein CreD involved in colicin E2 resistance | Defense mechanisms [V] | 0.41 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 92.28 % |
Unclassified | root | N/A | 7.72 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2170459024|GZRSKLJ02ISFG0 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 508 | Open in IMG/M |
3300000567|JGI12270J11330_10049084 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2276 | Open in IMG/M |
3300001867|JGI12627J18819_10457279 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 523 | Open in IMG/M |
3300002245|JGIcombinedJ26739_101322523 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 612 | Open in IMG/M |
3300002680|Ga0005483J37271_103258 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 904 | Open in IMG/M |
3300003369|JGI24140J50213_10247172 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 548 | Open in IMG/M |
3300004092|Ga0062389_101953486 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 764 | Open in IMG/M |
3300004117|Ga0058893_1339230 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 776 | Open in IMG/M |
3300004609|Ga0068958_1252917 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 894 | Open in IMG/M |
3300004631|Ga0058899_10020485 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 795 | Open in IMG/M |
3300005166|Ga0066674_10314833 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 735 | Open in IMG/M |
3300005181|Ga0066678_10514708 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 795 | Open in IMG/M |
3300005332|Ga0066388_107347998 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 553 | Open in IMG/M |
3300005434|Ga0070709_10227954 | All Organisms → cellular organisms → Bacteria | 1332 | Open in IMG/M |
3300005436|Ga0070713_101380520 | Not Available | 683 | Open in IMG/M |
3300005437|Ga0070710_10711029 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 710 | Open in IMG/M |
3300005450|Ga0066682_10339865 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 967 | Open in IMG/M |
3300005536|Ga0070697_100117625 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium | 2220 | Open in IMG/M |
3300005541|Ga0070733_10312120 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1040 | Open in IMG/M |
3300005541|Ga0070733_10531107 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter | 788 | Open in IMG/M |
3300005542|Ga0070732_10679306 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 626 | Open in IMG/M |
3300005545|Ga0070695_101692047 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 529 | Open in IMG/M |
3300005552|Ga0066701_10740003 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 589 | Open in IMG/M |
3300005554|Ga0066661_10593304 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 658 | Open in IMG/M |
3300005586|Ga0066691_10437846 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 780 | Open in IMG/M |
3300006028|Ga0070717_10342289 | All Organisms → cellular organisms → Bacteria | 1336 | Open in IMG/M |
3300006028|Ga0070717_11913630 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 535 | Open in IMG/M |
3300006052|Ga0075029_100199445 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1249 | Open in IMG/M |
3300006052|Ga0075029_100957372 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 589 | Open in IMG/M |
3300006059|Ga0075017_101331764 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
3300006059|Ga0075017_101527475 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 526 | Open in IMG/M |
3300006086|Ga0075019_10102110 | All Organisms → cellular organisms → Bacteria | 1649 | Open in IMG/M |
3300006102|Ga0075015_100552114 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 669 | Open in IMG/M |
3300006176|Ga0070765_100285874 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1521 | Open in IMG/M |
3300006354|Ga0075021_10644216 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 678 | Open in IMG/M |
3300006358|Ga0068871_102228223 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 522 | Open in IMG/M |
3300006794|Ga0066658_10274341 | All Organisms → cellular organisms → Bacteria | 903 | Open in IMG/M |
3300009088|Ga0099830_11296587 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 605 | Open in IMG/M |
3300009089|Ga0099828_10513226 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1081 | Open in IMG/M |
3300009101|Ga0105247_11739381 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 517 | Open in IMG/M |
3300009137|Ga0066709_102862025 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 638 | Open in IMG/M |
3300009177|Ga0105248_10310755 | All Organisms → cellular organisms → Bacteria | 1775 | Open in IMG/M |
3300009519|Ga0116108_1064642 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1139 | Open in IMG/M |
3300009520|Ga0116214_1109008 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1020 | Open in IMG/M |
3300009547|Ga0116136_1107256 | Not Available | 723 | Open in IMG/M |
3300009621|Ga0116116_1112286 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 737 | Open in IMG/M |
3300009623|Ga0116133_1092746 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 764 | Open in IMG/M |
3300009635|Ga0116117_1151389 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 597 | Open in IMG/M |
3300009639|Ga0116122_1089136 | Not Available | 1010 | Open in IMG/M |
3300009643|Ga0116110_1046507 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1569 | Open in IMG/M |
3300009644|Ga0116121_1182669 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 665 | Open in IMG/M |
3300009683|Ga0116224_10038499 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2345 | Open in IMG/M |
3300009698|Ga0116216_10593071 | All Organisms → cellular organisms → Bacteria | 668 | Open in IMG/M |
3300009824|Ga0116219_10594283 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 608 | Open in IMG/M |
3300009824|Ga0116219_10633507 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 587 | Open in IMG/M |
3300009839|Ga0116223_10178103 | All Organisms → cellular organisms → Bacteria | 1309 | Open in IMG/M |
3300010046|Ga0126384_10309138 | All Organisms → cellular organisms → Bacteria | 1302 | Open in IMG/M |
3300010046|Ga0126384_10800609 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 844 | Open in IMG/M |
3300010048|Ga0126373_10180370 | All Organisms → cellular organisms → Bacteria | 2032 | Open in IMG/M |
3300010323|Ga0134086_10063364 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1268 | Open in IMG/M |
3300010325|Ga0134064_10037781 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1442 | Open in IMG/M |
3300010333|Ga0134080_10464948 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 595 | Open in IMG/M |
3300010359|Ga0126376_10376260 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1269 | Open in IMG/M |
3300010359|Ga0126376_12167935 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 600 | Open in IMG/M |
3300010360|Ga0126372_10075774 | All Organisms → cellular organisms → Bacteria | 2418 | Open in IMG/M |
3300010361|Ga0126378_11262758 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 835 | Open in IMG/M |
3300010366|Ga0126379_10601314 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1185 | Open in IMG/M |
3300010366|Ga0126379_13363624 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 536 | Open in IMG/M |
3300010373|Ga0134128_10952546 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 949 | Open in IMG/M |
3300010400|Ga0134122_10113940 | All Organisms → cellular organisms → Bacteria | 2158 | Open in IMG/M |
3300010401|Ga0134121_12647489 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 546 | Open in IMG/M |
