| Basic Information | |
|---|---|
| Family ID | F016444 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 247 |
| Average Sequence Length | 41 residues |
| Representative Sequence | HMLPMLNAVDLKRLTTNKNVPETLRTTAMKLQRTRAELKK |
| Number of Associated Samples | 194 |
| Number of Associated Scaffolds | 247 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 1.62 % |
| % of genes near scaffold ends (potentially truncated) | 95.14 % |
| % of genes from short scaffolds (< 2000 bps) | 87.85 % |
| Associated GOLD sequencing projects | 181 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.61 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (79.757 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (25.911 % of family members) |
| Environment Ontology (ENVO) | Unclassified (29.960 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (45.749 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 44.12% β-sheet: 0.00% Coil/Unstructured: 55.88% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.61 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 247 Family Scaffolds |
|---|---|---|
| PF01425 | Amidase | 16.60 |
| PF03724 | META | 6.07 |
| PF04226 | Transgly_assoc | 4.86 |
| PF13628 | DUF4142 | 4.86 |
| PF00149 | Metallophos | 2.02 |
| PF06271 | RDD | 2.02 |
| PF01979 | Amidohydro_1 | 1.62 |
| PF00581 | Rhodanese | 1.21 |
| PF13668 | Ferritin_2 | 1.21 |
| PF00383 | dCMP_cyt_deam_1 | 0.81 |
| PF01266 | DAO | 0.81 |
| PF14534 | DUF4440 | 0.81 |
| PF13248 | zf-ribbon_3 | 0.81 |
| PF05016 | ParE_toxin | 0.81 |
| PF00190 | Cupin_1 | 0.40 |
| PF00793 | DAHP_synth_1 | 0.40 |
| PF02698 | DUF218 | 0.40 |
| PF04389 | Peptidase_M28 | 0.40 |
| PF12704 | MacB_PCD | 0.40 |
| PF05187 | ETF_QO | 0.40 |
| PF07883 | Cupin_2 | 0.40 |
| PF08570 | DUF1761 | 0.40 |
| PF04237 | YjbR | 0.40 |
| COG ID | Name | Functional Category | % Frequency in 247 Family Scaffolds |
|---|---|---|---|
| COG0154 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase | Translation, ribosomal structure and biogenesis [J] | 16.60 |
| COG3187 | Heat shock protein HslJ | Posttranslational modification, protein turnover, chaperones [O] | 6.07 |
| COG2261 | Uncharacterized membrane protein YeaQ/YmgE, transglycosylase-associated protein family | General function prediction only [R] | 4.86 |
| COG1714 | Uncharacterized membrane protein YckC, RDD family | Function unknown [S] | 2.02 |
| COG0644 | Dehydrogenase (flavoprotein) | Energy production and conversion [C] | 0.40 |
| COG1434 | Lipid carrier protein ElyC involved in cell wall biogenesis, DUF218 family | Cell wall/membrane/envelope biogenesis [M] | 0.40 |
| COG2315 | Predicted DNA-binding protein with ‘double-wing’ structural motif, MmcQ/YjbR family | Transcription [K] | 0.40 |
| COG2440 | Ferredoxin-like protein FixX | Energy production and conversion [C] | 0.40 |
| COG2949 | Uncharacterized periplasmic protein SanA, affects membrane permeability for vancomycin | Cell wall/membrane/envelope biogenesis [M] | 0.40 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 79.76 % |
| Unclassified | root | N/A | 20.24 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2088090014|GPIPI_16590280 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1324 | Open in IMG/M |
| 2170459002|F0B48LX02J2DIN | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 501 | Open in IMG/M |
| 3300001527|A3513AW1_1303467 | All Organisms → cellular organisms → Bacteria | 712 | Open in IMG/M |
| 3300002908|JGI25382J43887_10293515 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 717 | Open in IMG/M |
| 3300004091|Ga0062387_100114971 | All Organisms → cellular organisms → Bacteria | 1480 | Open in IMG/M |
| 3300004152|Ga0062386_101284744 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 609 | Open in IMG/M |
| 3300004267|Ga0066396_10087569 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
| 3300005166|Ga0066674_10388845 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 649 | Open in IMG/M |
| 3300005167|Ga0066672_10038781 | All Organisms → cellular organisms → Bacteria | 2665 | Open in IMG/M |
| 3300005176|Ga0066679_10385567 | All Organisms → cellular organisms → Bacteria | 917 | Open in IMG/M |
| 3300005176|Ga0066679_10634289 | All Organisms → cellular organisms → Bacteria | 697 | Open in IMG/M |
| 3300005332|Ga0066388_106089759 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 609 | Open in IMG/M |
| 3300005444|Ga0070694_100043256 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3011 | Open in IMG/M |
| 3300005468|Ga0070707_100927919 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 835 | Open in IMG/M |
| 3300005533|Ga0070734_10407046 | Not Available | 776 | Open in IMG/M |
| 3300005554|Ga0066661_10371944 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 874 | Open in IMG/M |
| 3300005566|Ga0066693_10031986 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1670 | Open in IMG/M |
| 3300005568|Ga0066703_10367185 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 863 | Open in IMG/M |
| 3300005568|Ga0066703_10508089 | All Organisms → cellular organisms → Bacteria | 714 | Open in IMG/M |
| 3300005610|Ga0070763_10334599 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 839 | Open in IMG/M |