3300011078|Ga0138565_1129623 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 900 | Open in IMG/M |
3300011120|Ga0150983_10851155 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1040 | Open in IMG/M |
3300011120|Ga0150983_15082296 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 992 | Open in IMG/M |
3300011998|Ga0120114_1064042 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 714 | Open in IMG/M |
3300012096|Ga0137389_11752566 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 517 | Open in IMG/M |
3300012198|Ga0137364_10330628 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1135 | Open in IMG/M |
3300012198|Ga0137364_10715689 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 756 | Open in IMG/M |
3300012207|Ga0137381_11175996 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 659 | Open in IMG/M |
3300012208|Ga0137376_10276515 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1457 | Open in IMG/M |
3300012208|Ga0137376_10570748 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 980 | Open in IMG/M |
3300012212|Ga0150985_118518102 | All Organisms → cellular organisms → Bacteria | 902 | Open in IMG/M |
3300012349|Ga0137387_10388398 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1012 | Open in IMG/M |
3300012351|Ga0137386_11216144 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 526 | Open in IMG/M |
3300012356|Ga0137371_11312155 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 535 | Open in IMG/M |
3300012469|Ga0150984_105986793 | All Organisms → cellular organisms → Bacteria | 867 | Open in IMG/M |
3300012532|Ga0137373_10679638 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 769 | Open in IMG/M |
3300012989|Ga0164305_12010463 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 528 | Open in IMG/M |
3300013308|Ga0157375_12217837 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 654 | Open in IMG/M |
3300014150|Ga0134081_10002461 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 4530 | Open in IMG/M |
3300014151|Ga0181539_1139111 | Not Available | 978 | Open in IMG/M |
3300014154|Ga0134075_10443804 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 576 | Open in IMG/M |
3300014159|Ga0181530_10319425 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 809 | Open in IMG/M |
3300014164|Ga0181532_10023397 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → unclassified Luteitalea → Luteitalea sp. | 4425 | Open in IMG/M |
3300014200|Ga0181526_10208282 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1250 | Open in IMG/M |
3300014657|Ga0181522_10178165 | All Organisms → cellular organisms → Bacteria | 1247 | Open in IMG/M |
3300015053|Ga0137405_1068409 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1161 | Open in IMG/M |
3300015373|Ga0132257_101547886 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 847 | Open in IMG/M |
3300016387|Ga0182040_10993199 | Not Available | 699 | Open in IMG/M |
3300016404|Ga0182037_10185052 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1602 | Open in IMG/M |
3300017822|Ga0187802_10017281 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2436 | Open in IMG/M |
3300017822|Ga0187802_10191224 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 786 | Open in IMG/M |
3300017927|Ga0187824_10379379 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 513 | Open in IMG/M |
3300017933|Ga0187801_10122010 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1001 | Open in IMG/M |
3300017933|Ga0187801_10142917 | All Organisms → cellular organisms → Bacteria | 928 | Open in IMG/M |
3300017933|Ga0187801_10502510 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 511 | Open in IMG/M |
3300017948|Ga0187847_10394282 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 761 | Open in IMG/M |
3300017959|Ga0187779_10809007 | Not Available | 640 | Open in IMG/M |
3300017972|Ga0187781_10227652 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1317 | Open in IMG/M |
3300017974|Ga0187777_10423070 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 924 | Open in IMG/M |
3300017988|Ga0181520_11042339 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 539 | Open in IMG/M |
3300017995|Ga0187816_10244870 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 782 | Open in IMG/M |
3300018005|Ga0187878_1149380 | Not Available | 907 | Open in IMG/M |
3300018006|Ga0187804_10061094 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1493 | Open in IMG/M |
3300018007|Ga0187805_10597683 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 521 | Open in IMG/M |
3300018013|Ga0187873_1126862 | Not Available | 989 | Open in IMG/M |
3300018013|Ga0187873_1129826 | All Organisms → cellular organisms → Bacteria | 974 | Open in IMG/M |
3300018026|Ga0187857_10184514 | Not Available | 978 | Open in IMG/M |
3300018037|Ga0187883_10092122 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1579 | Open in IMG/M |
3300018047|Ga0187859_10510042 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 670 | Open in IMG/M |
3300018057|Ga0187858_10542734 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 706 | Open in IMG/M |
3300018062|Ga0187784_11688009 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 502 | Open in IMG/M |
3300018085|Ga0187772_10125850 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1675 | Open in IMG/M |
3300018085|Ga0187772_10322659 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1062 | Open in IMG/M |
3300018088|Ga0187771_11516469 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 569 | Open in IMG/M |
3300018088|Ga0187771_11566225 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 559 | Open in IMG/M |
3300018090|Ga0187770_10102227 | All Organisms → cellular organisms → Bacteria | 2140 | Open in IMG/M |
3300018090|Ga0187770_10433950 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1034 | Open in IMG/M |
3300018090|Ga0187770_11801254 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 501 | Open in IMG/M |
3300018431|Ga0066655_10282853 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1074 | Open in IMG/M |
3300018433|Ga0066667_10228852 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1391 | Open in IMG/M |
3300018468|Ga0066662_11612987 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 677 | Open in IMG/M |
3300019278|Ga0187800_1141411 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 608 | Open in IMG/M |
3300019787|Ga0182031_1026670 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2 | 787 | Open in IMG/M |
3300020199|Ga0179592_10446667 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 559 | Open in IMG/M |
3300020581|Ga0210399_10950123 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 695 | Open in IMG/M |
3300021170|Ga0210400_11231213 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 602 | Open in IMG/M |
3300021171|Ga0210405_10504582 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 948 | Open in IMG/M |
3300021178|Ga0210408_10067249 | Not Available | 2798 | Open in IMG/M |
3300021178|Ga0210408_10420671 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1064 | Open in IMG/M |
3300021401|Ga0210393_10019133 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5310 | Open in IMG/M |
3300021405|Ga0210387_10866013 | All Organisms → cellular organisms → Bacteria | 796 | Open in IMG/M |
3300021406|Ga0210386_11397791 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
3300021432|Ga0210384_11386240 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 608 | Open in IMG/M |
3300021432|Ga0210384_11846040 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 510 | Open in IMG/M |
3300021433|Ga0210391_10890712 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 694 | Open in IMG/M |