| 3300005712|Ga0070764_11078642 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 508 | Open in IMG/M |
| 3300005764|Ga0066903_101476227 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1282 | Open in IMG/M |
| 3300005842|Ga0068858_101304781 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 714 | Open in IMG/M |
| 3300006050|Ga0075028_100313843 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 877 | Open in IMG/M |
| 3300006050|Ga0075028_100372129 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 811 | Open in IMG/M |
| 3300006059|Ga0075017_100029358 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3615 | Open in IMG/M |
| 3300006086|Ga0075019_10759228 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 616 | Open in IMG/M |
| 3300006162|Ga0075030_100937981 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 682 | Open in IMG/M |
| 3300006173|Ga0070716_100197236 | Not Available | 1335 | Open in IMG/M |
| 3300006175|Ga0070712_100599395 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → unclassified Granulicella → Granulicella sp. L46 | 932 | Open in IMG/M |
| 3300006176|Ga0070765_101734415 | Not Available | 586 | Open in IMG/M |
| 3300006354|Ga0075021_10003762 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 7979 | Open in IMG/M |
| 3300006794|Ga0066658_10752744 | Not Available | 544 | Open in IMG/M |
| 3300006797|Ga0066659_10437275 | All Organisms → cellular organisms → Bacteria | 1037 | Open in IMG/M |
| 3300006797|Ga0066659_10845941 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 761 | Open in IMG/M |
| 3300006881|Ga0068865_101878098 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
| 3300006954|Ga0079219_12247042 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 526 | Open in IMG/M |
| 3300007076|Ga0075435_100773782 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 835 | Open in IMG/M |
| 3300007788|Ga0099795_10439748 | Not Available | 599 | Open in IMG/M |
| 3300009012|Ga0066710_101312026 | All Organisms → cellular organisms → Bacteria | 1123 | Open in IMG/M |
| 3300009088|Ga0099830_10542657 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 951 | Open in IMG/M |
| 3300009088|Ga0099830_11581841 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 546 | Open in IMG/M |
| 3300009089|Ga0099828_10199738 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1784 | Open in IMG/M |
| 3300009089|Ga0099828_10919004 | Not Available | 781 | Open in IMG/M |
| 3300009089|Ga0099828_10961829 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 761 | Open in IMG/M |
| 3300009089|Ga0099828_11628607 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 568 | Open in IMG/M |
| 3300009090|Ga0099827_10492890 | Not Available | 1052 | Open in IMG/M |
| 3300009162|Ga0075423_11016927 | All Organisms → cellular organisms → Bacteria | 881 | Open in IMG/M |
| 3300009523|Ga0116221_1279358 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 722 | Open in IMG/M |
| 3300010043|Ga0126380_12293097 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 501 | Open in IMG/M |
| 3300010048|Ga0126373_11810970 | Not Available | 674 | Open in IMG/M |
| 3300010159|Ga0099796_10174154 | Not Available | 860 | Open in IMG/M |
| 3300010322|Ga0134084_10028450 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1551 | Open in IMG/M |
| 3300010325|Ga0134064_10357515 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 572 | Open in IMG/M |
| 3300010343|Ga0074044_10603734 | All Organisms → cellular organisms → Bacteria | 716 | Open in IMG/M |
| 3300010343|Ga0074044_10783609 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 623 | Open in IMG/M |
| 3300010359|Ga0126376_11817555 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 647 | Open in IMG/M |
| 3300010361|Ga0126378_10228827 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1946 | Open in IMG/M |
| 3300010361|Ga0126378_13175660 | Not Available | 523 | Open in IMG/M |
| 3300010362|Ga0126377_12112138 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 639 | Open in IMG/M |
| 3300010376|Ga0126381_105054554 | Not Available | 505 | Open in IMG/M |
| 3300010379|Ga0136449_103376552 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 612 | Open in IMG/M |
| 3300010398|Ga0126383_10816680 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1016 | Open in IMG/M |
| 3300010400|Ga0134122_10366248 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1261 | Open in IMG/M |
| 3300010866|Ga0126344_1131750 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 557 | Open in IMG/M |
| 3300011120|Ga0150983_13847890 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 734 | Open in IMG/M |
| 3300011269|Ga0137392_10133711 | Not Available | 1990 | Open in IMG/M |
| 3300011269|Ga0137392_10554829 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 954 | Open in IMG/M |
| 3300011270|Ga0137391_10277347 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1449 | Open in IMG/M |
| 3300011270|Ga0137391_11490872 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 521 | Open in IMG/M |
| 3300011271|Ga0137393_11648212 | Not Available | 531 | Open in IMG/M |
| 3300011271|Ga0137393_11706779 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 519 | Open in IMG/M |