3300021476|Ga0187846_10001088 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 15449 | Open in IMG/M |
3300021476|Ga0187846_10419885 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 549 | Open in IMG/M |
3300021478|Ga0210402_10744779 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 904 | Open in IMG/M |
3300022504|Ga0242642_1018834 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 924 | Open in IMG/M |
3300022504|Ga0242642_1025386 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 830 | Open in IMG/M |
3300022511|Ga0242651_1009719 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 878 | Open in IMG/M |
3300022522|Ga0242659_1029235 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 893 | Open in IMG/M |
3300022522|Ga0242659_1042954 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 778 | Open in IMG/M |
3300022525|Ga0242656_1015932 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1072 | Open in IMG/M |
3300022528|Ga0242669_1014103 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1077 | Open in IMG/M |
3300022531|Ga0242660_1050925 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 903 | Open in IMG/M |
3300022532|Ga0242655_10047207 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1049 | Open in IMG/M |
3300022532|Ga0242655_10072802 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 895 | Open in IMG/M |
3300022533|Ga0242662_10102967 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 816 | Open in IMG/M |
3300022533|Ga0242662_10353317 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 502 | Open in IMG/M |
3300022712|Ga0242653_1021945 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 899 | Open in IMG/M |
3300022712|Ga0242653_1024154 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 872 | Open in IMG/M |
3300022722|Ga0242657_1190938 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 561 | Open in IMG/M |
3300022724|Ga0242665_10061244 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1029 | Open in IMG/M |
3300024182|Ga0247669_1004699 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2888 | Open in IMG/M |
3300024220|Ga0224568_1015578 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 749 | Open in IMG/M |
3300024331|Ga0247668_1019085 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1417 | Open in IMG/M |
3300025473|Ga0208190_1111697 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
3300025507|Ga0208188_1003963 | All Organisms → cellular organisms → Bacteria | 5544 | Open in IMG/M |
3300025509|Ga0208848_1044568 | All Organisms → cellular organisms → Bacteria | 952 | Open in IMG/M |
3300025915|Ga0207693_10551334 | Not Available | 899 | Open in IMG/M |
3300025922|Ga0207646_10316791 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1409 | Open in IMG/M |
3300026023|Ga0207677_11611764 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 601 | Open in IMG/M |
3300026307|Ga0209469_1092529 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 868 | Open in IMG/M |
3300026322|Ga0209687_1161258 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 717 | Open in IMG/M |
3300026335|Ga0209804_1340754 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 504 | Open in IMG/M |
3300026514|Ga0257168_1028412 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1186 | Open in IMG/M |
3300026527|Ga0209059_1055963 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1726 | Open in IMG/M |
3300026547|Ga0209156_10186951 | All Organisms → cellular organisms → Bacteria | 993 | Open in IMG/M |
3300026548|Ga0209161_10058156 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2490 | Open in IMG/M |
3300027061|Ga0209729_1053588 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 514 | Open in IMG/M |
3300027432|Ga0209421_1021900 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1234 | Open in IMG/M |
3300027548|Ga0209523_1109999 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 570 | Open in IMG/M |
3300027652|Ga0209007_1135192 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 615 | Open in IMG/M |
3300027745|Ga0209908_10064667 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 840 | Open in IMG/M |
3300027783|Ga0209448_10181108 | All Organisms → cellular organisms → Bacteria | 701 | Open in IMG/M |
3300027842|Ga0209580_10334981 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 754 | Open in IMG/M |
3300027842|Ga0209580_10405510 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 679 | Open in IMG/M |
3300027867|Ga0209167_10512190 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 657 | Open in IMG/M |
3300027874|Ga0209465_10194327 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1012 | Open in IMG/M |
3300027898|Ga0209067_10664249 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 602 | Open in IMG/M |
3300027911|Ga0209698_11358156 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 519 | Open in IMG/M |
3300028047|Ga0209526_10614650 | All Organisms → cellular organisms → Bacteria | 694 | Open in IMG/M |
3300028146|Ga0247682_1003407 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2829 | Open in IMG/M |
3300028536|Ga0137415_11160439 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 586 | Open in IMG/M |
3300028646|Ga0302159_10023085 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1380 | Open in IMG/M |
3300029918|Ga0302143_1003515 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3394 | Open in IMG/M |
3300030019|Ga0311348_10851335 | All Organisms → cellular organisms → Bacteria | 679 | Open in IMG/M |
3300030545|Ga0210271_10072172 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 906 | Open in IMG/M |
3300030625|Ga0210259_10910357 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 965 | Open in IMG/M |
3300030627|Ga0210269_10061105 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 927 | Open in IMG/M |
3300030627|Ga0210269_10105339 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 795 | Open in IMG/M |
3300030659|Ga0316363_10357327 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 574 | Open in IMG/M |
3300030740|Ga0265460_10509898 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 939 | Open in IMG/M |
3300031028|Ga0302180_10072239 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2028 | Open in IMG/M |
3300031128|Ga0170823_13979038 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 639 | Open in IMG/M |
3300031231|Ga0170824_126531379 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 708 | Open in IMG/M |
3300031238|Ga0265332_10076758 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1420 | Open in IMG/M |
3300031250|Ga0265331_10111298 | Not Available | 1256 | Open in IMG/M |
3300031446|Ga0170820_12863730 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 505 | Open in IMG/M |
3300031595|Ga0265313_10052010 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1957 | Open in IMG/M |
3300031720|Ga0307469_12092057 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 550 | Open in IMG/M |
3300031720|Ga0307469_12230542 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
3300031754|Ga0307475_10651734 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 841 | Open in IMG/M |
3300031754|Ga0307475_10958001 | All Organisms → cellular organisms → Bacteria | 674 | Open in IMG/M |
3300031820|Ga0307473_10590276 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 765 | Open in IMG/M |
3300031823|Ga0307478_10537818 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 975 | Open in IMG/M |
3300031823|Ga0307478_11092338 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 666 | Open in IMG/M |