| 3300011271|Ga0137393_11778682 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 504 | Open in IMG/M |
| 3300012096|Ga0137389_10228054 | Not Available | 1559 | Open in IMG/M |
| 3300012189|Ga0137388_11919698 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 522 | Open in IMG/M |
| 3300012200|Ga0137382_11244128 | Not Available | 527 | Open in IMG/M |
| 3300012202|Ga0137363_10423373 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1111 | Open in IMG/M |
| 3300012203|Ga0137399_11062435 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 682 | Open in IMG/M |
| 3300012205|Ga0137362_10122785 | Not Available | 2204 | Open in IMG/M |
| 3300012205|Ga0137362_10579584 | Not Available | 968 | Open in IMG/M |
| 3300012207|Ga0137381_11660421 | Not Available | 529 | Open in IMG/M |
| 3300012208|Ga0137376_11022272 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 708 | Open in IMG/M |
| 3300012210|Ga0137378_10322251 | All Organisms → cellular organisms → Bacteria | 1437 | Open in IMG/M |
| 3300012349|Ga0137387_10323132 | Not Available | 1116 | Open in IMG/M |
| 3300012357|Ga0137384_11105717 | Not Available | 635 | Open in IMG/M |
| 3300012361|Ga0137360_10707956 | Not Available | 865 | Open in IMG/M |
| 3300012361|Ga0137360_10945760 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 743 | Open in IMG/M |
| 3300012361|Ga0137360_11000888 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 721 | Open in IMG/M |
| 3300012582|Ga0137358_10271888 | All Organisms → cellular organisms → Bacteria | 1152 | Open in IMG/M |
| 3300012582|Ga0137358_10550414 | Not Available | 776 | Open in IMG/M |
| 3300012683|Ga0137398_10245732 | All Organisms → cellular organisms → Bacteria | 1191 | Open in IMG/M |
| 3300012917|Ga0137395_10392477 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 993 | Open in IMG/M |
| 3300012917|Ga0137395_11176395 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 538 | Open in IMG/M |
| 3300012922|Ga0137394_11221000 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 615 | Open in IMG/M |
| 3300012923|Ga0137359_10107972 | Not Available | 2460 | Open in IMG/M |
| 3300012925|Ga0137419_10573431 | All Organisms → cellular organisms → Bacteria | 904 | Open in IMG/M |
| 3300012927|Ga0137416_10060302 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2706 | Open in IMG/M |
| 3300012927|Ga0137416_10710083 | Not Available | 884 | Open in IMG/M |
| 3300012929|Ga0137404_12026400 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 537 | Open in IMG/M |
| 3300012931|Ga0153915_10795307 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1096 | Open in IMG/M |
| 3300012931|Ga0153915_11006040 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 971 | Open in IMG/M |
| 3300012944|Ga0137410_10809590 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 787 | Open in IMG/M |
| 3300012976|Ga0134076_10223832 | Not Available | 795 | Open in IMG/M |
| 3300012977|Ga0134087_10260712 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 798 | Open in IMG/M |
| 3300013308|Ga0157375_12588830 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 606 | Open in IMG/M |
| 3300014152|Ga0181533_1139437 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1008 | Open in IMG/M |
| 3300014153|Ga0181527_1056961 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2051 | Open in IMG/M |
| 3300014153|Ga0181527_1140874 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1068 | Open in IMG/M |
| 3300014155|Ga0181524_10119847 | All Organisms → cellular organisms → Bacteria | 1423 | Open in IMG/M |
| 3300014155|Ga0181524_10243770 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 849 | Open in IMG/M |
| 3300014157|Ga0134078_10039770 | Not Available | 1584 | Open in IMG/M |
| 3300014200|Ga0181526_10976080 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| 3300015053|Ga0137405_1304024 | All Organisms → cellular organisms → Bacteria | 2037 | Open in IMG/M |
| 3300015054|Ga0137420_1395219 | Not Available | 2504 | Open in IMG/M |
| 3300015241|Ga0137418_10036065 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4568 | Open in IMG/M |
| 3300015241|Ga0137418_10127439 | All Organisms → cellular organisms → Bacteria | 2264 | Open in IMG/M |
| 3300015241|Ga0137418_10490225 | All Organisms → cellular organisms → Bacteria | 985 | Open in IMG/M |
| 3300015264|Ga0137403_11443340 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 537 | Open in IMG/M |
| 3300015358|Ga0134089_10549055 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 512 | Open in IMG/M |
| 3300015371|Ga0132258_11670519 | All Organisms → cellular organisms → Bacteria | 1607 | Open in IMG/M |
| 3300016341|Ga0182035_12153622 | Not Available | 506 | Open in IMG/M |
| 3300016357|Ga0182032_10585828 | All Organisms → cellular organisms → Bacteria | 927 | Open in IMG/M |
| 3300016404|Ga0182037_10867280 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 781 | Open in IMG/M |
| 3300016445|Ga0182038_11840486 | Not Available | 547 | Open in IMG/M |
| 3300017657|Ga0134074_1409007 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 504 | Open in IMG/M |
| 3300017823|Ga0187818_10397767 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 612 | Open in IMG/M |
| 3300017933|Ga0187801_10055820 | All Organisms → cellular organisms → Bacteria | 1443 | Open in IMG/M |
| 3300017937|Ga0187809_10401313 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
| 3300017947|Ga0187785_10195763 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 877 | Open in IMG/M |
| 3300017955|Ga0187817_10573762 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 720 | Open in IMG/M |
| 3300017970|Ga0187783_11078871 | Not Available | 578 | Open in IMG/M |
| 3300017972|Ga0187781_10028016 | All Organisms → cellular organisms → Bacteria | 3891 | Open in IMG/M |
| 3300017972|Ga0187781_11005212 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 610 | Open in IMG/M |
| 3300018012|Ga0187810_10489436 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 524 | Open in IMG/M |
| 3300018060|Ga0187765_10102388 | All Organisms → cellular organisms → Bacteria | 1561 | Open in IMG/M |
| 3300018088|Ga0187771_11830124 | Not Available | 515 | Open in IMG/M |
| 3300018089|Ga0187774_10775127 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
| 3300018468|Ga0066662_11403056 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 723 | Open in IMG/M |
| 3300018482|Ga0066669_12419159 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 504 | Open in IMG/M |
| 3300019890|Ga0193728_1079101 | All Organisms → cellular organisms → Bacteria | 1551 | Open in IMG/M |
| 3300020140|Ga0179590_1165212 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 606 | Open in IMG/M |
| 3300020579|Ga0210407_10526546 | All Organisms → cellular organisms → Bacteria | 923 | Open in IMG/M |
| 3300020579|Ga0210407_11045151 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 621 | Open in IMG/M |
| 3300020579|Ga0210407_11150199 | Not Available | 586 | Open in IMG/M |
| 3300020580|Ga0210403_10389090 | Not Available | 1139 | Open in IMG/M |
| 3300020581|Ga0210399_10207706 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1629 | Open in IMG/M |
| 3300020581|Ga0210399_10601263 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → unclassified Granulicella → Granulicella sp. L46 | 910 | Open in IMG/M |
| 3300020581|Ga0210399_10970783 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 686 | Open in IMG/M |
| 3300020582|Ga0210395_11204323 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter lichenicola | 556 | Open in IMG/M |
| 3300021086|Ga0179596_10473641 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 634 | Open in IMG/M |
| 3300021168|Ga0210406_10415966 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1075 | Open in IMG/M |
| 3300021170|Ga0210400_10378663 | Not Available | 1166 | Open in IMG/M |
| 3300021170|Ga0210400_11574004 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 519 | Open in IMG/M |
| 3300021181|Ga0210388_10278358 | Not Available | 1469 | Open in IMG/M |
| 3300021181|Ga0210388_11369936 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 595 | Open in IMG/M |
| 3300021433|Ga0210391_10827905 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 723 | Open in IMG/M |
| 3300021478|Ga0210402_10065394 | All Organisms → cellular organisms → Bacteria | 3203 | Open in IMG/M |
| 3300023259|Ga0224551_1014074 | All Organisms → cellular organisms → Bacteria | 1344 | Open in IMG/M |
| 3300024246|Ga0247680_1056919 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 570 | Open in IMG/M |
| 3300024288|Ga0179589_10253473 | Not Available | 782 | Open in IMG/M |
| 3300024290|Ga0247667_1000943 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 6645 | Open in IMG/M |
| 3300024330|Ga0137417_1253052 | Not Available | 2449 | Open in IMG/M |
| 3300024330|Ga0137417_1360430 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1830 | Open in IMG/M |
| 3300025472|Ga0208692_1035964 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1281 | Open in IMG/M |
| 3300025475|Ga0208478_1046580 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 826 | Open in IMG/M |
| 3300025898|Ga0207692_10230437 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → unclassified Granulicella → Granulicella sp. L46 | 1102 | Open in IMG/M |
| 3300025961|Ga0207712_11176101 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 684 | Open in IMG/M |
| 3300026319|Ga0209647_1106959 | All Organisms → cellular organisms → Bacteria | 1320 | Open in IMG/M |
| 3300026320|Ga0209131_1171373 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1064 | Open in IMG/M |
| 3300026325|Ga0209152_10110693 | All Organisms → cellular organisms → Bacteria | 1041 | Open in IMG/M |
| 3300026325|Ga0209152_10142850 | Not Available | 911 | Open in IMG/M |
| 3300026328|Ga0209802_1170060 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 891 | Open in IMG/M |
| 3300026332|Ga0209803_1340949 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300026467|Ga0257154_1078245 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 526 | Open in IMG/M |
| 3300026550|Ga0209474_10041215 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3369 | Open in IMG/M |
| 3300026551|Ga0209648_10304744 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1136 | Open in IMG/M |
| 3300026555|Ga0179593_1080666 | All Organisms → cellular organisms → Bacteria | 2672 | Open in IMG/M |