3300031910|Ga0306923_12252190 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 545 | Open in IMG/M |
3300031942|Ga0310916_11260144 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 610 | Open in IMG/M |
3300031954|Ga0306926_11537962 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 766 | Open in IMG/M |
3300031954|Ga0306926_11645649 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 735 | Open in IMG/M |
3300032094|Ga0318540_10369673 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 693 | Open in IMG/M |
3300032180|Ga0307471_101107873 | All Organisms → cellular organisms → Bacteria | 957 | Open in IMG/M |
3300032180|Ga0307471_104158048 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 511 | Open in IMG/M |
3300032205|Ga0307472_100977577 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 791 | Open in IMG/M |
3300032205|Ga0307472_102273194 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
3300032805|Ga0335078_10519944 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1524 | Open in IMG/M |
3300032829|Ga0335070_10153368 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2341 | Open in IMG/M |
3300032829|Ga0335070_11810027 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 552 | Open in IMG/M |
3300032892|Ga0335081_10727644 | Not Available | 1199 | Open in IMG/M |
3300032893|Ga0335069_10544536 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1339 | Open in IMG/M |
3300032893|Ga0335069_11012782 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 921 | Open in IMG/M |
3300032955|Ga0335076_10058477 | All Organisms → cellular organisms → Bacteria | 3810 | Open in IMG/M |
3300033004|Ga0335084_11986769 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 567 | Open in IMG/M |
3300033405|Ga0326727_10605594 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 910 | Open in IMG/M |
3300033412|Ga0310810_10863857 | All Organisms → cellular organisms → Bacteria | 802 | Open in IMG/M |
3300033806|Ga0314865_072681 | All Organisms → cellular organisms → Bacteria | 892 | Open in IMG/M |
3300033829|Ga0334854_129595 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 609 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 15.85% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.10% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.28% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 5.28% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.47% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 4.47% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 4.06% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 4.06% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.06% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.66% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 3.66% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.66% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.66% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 3.25% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 2.44% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.44% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.03% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.03% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.22% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.22% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 1.22% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.63% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.63% |
Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.41% |
Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.41% |
Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.41% |
Thawing Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Thawing Permafrost | 0.41% |
Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.41% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.41% |
Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.41% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.41% |
Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.41% |
Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.41% |
Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.41% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.41% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.41% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.41% |
Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.41% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.41% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.41% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.81% |
Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.81% |
Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.81% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.81% |
Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.81% |
Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 0.81% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.81% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2170459024 | Grass soil microbial communities from Rothamsted Park, UK - FD1 (NaCl 300g/L 5ml) | Environmental | Open in IMG/M |
3300000567 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 | Environmental | Open in IMG/M |
3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
3300002680 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF132 (Metagenome Metatranscriptome, Counting Only) | Environmental | Open in IMG/M |
3300003369 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Incubations 002-22A | Environmental | Open in IMG/M |
3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
3300004117 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF222 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300004609 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 50 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300004631 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF234 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
3300009519 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_150 | Environmental | Open in IMG/M |
3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
3300009547 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_40 | Environmental | Open in IMG/M |
3300009621 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_150 | Environmental | Open in IMG/M |
3300009623 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10 | Environmental | Open in IMG/M |
3300009635 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_10 | Environmental | Open in IMG/M |
3300009639 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_40 | Environmental | Open in IMG/M |
3300009643 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_40 | Environmental | Open in IMG/M |
3300009644 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_10 | Environmental | Open in IMG/M |
3300009683 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG | Environmental | Open in IMG/M |
3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
3300011078 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 50 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
3300011998 | Permafrost microbial communities from Nunavut, Canada - A30_35cm_6M | Environmental | Open in IMG/M |
3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
3300014150 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300014151 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_60_metaG | Environmental | Open in IMG/M |
3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
3300014159 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_60_metaG | Environmental | Open in IMG/M |
3300014164 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaG | Environmental | Open in IMG/M |