| 3300026555|Ga0179593_1115183 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2250 | Open in IMG/M |
| 3300026555|Ga0179593_1118286 | All Organisms → cellular organisms → Bacteria | 2236 | Open in IMG/M |
| 3300026557|Ga0179587_10916232 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 578 | Open in IMG/M |
| 3300026941|Ga0207741_1006685 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1387 | Open in IMG/M |
| 3300027109|Ga0208603_1034395 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 790 | Open in IMG/M |
| 3300027376|Ga0209004_1026580 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 937 | Open in IMG/M |
| 3300027652|Ga0209007_1054696 | All Organisms → cellular organisms → Bacteria | 1013 | Open in IMG/M |
| 3300027671|Ga0209588_1020238 | Not Available | 2083 | Open in IMG/M |
| 3300027671|Ga0209588_1121881 | Not Available | 834 | Open in IMG/M |
| 3300027701|Ga0209447_10003965 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4452 | Open in IMG/M |
| 3300027737|Ga0209038_10039816 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidipila → unclassified Acidipila → Acidipila sp. | 1401 | Open in IMG/M |
| 3300027737|Ga0209038_10253670 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales | 527 | Open in IMG/M |
| 3300027775|Ga0209177_10384301 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 558 | Open in IMG/M |
| 3300027795|Ga0209139_10220951 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 670 | Open in IMG/M |
| 3300027821|Ga0209811_10082543 | All Organisms → cellular organisms → Bacteria | 1136 | Open in IMG/M |
| 3300027857|Ga0209166_10180697 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1141 | Open in IMG/M |
| 3300027874|Ga0209465_10179166 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1056 | Open in IMG/M |
| 3300027875|Ga0209283_10012704 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 5022 | Open in IMG/M |
| 3300027875|Ga0209283_10258640 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1153 | Open in IMG/M |
| 3300027875|Ga0209283_10599689 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 698 | Open in IMG/M |
| 3300027875|Ga0209283_10898707 | Not Available | 536 | Open in IMG/M |
| 3300027889|Ga0209380_10220872 | All Organisms → cellular organisms → Bacteria | 1113 | Open in IMG/M |
| 3300027908|Ga0209006_11278557 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 569 | Open in IMG/M |
| 3300028047|Ga0209526_10036661 | All Organisms → cellular organisms → Bacteria | 3451 | Open in IMG/M |
| 3300028906|Ga0308309_11338864 | Not Available | 615 | Open in IMG/M |
| 3300029944|Ga0311352_10167340 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidipila → unclassified Acidipila → Acidipila sp. | 1893 | Open in IMG/M |
| 3300031231|Ga0170824_100321330 | Not Available | 707 | Open in IMG/M |
| 3300031231|Ga0170824_114594125 | All Organisms → cellular organisms → Bacteria | 1078 | Open in IMG/M |
| 3300031234|Ga0302325_10355973 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidipila → unclassified Acidipila → Acidipila sp. | 2320 | Open in IMG/M |
| 3300031474|Ga0170818_111331575 | All Organisms → cellular organisms → Bacteria | 1024 | Open in IMG/M |
| 3300031681|Ga0318572_10928345 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300031715|Ga0307476_11355926 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 518 | Open in IMG/M |
| 3300031720|Ga0307469_10211787 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → unclassified Granulicella → Granulicella sp. L46 | 1524 | Open in IMG/M |
| 3300031720|Ga0307469_11971641 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 566 | Open in IMG/M |
| 3300031736|Ga0318501_10629543 | Not Available | 590 | Open in IMG/M |
| 3300031754|Ga0307475_10419957 | All Organisms → cellular organisms → Bacteria | 1075 | Open in IMG/M |
| 3300031754|Ga0307475_11110879 | Not Available | 618 | Open in IMG/M |
| 3300031768|Ga0318509_10102765 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1543 | Open in IMG/M |
| 3300031769|Ga0318526_10440888 | Not Available | 532 | Open in IMG/M |
| 3300031770|Ga0318521_10790747 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 578 | Open in IMG/M |
| 3300031823|Ga0307478_11309249 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 602 | Open in IMG/M |
| 3300031823|Ga0307478_11559644 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 546 | Open in IMG/M |
| 3300031823|Ga0307478_11683699 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis → Candidatus Koribacter versatilis Ellin345 | 523 | Open in IMG/M |
| 3300031880|Ga0318544_10168261 | All Organisms → cellular organisms → Bacteria | 843 | Open in IMG/M |
| 3300031890|Ga0306925_11080241 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 812 | Open in IMG/M |
| 3300031912|Ga0306921_12548852 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 529 | Open in IMG/M |
| 3300031954|Ga0306926_12912135 | Not Available | 514 | Open in IMG/M |
| 3300031962|Ga0307479_10227342 | Not Available | 1840 | Open in IMG/M |
| 3300032001|Ga0306922_10433304 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1406 | Open in IMG/M |