3300014200 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaG | Environmental | Open in IMG/M |
3300014657 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaG | Environmental | Open in IMG/M |
3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
3300017927 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_4 | Environmental | Open in IMG/M |
3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
3300017948 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10 | Environmental | Open in IMG/M |
3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
3300017988 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_30_metaG | Environmental | Open in IMG/M |
3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
3300018005 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_150 | Environmental | Open in IMG/M |
3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
3300018013 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_100 | Environmental | Open in IMG/M |
3300018026 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_100 | Environmental | Open in IMG/M |
3300018037 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10 | Environmental | Open in IMG/M |
3300018047 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10 | Environmental | Open in IMG/M |
3300018057 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150 | Environmental | Open in IMG/M |
3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300019278 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019787 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (PacBio error correction) | Environmental | Open in IMG/M |
3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
3300021476 | Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2) | Environmental | Open in IMG/M |
3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
3300022504 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-2-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022511 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-28-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022522 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-11-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022525 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-4-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022528 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022531 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-28-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022532 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022533 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022712 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-32-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022722 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-12-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022724 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300024182 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK10 | Environmental | Open in IMG/M |
3300024220 | Spruce litter microbial communities from Bohemian Forest, Czech Republic ? CLU5 | Environmental | Open in IMG/M |
3300024331 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK09 | Environmental | Open in IMG/M |
3300025473 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_10 (SPAdes) | Environmental | Open in IMG/M |
3300025507 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_40 (SPAdes) | Environmental | Open in IMG/M |
3300025509 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-1 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026307 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 (SPAdes) | Environmental | Open in IMG/M |
3300026322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 (SPAdes) | Environmental | Open in IMG/M |
3300026335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes) | Environmental | Open in IMG/M |
3300026514 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-13-B | Environmental | Open in IMG/M |
3300026527 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 (SPAdes) | Environmental | Open in IMG/M |
3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
3300027061 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027432 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O2 (SPAdes) | Environmental | Open in IMG/M |
3300027548 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027652 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O2 (SPAdes) | Environmental | Open in IMG/M |
3300027674 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027745 | Thawing permafrost microbial communities from the Arctic, studying carbon transformations - Permafrost 812P2M | Environmental | Open in IMG/M |
3300027783 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2 (SPAdes) | Environmental | Open in IMG/M |
3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
3300027825 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 (SPAdes) | Environmental | Open in IMG/M |
3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
3300027898 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes) | Environmental | Open in IMG/M |
3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
3300028146 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK23 | Environmental | Open in IMG/M |
3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300028646 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E1_2 | Environmental | Open in IMG/M |
3300029918 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E2_1 | Environmental | Open in IMG/M |
3300030019 | II_Fen_E2 coassembly | Environmental | Open in IMG/M |
3300030545 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO142-VCO033SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030625 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO122-ANR120SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030627 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO153-ARE095SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030659 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG (v2) | Environmental | Open in IMG/M |
3300030740 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada ARE Co-assembly | Environmental | Open in IMG/M |
3300031028 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_2 | Environmental | Open in IMG/M |
3300031128 | Oak Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Host-Associated | Open in IMG/M |
3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Host-Associated | Open in IMG/M |
3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Host-Associated | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
3300032094 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
3300033405 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB29MY | Environmental | Open in IMG/M |
3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
3300033806 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_50_20 | Environmental | Open in IMG/M |
3300033829 | Peat soil microbial communities from Stordalen Mire, Sweden - 715 P2 1-5 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
FD1_07673310 | 2170459024 | Grass Soil | LELPNGMFFLGRARLAGNTTFDQKIPLKGLKDKPKRAVISYYDDVLASPN |
JGI12270J11330_100490844 | 3300000567 | Peatlands Soil | DGNIAFLGRARMTGNNTVEQKVPLKGLKTKPHRVALNYYDDVLASP* |
JGI12627J18819_104572791 | 3300001867 | Forest Soil | NVAFLGRARLIGSGSVDQKVPLKGLKTKPRRAMVNYYDDILASPN* |
JGIcombinedJ26739_1013225232 | 3300002245 | Forest Soil | VCWCRFICARLIGNKSIEQKIPLKGLKPKPRRAVLNYYDDVLAFPN* |
Ga0005483J37271_1032582 | 3300002680 | Forest Soil | DGKVVFLGRVRMVGNDSIEQKLPVKGLKTKPRRALLSYCDDVLASPN* |