| 3300032035|Ga0310911_10656527 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 608 | Open in IMG/M |
| 3300032042|Ga0318545_10225503 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 672 | Open in IMG/M |
| 3300032076|Ga0306924_10548641 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1312 | Open in IMG/M |
| 3300032076|Ga0306924_10608182 | All Organisms → cellular organisms → Bacteria | 1236 | Open in IMG/M |
| 3300032076|Ga0306924_10649832 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1189 | Open in IMG/M |
| 3300032091|Ga0318577_10435650 | All Organisms → cellular organisms → Bacteria | 626 | Open in IMG/M |
| 3300032174|Ga0307470_11494546 | Not Available | 561 | Open in IMG/M |
| 3300032180|Ga0307471_100003831 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 9105 | Open in IMG/M |
| 3300032180|Ga0307471_100167074 | All Organisms → cellular organisms → Bacteria | 2146 | Open in IMG/M |
| 3300032180|Ga0307471_100383363 | All Organisms → cellular organisms → Bacteria | 1528 | Open in IMG/M |
| 3300032892|Ga0335081_10043892 | All Organisms → cellular organisms → Bacteria | 7073 | Open in IMG/M |
| 3300032898|Ga0335072_10570059 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1148 | Open in IMG/M |
| 3300032898|Ga0335072_11709255 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 524 | Open in IMG/M |
| 3300032954|Ga0335083_10223721 | All Organisms → cellular organisms → Bacteria | 1703 | Open in IMG/M |
| 3300032954|Ga0335083_11043682 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter lichenicola | 641 | Open in IMG/M |
| 3300032955|Ga0335076_10173397 | All Organisms → cellular organisms → Bacteria | 2066 | Open in IMG/M |
| 3300032955|Ga0335076_11542765 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 551 | Open in IMG/M |
| 3300033289|Ga0310914_11830690 | Not Available | 511 | Open in IMG/M |
| 3300033402|Ga0326728_10106074 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3346 | Open in IMG/M |
| 3300033480|Ga0316620_10939190 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 838 | Open in IMG/M |
| 3300033983|Ga0371488_0154166 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1201 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 25.91% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 11.34% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 6.88% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 5.26% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.45% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.24% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.24% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.43% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 2.43% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.43% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.43% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.83% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.83% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.83% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.02% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.02% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.02% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.02% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.21% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.21% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.81% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.81% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.81% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.81% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.81% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.81% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.81% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.40% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.40% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.40% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.40% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.40% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.40% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.40% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.40% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.40% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.40% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.40% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.40% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.40% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2088090014 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 2170459002 | Grass soil microbial communities from Rothamsted Park, UK - March 2009 direct MP BIO 1O1 lysis 0-21 cm | Environmental | Open in IMG/M |
| 3300001527 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A3-5cm-13A)- 1 week illumina | Environmental | Open in IMG/M |
| 3300002908 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300004267 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 6 MoBio | Environmental | Open in IMG/M |
| 3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005533 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009523 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
| 3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010866 | Boreal forest soil eukaryotic communities from Alaska, USA - C1-3 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014152 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_60_metaG | Environmental | Open in IMG/M |
| 3300014153 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_60_metaG | Environmental | Open in IMG/M |
| 3300014155 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_60_metaG | Environmental | Open in IMG/M |
| 3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300014200 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaG | Environmental | Open in IMG/M |
| 3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017657 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015 | Environmental | Open in IMG/M |
| 3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
| 3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
| 3300017937 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4 | Environmental | Open in IMG/M |
| 3300017947 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018012 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5 | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300018089 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019890 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1 | Environmental | Open in IMG/M |
| 3300020140 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300023259 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P3 20-24 | Environmental | Open in IMG/M |
| 3300024246 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK21 | Environmental | Open in IMG/M |
| 3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300024290 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK08 | Environmental | Open in IMG/M |
| 3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025472 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_100 (SPAdes) | Environmental | Open in IMG/M |
| 3300025475 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-2 deep-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026319 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes) | Environmental | Open in IMG/M |
| 3300026328 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes) | Environmental | Open in IMG/M |
| 3300026332 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes) | Environmental | Open in IMG/M |
| 3300026467 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-16-A | Environmental | Open in IMG/M |
| 3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026555 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300026941 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 39 (SPAdes) | Environmental | Open in IMG/M |
| 3300027109 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF008 (SPAdes) | Environmental | Open in IMG/M |
| 3300027376 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027652 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027701 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027737 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027775 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes) | Environmental | Open in IMG/M |
| 3300027795 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027821 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027857 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029944 | II_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031769 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031880 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032042 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033402 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MN | Environmental | Open in IMG/M |
| 3300033480 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D5_B | Environmental | Open in IMG/M |
| 3300033983 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB23AN SIP fraction | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| GPIPI_01059890 | 2088090014 | Soil | MLNPMDLKRLTMNKNVPETLRTTAVKLQRQRAETKK |
| E1_04458440 | 2170459002 | Grass Soil | NPPDLKKLGMNKNIPETLRATAVKLMRQRNETKNS |
| A3513AW1_13034672 | 3300001527 | Permafrost | LDMLPMLNAVDLKKLSNNKNVPETLRTTATKLIRTRAVQH* |
| JGI25382J43887_102935153 | 3300002908 | Grasslands Soil | LPQLNAQDLKRLTMNKNIPETLRSTAMKLNRQRMENRPGSR* |
| Ga0062387_1001149711 | 3300004091 | Bog Forest Soil | HMLPMVNVMDLKKLTNNKNVPETLRTTATKLQRTRAELKK* |
| Ga0062386_1012847441 | 3300004152 | Bog Forest Soil | LDVSLHMLPILNALDLKRLSMNKNIPETLRSTANKLLRTRADLKK* |
| Ga0066396_100875692 | 3300004267 | Tropical Forest Soil | TLHMLPLLNAQDLKRLTMNKNIPETLRTTAIKLQRQRQEFKK* |
| Ga0066674_103888451 | 3300005166 | Soil | PLDVTMHMLPMLNAVDLKRLTTNKNVPETLRTTAVKLQRTRADLNK* |
| Ga0066672_100387816 | 3300005167 | Soil | TMHMLPMLNAVDLKRLTTNKNVPETLRTTAIKLQRTRSELKR* |
| Ga0066679_103855673 | 3300005176 | Soil | NLLPMLNPPDLKKLGMNKNIPETLRATAVKLMRQRNETKK* |
| Ga0066679_106342892 | 3300005176 | Soil | HMLPMLNAVDLKRLTTNKNVPETLRTTAIKLQRTRSELKR* |
| Ga0066388_1060897592 | 3300005332 | Tropical Forest Soil | LHMLPMLNAQDLKRLTSNKNVPETLRTTAMKLQRTRAEQKK* |
| Ga0070694_1000432561 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | KTPLDVSLHMLPMINAMDLKKLTTNKNIPETLRTTAGKLQRTRTELKK* |