JGI24140J50213_102471721 | 3300003369 | Arctic Peat Soil | GLRRHVVLGRAHLTGNATFEQKMPLKGLKEKPKRAAINYYDDVLASPN* |
Ga0062389_1019534862 | 3300004092 | Bog Forest Soil | FLGRARISGNTTIEQKVPLKNVKTAPKRAIINYNDDVLASPN* |
Ga0058893_13392301 | 3300004117 | Forest Soil | RVRMVGNDSIEQKLPVKGLKTKPRRALLSYCDDVLASPN* |
Ga0068958_12529171 | 3300004609 | Peatlands Soil | RARLTGNTTIDQKIPLKGLKDKPRRAVLNYYDDVLASPN* |
Ga0058899_100204851 | 3300004631 | Forest Soil | LGRARLIGNNSFDEKIPLKGLKEKPKRAVMSYYDDVLASAN* |
Ga0066674_103148332 | 3300005166 | Soil | DGRIVFLGRLRIVGNSSGTAKVPLKGLKAKPRRALINYYDDVLASPS* |
Ga0066678_105147082 | 3300005181 | Soil | ELADGRTAFLGRVRIAGNSSTEAKIPLKGIKDVPKRAMLNYYDDVLASPN* |
Ga0066388_1073479983 | 3300005332 | Tropical Forest Soil | LASGKTAFLGRARLNGNSSTDAKVPLRGVKDVPRRAVLNYYDDVLASPN* |
Ga0070709_102279542 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | LSIGRARLLGNSAVEQTVSLKGWKEKPKRAVVNYYDDVLAGGN* |
Ga0070713_1013805201 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | RVTMVGNTSQEGKIALKGLKDIPRRAIVNYYDDVLASSN* |
Ga0070710_107110291 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | IYFLGRARMAGNTTVEQKIPLKGLKEKPRRAMLNYYDDVLASPN* |
Ga0066682_103398652 | 3300005450 | Soil | FLGRLRIVGNSSGTAKVPLKGLKAKPRRALINYYDDVLASPS* |
Ga0070697_1001176251 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | LADGRIVNLGRARVMGSTSVEQKVPLKGLKDAPKRALLSYYDDVLAAPN* |
Ga0070733_103121201 | 3300005541 | Surface Soil | ARMAGNNSVEQKIPLKGLKTRPKGAVLNYYDDVLASPN* |
Ga0070733_105311071 | 3300005541 | Surface Soil | GRVTLVGNASTGGKIPLKGMKDAPRRALLNYYDDILAASN* |
Ga0070732_106793062 | 3300005542 | Surface Soil | LGRARLVGNTSVEKKIPLKGLETKPRRAIANYYDDVLATPN* |
Ga0070695_1016920471 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | LGRANLTGNTSFEQKVPIKGLKEKPRRALVNYYDDVLASEN* |
Ga0066701_107400032 | 3300005552 | Soil | IVFLGRMRIVGNKSEAAKVPLKGLKAKPRRAMINYYDDVLASPG* |
Ga0066661_105933042 | 3300005554 | Soil | EELFFSGERIVGNSSGTAKVPLNGLKAKPRRALINYSDDVLASPN* |
Ga0066691_104378462 | 3300005586 | Soil | DGRIASLGRVSIGGNNSTDAKVPLKGLKDTPRRALLNYYDDVLASPN* |
Ga0070717_103422893 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | HVAQIGRVGMVGNTSQEGKISLKGLKDMPRRAMLNYYDDVLASSN* |
Ga0070717_119136302 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MAGNTTVEQKIPLKGLKEKPRRAMLNYYDDVLASPN* |
Ga0075029_1001994452 | 3300006052 | Watersheds | GLVGNTTYERKISLKGLKDKPRRALINYYDDVLCSLN* |
Ga0075029_1009573721 | 3300006052 | Watersheds | RLTGNTSVDQKIPLKGLKDAPKRAAVNYNYDVLASN* |
Ga0075017_1013317641 | 3300006059 | Watersheds | HLGRALLTGNTSVDQKVPIKGLKDTPKRALVNYNDDVLASN* |
Ga0075017_1015274751 | 3300006059 | Watersheds | LGHARISGNSPIEQKIPLRGLKTKPRAAMLNYYDDVLASPN* |
Ga0075019_101021102 | 3300006086 | Watersheds | VGNTSTEQKVPLKGLKGKPKRVVVSYYDDVLATAN* |
Ga0075015_1005521141 | 3300006102 | Watersheds | ADGNIVVLGRARMTGNDSVDQKIPLKGVKTKPRRALVNYYDDVLASPN* |
Ga0070765_1002858741 | 3300006176 | Soil | GHPVFVGRARLAGDSSVEQKVSMKGLKAKPRRALLNSYHDVLASPS* |
Ga0075021_106442162 | 3300006354 | Watersheds | LVGNASIEQKIPLKGLKTRPRRALINYFDDVLSSPN* |
Ga0068871_1022282232 | 3300006358 | Miscanthus Rhizosphere | LGNSAVEQTVSLKGWKEKPKRAVVNYYDDVLAGGN* |
Ga0066658_102743412 | 3300006794 | Soil | DDGRIVFLGRLRLVGNSSAAPKVPLKGLKTKPRRALINYFDDVLASAN* |
Ga0099830_112965871 | 3300009088 | Vadose Zone Soil | LETAEGKIVFLGRVRLAGNNSFEQKVPLRGLKVKPKRAMVNYYDDVLAAAN* |
Ga0099828_105132264 | 3300009089 | Vadose Zone Soil | FLGRARLAGNASVEQKIPLKGLKTKPRRAMVNYYDDVLASPN* |
Ga0105247_117393811 | 3300009101 | Switchgrass Rhizosphere | VGNTSEEGKIPLTGVKDTPRRAMVNYYDDVLATN* |
Ga0066709_1028620251 | 3300009137 | Grasslands Soil | LANGKTAFLGRVRIAGNSSTEAKIPLKGLKDTPRRAMLNYYDDILASPN* |
Ga0105248_103107551 | 3300009177 | Switchgrass Rhizosphere | AGNTTIEQKVTLKGVQTAPKRALVNYNYDVLAGN* |
Ga0116108_10646423 | 3300009519 | Peatland | RLNGNNSLGQKVPLKGLKAKPRRALLNYYDDVLASPN* |
Ga0116214_11090081 | 3300009520 | Peatlands Soil | IGNSSVDQKVPLKGWKDAPKRALVNYNDDVLASN* |
Ga0116136_11072561 | 3300009547 | Peatland | LGNASVDQKVPLKGLKDTPKRALVNYYDDVLASN* |
Ga0116116_11122861 | 3300009621 | Peatland | ARLNGNNSLGQKVPLKGLKAKPRRALLNYYDDVLASPN* |
Ga0116133_10927461 | 3300009623 | Peatland | ARLTGNSTFEQKIPLKGMKEMPRRALINYYDDVLAAPN* |
Ga0116117_11513891 | 3300009635 | Peatland | RLTGYSSVEQKVPLKGLKAKPKRAMLSYYDDVLASPN* |
Ga0116122_10891361 | 3300009639 | Peatland | LLGNASVDQKVPLKGLKDTPKRALVNYYDDVLASN* |
Ga0116110_10465072 | 3300009643 | Peatland | GRARLLGNASVDQKVPLKGLKDTPKRALVNYYDDVLASN* |
Ga0116121_11826691 | 3300009644 | Peatland | ADGRIVNLGRARLIGNKTVDEKLPLKGLKDAPKRALLNYYDDVLASN* |
Ga0116224_100384991 | 3300009683 | Peatlands Soil | LIGNSSVDQKVPLKGWKDAPKRALVNYNDDVLASN* |
Ga0116216_105930712 | 3300009698 | Peatlands Soil | LLLGRARLIGNMTLEQKIPLKGVKEKPRRALVNYFDDVLASAK* |
Ga0116219_105942833 | 3300009824 | Peatlands Soil | ADGRMVNLGRARLIGNTSADQKIPLKGLKDAPKRALVNYNDDVLASN* |
Ga0116219_106335072 | 3300009824 | Peatlands Soil | ARLIGNSSVDQKVPLKGWKDAPKRALVNYNDDVLASN* |
Ga0116223_101781031 | 3300009839 | Peatlands Soil | LLGRARLIGNMTLEQKIPLKGVKEKPRRALVNYFDDVLASAK* |
Ga0126384_103091381 | 3300010046 | Tropical Forest Soil | TLVGNTSQDTKVLLKGIKDTPHRAMVNYYDDVLASPN* |
Ga0126384_108006091 | 3300010046 | Tropical Forest Soil | IGNSASSPKVPLKGLKAKPRRAMINYYDDVLASVN* |
Ga0126373_101803701 | 3300010048 | Tropical Forest Soil | AFLGRARLVGNSASSPKVPLKGLKAKPRRAMINYYDDVLASPN* |
Ga0134086_100633642 | 3300010323 | Grasslands Soil | DGRMVNLGRAHVTGNTSIEQKVPLKGLKDAPKRALLSYYDDVLAAPN* |
Ga0134064_100377813 | 3300010325 | Grasslands Soil | GRAHVTGNTSIEQKVPLKGLKDAPKRALLSYYDDVLAAPN* |
Ga0134080_104649482 | 3300010333 | Grasslands Soil | LADGRMVNLGRAHVTGNTSIEQKVPLKGLKDAPKRALLSYYDDVLAAPN* |
Ga0074044_103015832 | 3300010343 | Bog Forest Soil | EDRRNNVGNSTVDQTVTLNGLKEKPLRAMINYYDDVLAAPN* |
Ga0126376_103762602 | 3300010359 | Tropical Forest Soil | ELANGNVVRIGSVRAVGNTTVEQKAPFKGLKDKPRRALINYYDDVLASP* |
Ga0126376_121679352 | 3300010359 | Tropical Forest Soil | LTGNTSVEQKVPMKGLAVKPKRAILNYNYDVLASAN* |
Ga0126372_100757744 | 3300010360 | Tropical Forest Soil | VTGNSSFEQKVPLKGLKDTPKRAMLSYYDDVLAVPN* |
Ga0126378_112627581 | 3300010361 | Tropical Forest Soil | RIRLVGNNYFEQKVPLKGLKIKPKRAVVNYFDDVLASPN* |
Ga0126379_106013143 | 3300010366 | Tropical Forest Soil | ALGRAPLVGSSTVEDKVQIKGLKTKPRRALLNYYDDVLAAR* |
Ga0126379_133636242 | 3300010366 | Tropical Forest Soil | GRARMKGNTSVEQKVPLRGLKDAPRRALVNYNYDVLAAN* |
Ga0134128_109525461 | 3300010373 | Terrestrial Soil | GRARIMGNTSVEQKVPLKGLKDAPKRALLSYYDDVLAAPN* |
Ga0134122_101139401 | 3300010400 | Terrestrial Soil | NDGRLLSIGRARLLGNTAVEQTGSLKGGKEKPKRAVVNYYDDVLAGGN* |
Ga0134121_126474892 | 3300010401 | Terrestrial Soil | FLGRARLMGNATFDQKIPLKDLKDKPKRAVISYYDDVLASPN* |
Ga0138565_11296232 | 3300011078 | Peatlands Soil | LGRARLTGNTTIDQKIPLKGLKDKPRRAVLNYYDDVLASPN* |
Ga0150983_108511552 | 3300011120 | Forest Soil | GNTTLEQKIPLKGVKEKPRRALVNYFDDVLASAK* |
Ga0150983_150822962 | 3300011120 | Forest Soil | DGRVLPLGRARLIGNTSIEQKVPLKGIKDRPTNATINYFDDVLASAN* |
Ga0120114_10640421 | 3300011998 | Permafrost | TVNLGRVTLIGNSSLDGKIPLKGIKEPPHRAMLNSYDDVLASPN* |
Ga0137389_117525661 | 3300012096 | Vadose Zone Soil | TVIGNSSMDAKVPLKGVKDAPRRAILNYYDDVLASPN* |
Ga0137364_103306281 | 3300012198 | Vadose Zone Soil | ELADGKTMFLGRARLTGNSSTEAKIPLKGLQDIPRRAMLNYYDDVLASPN* |
Ga0137364_107156891 | 3300012198 | Vadose Zone Soil | ARVMGNTSVEQRVPLKGLKDAPKRALLSYYDDVLAAPN* |
Ga0137381_111759962 | 3300012207 | Vadose Zone Soil | ELADGRMVNLGRAHVTGNTSIEQKVPLKGLKDAPKRALLSYYDDVLAAPN* |
Ga0137376_102765153 | 3300012208 | Vadose Zone Soil | ELADGRTVNLGRASLSGNSSIDRKVPLRGVKVAPKRALVNYNYDVLASN* |
Ga0137376_105707482 | 3300012208 | Vadose Zone Soil | VRIAGNSSTEAKTPLKGLKDTPRRAMLNYYDDILASPN* |
Ga0150985_1185181022 | 3300012212 | Avena Fatua Rhizosphere | GRMVSLGRANLTGNTSFEQKVPIKGLKEKPRRALVNYYDDVLASEN* |
Ga0137387_103883983 | 3300012349 | Vadose Zone Soil | ELPNGMFFLGRAHLTGNSTFDQKIPLKGLKEKPKRAVISYYDDVLASPN* |
Ga0137386_112161442 | 3300012351 | Vadose Zone Soil | FLGRAHLTGNSTFDQKIPLKGLKEKPKRAVISYYDDVLASPN* |
Ga0137371_113121552 | 3300012356 | Vadose Zone Soil | MYDLGRLTVAGNSTIDGKVPLKGLKDVPRRAVLNYYDDVLASPN* |
Ga0150984_1059867932 | 3300012469 | Avena Fatua Rhizosphere | ANLTGNTSFEQKVPIKGLKEKPRRALVNYYDDVLASEN* |
Ga0137373_106796382 | 3300012532 | Vadose Zone Soil | AFLGRVRIAGNSSTEAKIPLKGLKDTPRRAMLNYYDDILASPN* |
Ga0164305_120104631 | 3300012989 | Soil | EMNDGRLLSIGRARLLGNSAVEQTVSLKGWKEKPKRAVVNYYDDVLAGGN* |
Ga0157375_122178372 | 3300013308 | Miscanthus Rhizosphere | YLEMNDGRLLSIGRARLLGNTAVEQTVSLKGWKEKPKRAVVNYYDDVLAGGN* |
Ga0134081_100024616 | 3300014150 | Grasslands Soil | RLVGNTSSPAKVPLKGLKTKPRRAIINYLDDVLASPS* |
Ga0181539_11391112 | 3300014151 | Bog | RLLGNASVDQKVPLKGLKDTPKRALVNYYDDVLASN* |
Ga0134075_104438041 | 3300014154 | Grasslands Soil | RARLVGNSSVAPKVPLKGLKAKPRRALINYYDDVLASPN* |
Ga0181530_103194251 | 3300014159 | Bog | RMVGNKTVEQKVPLKGLKTKPHRVAINYYDDVLASP* |
Ga0181532_100233971 | 3300014164 | Bog | ARTLGNNTLQQKVSLKGFTPTPRHAFLSYYDDVLASPN* |
Ga0181526_102082821 | 3300014200 | Bog | NGMLFLGRARLTGNSNFEQKIPLKGLKDKPKRAVINYYDDVLASPN* |
Ga0181522_101781651 | 3300014657 | Bog | VPLGRARLLGNTSVEQKVPIKGLKDLPKRALVNYNDDVLASN* |
Ga0137405_10684093 | 3300015053 | Vadose Zone Soil | RVRLAGNNSFEQKVPLRGLKVKPKRAMVNYYDDVLAAAN* |
Ga0132257_1015478862 | 3300015373 | Arabidopsis Rhizosphere | MFFLGRARPMGNATFDQKIPLKGLKDKPKRAVISYYDDVLASPN* |
Ga0182040_109931992 | 3300016387 | Soil | LGRARLAGNSSLSQKVPIPGLKDPPKRAVINYFDDVLASVN |
Ga0182037_101850521 | 3300016404 | Soil | MADGRTVMLGHVRISGSSTAEQKVPLRGLKEKPRKAIINYMDDVLAAN |
Ga0187802_100172814 | 3300017822 | Freshwater Sediment | PLVGTNAIKDQVPLKNMKAQPHRAVLNYYDDVLASPN |
Ga0187802_101912242 | 3300017822 | Freshwater Sediment | GRTLLLGRARLIGNMTLEQKIPLKGVKEKPRRALVNYFDDVLASAK |
Ga0187824_103793791 | 3300017927 | Freshwater Sediment | RVTLVGDTSSSGKIPLKGLKDVPRRATLNYYDDVLASP |
Ga0187801_101220102 | 3300017933 | Freshwater Sediment | EDGNVRLLGRVRLVGTTPFEQKVSLGTPKAKPRRTLVNYYDDVLASP |
Ga0187801_101429172 | 3300017933 | Freshwater Sediment | MHLGRARLVGNNSVDQKVPLKGLKDTPKRALLNYNADVLASN |
Ga0187801_105025101 | 3300017933 | Freshwater Sediment | MVGSSSLEDKVPIKGLKTKPEPALVNCYDDGLAAN |
Ga0187847_103942821 | 3300017948 | Peatland | LEMADGRVLPLGRARLIGNTSIEQKVPLKGIKDRPTNATINYFDDVLASAN |
Ga0187779_108090071 | 3300017959 | Tropical Peatland | NIAPIGRALIMGNSSIEQKVPLKGWKMKPRRAMVNYYDDVLASAN |
Ga0187781_102276523 | 3300017972 | Tropical Peatland | ELADGNMFFLGRAKMTGNSSVDQKIPLKGLKTKPRRAVLNYYDDVLASPN |
Ga0187777_104230702 | 3300017974 | Tropical Peatland | LTGNTTVSQKLPLRGLKTKPRRVLLNYYDDVLASPN |
Ga0181520_110423391 | 3300017988 | Bog | LGRARMTGNTTLAQKIPLKGLKAKPNRAVLNYYDDVLASPN |
Ga0187816_102448701 | 3300017995 | Freshwater Sediment | DGRTVSLGRAHLVGNTSVDQKVPLKGLKDTPKRALLNYNDDVLASN |
Ga0187878_11493801 | 3300018005 | Peatland | GRTVYLGRARLLGNASVDQKVPLKGLKDTPKRALVNYYDDVLASN |
Ga0187804_100610941 | 3300018006 | Freshwater Sediment | PLVGTNAIKDQVPLKNLKAQPHRAVLNYYDDVLASPN |
Ga0187805_105976831 | 3300018007 | Freshwater Sediment | LLGRARLIGNMTLEQKIPLKGVKEKPRRALVNYFDDVLASAK |
Ga0187873_11268622 | 3300018013 | Peatland | GRARLLGNASVDQKVPLKGLKDTPKRALVNYYDDVLASN |
Ga0187873_11298261 | 3300018013 | Peatland | LTGNSSVDQKVPLKGLKDVPKRALVNYNDDVLASN |
Ga0187857_101845141 | 3300018026 | Peatland | ARLLGNASVDQKVPLKGLKDTPKRALVNYYDDVLASN |
Ga0187883_100921223 | 3300018037 | Peatland | LTGDSSVEQKVPLKGLKAKPKRAMLSYYDDVLASPN |
Ga0187859_105100421 | 3300018047 | Peatland | DGGMFFLGRARLTGNNSVEQKVPLKGLKAKPRRAVLNYYDDVLASPN |
Ga0187858_105427341 | 3300018057 | Peatland | IAFLGRARMVGNKTVEQKVPLKGLKTKPRRVAINYYDDVLASP |
Ga0187784_116880091 | 3300018062 | Tropical Peatland | TGNSTVEQKIPLKGLKTSPRRVAINYYDDVLASPN |
Ga0187772_101258503 | 3300018085 | Tropical Peatland | LVGNSTVEDRVAIKGLKTKPKRALANYYDDVLAAN |
Ga0187772_103226591 | 3300018085 | Tropical Peatland | GRARLTGNHSIAQKIPLKGVKTAPRRVVLNYYDDVLASPN |
Ga0187771_115164692 | 3300018088 | Tropical Peatland | TLIGNNSTGGKVALRGVKDTPRRAMLNYYDDVLASP |
Ga0187771_115662252 | 3300018088 | Tropical Peatland | GRVRLAGNNGGELKIPLKGLKTRPRRAMVNYYDDVLASPN |
Ga0187770_101022271 | 3300018090 | Tropical Peatland | VTLIGNNSTGGKVALRGVKDTPRRVMLNYYDDVLASP |
Ga0187770_104339501 | 3300018090 | Tropical Peatland | LGRATMIGNKTIEQKAPLRGLKTRPRRAVINYYDDVLATP |
Ga0187770_118012541 | 3300018090 | Tropical Peatland | NMFFLGRARLAGNSSVDQKIPLKGLKTKPRRAVLSYYDDVLAPPN |
Ga0066655_102828532 | 3300018431 | Grasslands Soil | FLGRMRIVGNKSEAAKVPLKGLKAKPRRAMINYYDDVLASPG |
Ga0066667_102288521 | 3300018433 | Grasslands Soil | LADGHVVNLGRARVAGNTSVEQKVPLKGLKEMPKRAMLNYFDDVLASP |
Ga0066662_116129871 | 3300018468 | Grasslands Soil | IFFLGRARLTGNTTVEQKIPLKGLKTKPRRAVVNYYDDVLASPS |
Ga0187800_11414112 | 3300019278 | Peatland | GRARMVGNTSVEQKVPLKGWKTPPRRALINYYDDVLASPN |
Ga0182031_10266702 | 3300019787 | Bog | DGRTISLGRARLVGNTTVDQKVPLKGLKDAPKRALVNYYDDVLASN |
Ga0179592_104466672 | 3300020199 | Vadose Zone Soil | VPIYLDLPNGMYFMGRARLIGSSTLDQKIPLKGLKERPKAALVNYYDDVLASPN |
Ga0210399_109501232 | 3300020581 | Soil | YLELPNGMFLLGRARLTGNNTIDEKIPLKGLKDKPKRAVINYFDDVLASPN |
Ga0210400_112312132 | 3300021170 | Soil | VLLGRVRLVGNSASPGKVPLKGLKTKPRRAIINYFDDVLASPN |
Ga0210405_105045822 | 3300021171 | Soil | ARLTGNSTFDQKLPLRGLKETPKRAVTSYYDDVLASPN |
Ga0210408_100672493 | 3300021178 | Soil | VRLTGNSTFEQKIPLKGLKDKPKRAVINYYDDVLASSS |
Ga0210408_104206712 | 3300021178 | Soil | ARLIGNTTLEQKIPLKGVKEKPRRALVNYYDDVLASAK |
Ga0210393_100191339 | 3300021401 | Soil | ELADGNIAFVGRAKLTGDSSMEQKVPMKGLKAKPRRALLNYYDDVLASPN |
Ga0210387_108660131 | 3300021405 | Soil | MSDWRTLFLGRARLLGNTTLEQKIPLHGLKEKPRRAVVNYLDDVLSSAK |
Ga0210386_113977912 | 3300021406 | Soil | GRARLIGNTTLEQKIPLKGTKDRPRRAVVNYFDDVLASAN |
Ga0210384_113862402 | 3300021432 | Soil | RMRLVGNSSSSPKVPLKGLKAKPRRALINYYDDVLASAN |
Ga0210384_118460401 | 3300021432 | Soil | ARLSGNTTIEQKIPLKGVKEKPRRALVNYYDDVLASAK |
Ga0210391_108907122 | 3300021433 | Soil | PTLIGNNSFDEKIPLKGLKEKPKRAVMSYYDDVLASAN |
Ga0187846_1000108813 | 3300021476 | Biofilm | VFLGRARLSGNTSIEQKVPLKGVKAKPRRALINYYDDVLASPS |
Ga0187846_104198851 | 3300021476 | Biofilm | LGRARMAGSTSIEQKVPLKGLKTKPRAALLNYYDDILASPN |
Ga0210402_107447792 | 3300021478 | Soil | NGNMFFLGRARLNGNNSFEDKIPLKGLKEKPHRAVINYYDDVLASPS |
Ga0242642_10188342 | 3300022504 | Soil | RTFPLGRARLTGNTTLEQKIPLKGIKDKPRRAVVNYFDDVLASAK |
Ga0242642_10253862 | 3300022504 | Soil | FLGRARITGNNSIDQKVPLKGLKDKPRRAVLNYYDDVLASPN |
Ga0242651_10097191 | 3300022511 | Soil | RLAGNTAVEQKVPLKGLKAQPRRAMINYYDDVLATAN |
Ga0242659_10292352 | 3300022522 | Soil | KVVFLGRVRMVGNDSIEHKLPVKGLKTKPRRALLSYYDDVLASPN |
Ga0242659_10429541 | 3300022522 | Soil | ARITGNNTVEQKVPLKGLKTKPRRAVVNYYDDVLASAN |
Ga0242656_10159321 | 3300022525 | Soil | GRTFPLGRARLTGNTTLEQKIPLKGIKDKPRRAVVNYFDDVLASAK |
Ga0242669_10141033 | 3300022528 | Soil | IIPIYLEMPDGKVVFLGRVRMVGNDSIEQKLPVKGLKTKPRRALLSYCDDVLASPN |
Ga0242660_10509251 | 3300022531 | Soil | RLTGNSTFDQKIPLKGLKDKPKRAVINYFDDVLASPN |
Ga0242655_100472071 | 3300022532 | Soil | DAGSNLPGLPSGMFFLGRARLIGNNSFDEKIPLKGLKEKPKRAVMSYYDDVLASTN |
Ga0242655_100728022 | 3300022532 | Soil | LGNTTVEQKVPLKGLKTKPKRALVNYYDDVLASPN |
Ga0242662_101029671 | 3300022533 | Soil | NVRFLGRARITGNTSIEQKIPLKGLKDKPHRILVNYYDDVLASAN |
Ga0242662_103533172 | 3300022533 | Soil | DGRTVMLGHVRIVGNSTAEQKVPLKGLKDKPRRALINYMDDVLASN |
Ga0242653_10219452 | 3300022712 | Soil | GKVVFLGRVRMVGNDSIEQKLPVKGLKTKPRRALLSYCDDVLASPN |
Ga0242653_10241541 | 3300022712 | Soil | ARLTGNNSVEQKVPIKGLKTKPRRALINYYDDVLASPN |
Ga0242657_11909382 | 3300022722 | Soil | GMYFLGRARLTGNKTVEQKVPIKGLKTKPRRAVLNYYDDVLASAN |
Ga0242665_100612441 | 3300022724 | Soil | DGRTFPLGRARLTGNTTLEQKIPLKGIKDKPRRAVVNYFDDVLASAK |
Ga0247669_10046994 | 3300024182 | Soil | EGRIVFLGRVRLAGNNSFEQKVPLRGLKVKPKRAMVNYYDDVLAAAN |
Ga0224568_10155781 | 3300024220 | Plant Litter | FFLGRARLTGNKSIEQKVPLKGIKARPRRAVLNYYDDVLASPN |
Ga0247668_10190851 | 3300024331 | Soil | LGRVRLAGNNSFEQKVALRGLKVKPKRAPVNYYDDVLALAN |
Ga0208190_11116972 | 3300025473 | Peatland | RIVNLGRARLIGNKTVDEKLPLKGLKDAPKRALLNYYDDVLASN |
Ga0208188_10039631 | 3300025507 | Peatland | CRTVYLGRARLLGNASVDQKVPLKGLKDTPKRALVNYYDDVLASN |
Ga0208848_10445682 | 3300025509 | Arctic Peat Soil | GRARLSGNSSVEQKVSLKGMKDRPRRALLNYYDDVLASP |
Ga0207685_105988631 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | RPVGNTTVEAKTPIKGLKEKPRRAMISYYNDVLATP |
Ga0207693_105513341 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | ITGNMSLEQKVPLKGLKTKPRRAIVNYYDDVLATAN |
Ga0207646_103167913 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | LGRANLIGNSSIDQKVPLRGVKTAPKRALVNYNYDVLASN |
Ga0207677_116117641 | 3300026023 | Miscanthus Rhizosphere | LVGNTSEEGKIPLTGVKDTPRRAMVNYYDDVLATN |
Ga0209469_10925292 | 3300026307 | Soil | GRMVNLGRAHVTGNTSIEQKVPLKGLKDAPKRALLSYYDDVLAAPN |
Ga0209687_11612581 | 3300026322 | Soil | VTGNTSIEQKVPLKGLKDAPKRALLSYYDDVLAAPN |
Ga0209804_13407541 | 3300026335 | Soil | IIFMGRARMIGNRSSEQKVPLKGLKTRPRRLLVNYYDDVLASPN |
Ga0257168_10284122 | 3300026514 | Soil | ELANGNTVLLGRAKLNGNTSVERKVPLKGVKEKPRRALMNYYDDVLASVN |
Ga0209059_10559633 | 3300026527 | Soil | FLGRMRVVGNKSEAAKVPLKGLKAKPRRALINYLDDVLASPN |
Ga0209156_101869513 | 3300026547 | Soil | RVTGNKSIAEKIPLKGLKDTPKRALLNYYDDVLASN |
Ga0209161_100581561 | 3300026548 | Soil | MVNLGRAHVTGNTSIEQKVPLKGLKDAPKRALLSYYDDVLAAPN |
Ga0209729_10535882 | 3300027061 | Forest Soil | IVGNKSEAAKVPLKGLKAKPRRAMINYYDDVLASPG |
Ga0209421_10219001 | 3300027432 | Forest Soil | ERANGGIAFLGRVRLVGNTSTEGKIPLKGIKDTPHRAMLNYYDDVLASPN |
Ga0209523_11099991 | 3300027548 | Forest Soil | VPIYFEMADGRMVMLGHVRIAGNSTAEQRLPLKGLKDKPRRALINYMDDVLASN |
Ga0209007_11351922 | 3300027652 | Forest Soil | VCWCRFICARLIGNKSIEQKIPLKGLKPKPRRAVLNYYDDVLAFPN |
Ga0209118_10693693 | 3300027674 | Forest Soil | ITGNTSVERKVPLKGVKEKPRRAIMNYHNDVLASVN |
Ga0209908_100646671 | 3300027745 | Thawing Permafrost | MADGHTINLGHARLIGNTSSDKKVSLKGLKDTPRRALLNYNDDVLASN |
Ga0209448_101811081 | 3300027783 | Bog Forest Soil | HITGNNSISQKVPLKGLKTKPRRVLINYYDDVLASPN |
Ga0209656_105488451 | 3300027812 | Bog Forest Soil | ATVGGNYTVQQTITLNNLKEQPRRAMINYYDDVLASPN |
Ga0209039_101797091 | 3300027825 | Bog Forest Soil | RGNATGEQTVTLNNLKEKPKRAMINYYDDVLASPN |
Ga0209580_103349811 | 3300027842 | Surface Soil | FFLGRARIVGNSSIDQKIPLKGLKTKPRRAIANYYDDVLASPN |
Ga0209580_104055102 | 3300027842 | Surface Soil | LGRARLVGNTSVEKKIPLKGLETKPRRAIANYYDDVLATPN |
Ga0209167_105121902 | 3300027867 | Surface Soil | DGNIFFLGRARMAGNNSVEQKIPLKGLKTRPKGAVLNYYDDVLASPN |
Ga0209465_101943271 | 3300027874 | Tropical Forest Soil | VGRARMDGNASVDQKVPLKGLKQKPRRAMLNYYDDVLASN |
Ga0209067_106642491 | 3300027898 | Watersheds | GRGRLMGNTTFEQKIPLKGLKETPRQAVVNYFDDVLASPN |
Ga0209698_113581561 | 3300027911 | Watersheds | ARMSGNSSIEQKIPLKGLKTKPRAAMLNYYDDVLASAN |
Ga0209526_106146501 | 3300028047 | Forest Soil | VGNTSQEGKIPLKGLKDIPRRAILNYYDDVLASSN |
Ga0247682_10034071 | 3300028146 | Soil | RLAGNNSFEQKVALRGLKVKPKRALVNYYDDVLALAN |
Ga0137415_111604391 | 3300028536 | Vadose Zone Soil | ELGNGNTVLLGRARMTGNTSVERKVPLKGVKEKPRRAIMNYYDDVLASVN |
Ga0302159_100230851 | 3300028646 | Fen | GRVRLVGNTSVEQKIPIRGLKTAPKRALVNYNDDVLASN |
Ga0302143_10035153 | 3300029918 | Bog | LADGRTISLGRARLVGNTTVDQKVPLKGLKDAPKRALVNYYDDVLASN |
Ga0311348_108513351 | 3300030019 | Fen | GRTVNLGRAHLTGNASVDQKVPLKGLKDAPKRALVNYNDDVLASN |
Ga0210271_100721723 | 3300030545 | Soil | FFYFLGRAKLTGNTSVEQKIPLKGLKAKPRRALLNYYDDVLASPN |
Ga0210259_109103572 | 3300030625 | Soil | EGGMYFLGRAKLTGNTSVEQKIPLKGLKAKPRRALLNYYDDVLASPN |
Ga0210269_100611051 | 3300030627 | Soil | TGNTSVEQKIPLKGLKAKPRRALLNYYDDVLASPN |
Ga0210269_101053392 | 3300030627 | Soil | RGRLAGNKSVEQKVPLKGLKAKPRRAVLNYYDDVLASPN |
Ga0316363_103573272 | 3300030659 | Peatlands Soil | TLLLGRARLIGNMTLEQKIPLKGVKEKPRRALVNYFDDVLASAK |
Ga0265460_105098981 | 3300030740 | Soil | RVFFFFMYFLGRAKLTGNTSVEQKIPLKGLKAKPRRALLNYYDDVLASPN |
Ga0302180_100722393 | 3300031028 | Palsa | LEMPDGNILFLGRGKLTGNSSIESKTPIKGLKTKPKRLVINYYDDVLASPS |
Ga0170823_139790382 | 3300031128 | Forest Soil | LELADGNMFPLARAKMSGNSSFEQKLPLKGLEVKPRRAVLSYYDDVLASPN |
Ga0170824_1265313791 | 3300031231 | Forest Soil | GRARIAGNTSIDQKVPLRGLKTKPRRAVLNYYDDVLASPN |
Ga0265332_100767581 | 3300031238 | Rhizosphere | NVPLGRARLVGNSSVEQKVPLKGLKDAPKRAVLNYNYDVLASPN |
Ga0265331_101112983 | 3300031250 | Rhizosphere | PDGNTTVEQKVPLKGLKQPPKRAMVNYFSDVLAAN |
Ga0170820_128637301 | 3300031446 | Forest Soil | LVGNSSQEGKLPLKGLKDIPRRALVNYYDDVLASPN |
Ga0265313_100520104 | 3300031595 | Rhizosphere | IGFLGRVRITGSKTLEQKIPLRGLKVKPRRLVLNYYDDVLASPN |
Ga0307469_120920572 | 3300031720 | Hardwood Forest Soil | LIGNSSIDQKVPLRGVKAPPKRAMVNYNYDVLASN |
Ga0307469_122305422 | 3300031720 | Hardwood Forest Soil | RLSGNSSIEQKVPLKGMKDRPRRAVLNYYDDVLASQ |
Ga0307475_106517343 | 3300031754 | Hardwood Forest Soil | TGNTSIEQKIPLKGLKDKPHRLLVNYYDDVLAAAN |
Ga0307475_109580011 | 3300031754 | Hardwood Forest Soil | GRMVMLGHVRIAGNSTAEQKVQLKGLKDKPRRALINYMDDVLASN |
Ga0307473_105902761 | 3300031820 | Hardwood Forest Soil | LLGRARVTGNTSVEQKVPLKGLKDTPKRALLSYYNDVLAAPN |
Ga0307478_105378183 | 3300031823 | Hardwood Forest Soil | FLGRARLVGITAYSQKVQLKGIKAKPRRALINYYDDVLASN |
Ga0307478_110923382 | 3300031823 | Hardwood Forest Soil | GRARLTGNSTFDQKLPLRGLKETPKRAVTSYYDDVLAWPN |
Ga0306923_122521901 | 3300031910 | Soil | GRARLIGNSSVDQKVPLKGLKTKPRRVLVNYYDDVLAAPN |
Ga0310916_112601442 | 3300031942 | Soil | FLGRARLIGNSSVENKVPLKGLKAKPRRAMVNYYDDVLASN |
Ga0306926_115379621 | 3300031954 | Soil | GRARLIGNSSVENKVPLKGLKAKPRRAMVNYYDDVLASN |
Ga0306926_116456492 | 3300031954 | Soil | DGNIAFLGRARLIGNSSVDQKVPLKGLKTKPRRVLVNYYDDVLAAPN |
Ga0318540_103696732 | 3300032094 | Soil | NMVLLGRARMVGNNTIQETVPLKGVKVRPKRALVNFYADVLASPN |
Ga0307471_1011078731 | 3300032180 | Hardwood Forest Soil | LFLGRARLTGNTTVAQKVPLKGLKAKPRRAILNYNDDVLASP |
Ga0307471_1041580481 | 3300032180 | Hardwood Forest Soil | RIAGNSTAEQKVPLKGLKDKPRRALINYMDDVLASN |
Ga0307472_1009775771 | 3300032205 | Hardwood Forest Soil | GKTVFLGRARLNGNTSLEQKIPLKGLKTKPRRAVINYYDDVLASPS |
Ga0307472_1022731941 | 3300032205 | Hardwood Forest Soil | LGRVRLTGSSSFERKIPLKGLKTKPRRAVINYYDDVLASPS |
Ga0335079_121218981 | 3300032783 | Soil | GSAKPAGNMTVDQKVPLNGLKEKPRRAMINYYDDVLAAN |
Ga0335078_105199441 | 3300032805 | Soil | MGRARMYGNKTVEQKIPMKGLKTKPRAAMLNYYDDVLASPN |
Ga0335070_101533684 | 3300032829 | Soil | GRARIMGNKSLEQRIPLKGLKTKPRAAMVNYYDDVLASPN |
Ga0335070_118100272 | 3300032829 | Soil | RASLTGNSSIDQKVPLKGLKTAPKRAMVNYNYDVLAAN |
Ga0335081_107276441 | 3300032892 | Soil | LNGNSSVEQKVALKGLKAKPRRAMLNYYDDVLASPN |
Ga0335069_105445361 | 3300032893 | Soil | ADGNIFFLGRAKMTGNNTIDQKIPLKGLKTKPRRAVMNYFDDVLATAN |
Ga0335069_110127821 | 3300032893 | Soil | LGRANLTGNSSVEQKVPLRGLKTPPKRALVNYNFDVLAGN |
Ga0335076_100584771 | 3300032955 | Soil | AGNTIIQQKVPLKGMKAAPRRAQLNYYDDVLASPD |
Ga0335084_119867692 | 3300033004 | Soil | DGRTGLLGRANLAGNTSIEQKVPLKGWKTPPKRALINYNYDVLASN |
Ga0326727_106055942 | 3300033405 | Peat Soil | ADGNIFFLGRARLTGNTSFEQKITVRGLKTKPRRAVLNYYDDVLASPN |
Ga0310810_108638571 | 3300033412 | Soil | GRLLSIGRARLLGNTAVEQTVSLKGWKEKPKRAVVNYYDDVLAGGN |
Ga0314865_072681_11_139 | 3300033806 | Peatland | VNFGHGALAGNTSVSQKVSLKGLKTPPRRVLLNYNYDVLASN |
Ga0334854_129595_494_607 | 3300033829 | Soil | ARLIGNSSIEQKIPMNGLKDAPKRAVVNYNDDVLASN |
⦗Top⦘ |