| Ga0070707_1009279191 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | SPLDVTLHMLPMLNPLDLKRLCTNKNIPETLRTTANKLQRQRMENKK* |
| Ga0070734_104070461 | 3300005533 | Surface Soil | AIDLKRLTTNKNVPETLRTTALKLQRTRAIQKEK* |
| Ga0066661_103719443 | 3300005554 | Soil | HMLPMLNAVDLKRLTTNKNVPETLRTTAMKLQRTRAELKK* |
| Ga0066693_100319863 | 3300005566 | Soil | LDVTLHMLPMLNAVDLKRLTTNKNVPETLRTTAMKLQRTRAELKK* |
| Ga0066703_103671853 | 3300005568 | Soil | VTLHMLPMLNAVDLKRLTTNKNVPETLRTTAMKLQRTRAELKK* |
| Ga0066703_105080892 | 3300005568 | Soil | VTLHMLPMLNAVDLKRLTTNKNVPETLRTTAMKLQRTRADLKK* |
| Ga0070763_103345991 | 3300005610 | Soil | VMLNPVDLKRLTTNKNVPETLRTTALKLQKQRAETKKG* |
| Ga0070764_110786421 | 3300005712 | Soil | PLDVSLHMLPMVNVMDLKKLTNNKNVPETLRTTATKLQRTRAELKK* |
| Ga0066903_1014762273 | 3300005764 | Tropical Forest Soil | MLPMLNPQDLKRLATNKNVPETLRTSAFKLQRTRADQKK* |
| Ga0068858_1013047812 | 3300005842 | Switchgrass Rhizosphere | MLPLINVMDLKRLTTNKNIPETLRTTAQKLHRQRQESKK* |
| Ga0075028_1003138431 | 3300006050 | Watersheds | VTMHMLPMLNAVDLKRLTGNKNVPETLRTTAIKLQRTRAELKK* |
| Ga0075028_1003721291 | 3300006050 | Watersheds | LDVTMHMLPMLNAVDLKRLTSNKNVPETLRTTAIKLQKTRAELKK* |
| Ga0075017_1000293585 | 3300006059 | Watersheds | LNAVDLKRLTSNKNVPETLRTTAVKLQRTRADLKK* |
| Ga0075019_107592281 | 3300006086 | Watersheds | HMLPMLNAVDLKRLTSNKNVPETLRTTAVKLQRTRADLKK* |
| Ga0075030_1009379811 | 3300006162 | Watersheds | HMLPVLTLADLKKLSMNKNVPETLRSSALKLQRTRASTQK* |
| Ga0070716_1001972362 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MLPMLNPLDLKRLCTNKNVPETLRTTATKLQRQRQENKK* |
| Ga0070712_1005993952 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | VSLHMLPMLNALDLKKLTMNKNIPETLRSTSLKLQRTRKELQK* |
| Ga0070765_1017344151 | 3300006176 | Soil | ILNAIDLKKLSMNKNVPETLRTTANKLMRTRADQKN* |
| Ga0075021_100037621 | 3300006354 | Watersheds | MHMLPLLNAQDLKRLTTNKNIPETLRTTAHKLHRTRQENKK* |
| Ga0066658_107527441 | 3300006794 | Soil | VSLHMLPMLNPLDLKRLTNNKNVPETLRTTANKLQRQRQDKR* |
| Ga0066659_104372753 | 3300006797 | Soil | DVTLHMLPMLNAVDLKRLTTNKNVPETLRTTAMKLQRTRADLKK* |
| Ga0066659_108459412 | 3300006797 | Soil | DVTLHMLPMLNAVDLKRLTTNKNVPETLRTTAMKLQRTRAELKK* |
| Ga0068865_1018780981 | 3300006881 | Miscanthus Rhizosphere | PLDVTLNLLPMLNPMDLKKLTMNKNVPETLRTTAIKLQRQRAETKK* |
| Ga0079219_122470421 | 3300006954 | Agricultural Soil | MLNPQDLKRLTTNKNIPETLRTTASKLQRTRADQKK* |
| Ga0075435_1007737821 | 3300007076 | Populus Rhizosphere | VSLHLLPMVNAVDLKKLTMNKNVPETLRTSAVKLQRQRAEFKK* |
| Ga0099795_104397482 | 3300007788 | Vadose Zone Soil | SPLDVTLHMLPMLNPLDLKRLCTNKNIPETLRTTANKLQRKRMENKK* |
| Ga0066710_1013120261 | 3300009012 | Grasslands Soil | DISLNLLPMLNPTDLKKLGMNKNIPETLRSTAVKLMRQRNETKK |
| Ga0099830_105426571 | 3300009088 | Vadose Zone Soil | PKVPLDVTLHMLPMLNAVDLKRLTTNKNVAETLRTTAMKLQRTRAALKK* |
| Ga0099830_115818412 | 3300009088 | Vadose Zone Soil | LNAVDLKRLTTNKNVPETLRTTAFKLQRTRTALKK* |
| Ga0099828_101997381 | 3300009089 | Vadose Zone Soil | MLNAVDLKRLTTNKNVPDTLRTTAFKLQRTRAELKK* |
| Ga0099828_109190041 | 3300009089 | Vadose Zone Soil | TLHMLPMLNAQDLKRLTMNKNIPETLRTTAFKLQRTRADLKK* |
| Ga0099828_109618292 | 3300009089 | Vadose Zone Soil | PMLNAVDLKRLISNRNVAETLRTTAMKLQRTRVELRK* |
| Ga0099828_116286071 | 3300009089 | Vadose Zone Soil | KVPLDVTLHMLPMLNAVDLKRLNTNKNVAETLRTTAMKLQRTRAALKK* |
| Ga0099827_104928901 | 3300009090 | Vadose Zone Soil | PLDVTMHMLPMLNAVDLKRLTTNKNVPETLRTTAVKLQRTRADLKK* |
| Ga0075423_110169272 | 3300009162 | Populus Rhizosphere | LHMLPLINVVDLKRLTTNKNIPETLRTTAQKLHRQRQESKK* |
| Ga0116221_12793583 | 3300009523 | Peatlands Soil | LDVSLRLLPMVHVPELRSLISNKNIPETLRTTATKLFRQRTDKKD* |
| Ga0126380_122930971 | 3300010043 | Tropical Forest Soil | DVTLNLLPMLNPLDLKKLTMNKNVPETLRTTAVKLQRQRAETKK* |
| Ga0126373_118109701 | 3300010048 | Tropical Forest Soil | MLPLLNAVDLKKLAMNKNVPDTLRTTAAKLMRTRAEQKK* |
| Ga0099796_101741541 | 3300010159 | Vadose Zone Soil | MLNPLDLKRLCTNKNIPETLRTTANKLQRQRMENKK* |
| Ga0134084_100284503 | 3300010322 | Grasslands Soil | VTMHMLPMLNAIDLKRLTSNKNVPETLRTTAMKLQRTRAELKK* |
| Ga0134064_103575151 | 3300010325 | Grasslands Soil | PLDVTMHMLPMLNAVDLKRLTTNKNVPETLRTTAIKLQRTRADLKK* |
| Ga0074044_106037342 | 3300010343 | Bog Forest Soil | MLPMLNAIDLKKLTTNKNVPETLRTTAHKLQRQRAEFKK* |
| Ga0074044_107836092 | 3300010343 | Bog Forest Soil | HMLPILNALDLKRLCMNKNIPETLRSTANKLMRTRADQRR* |
| Ga0126376_118175551 | 3300010359 | Tropical Forest Soil | SLNMLPLLNPVDLKRLTTNKNVPETLRTTAYKLQKQRAETKKG* |
| Ga0126378_102288273 | 3300010361 | Tropical Forest Soil | LPMLNPQDLKRLTTNKNVPETLRTTASKLQRTRADQKK* |
| Ga0126378_131756602 | 3300010361 | Tropical Forest Soil | HMLPMLNAQDLKRLTTNKNVPETLRTTAFKLQRTRAEQKR* |
| Ga0126377_121121382 | 3300010362 | Tropical Forest Soil | KVPLDVSLHLLPMINAVDLKKLTMNKNIPETLRTSAFKLQKQRAEIKK* |
| Ga0126381_1050545541 | 3300010376 | Tropical Forest Soil | TPLDVSLHMLPLLNAIDLKRLTTNKNIPETLRTTATKLQRTRADQKK* |
| Ga0136449_1033765521 | 3300010379 | Peatlands Soil | MLPMCNVMDLKKLTSNKNVPETLRTTAIKLQRTRAELKK* |
| Ga0126383_108166803 | 3300010398 | Tropical Forest Soil | TLHMLPMLNPQDLKRLTSNKNVPETLRTTANKLQRTRAEQKK* |
| Ga0134122_103662481 | 3300010400 | Terrestrial Soil | DVTLNLLPMLNPADLKKLTMNKNVPETLRTTAIKLQRQRAETKK* |
| Ga0126344_11317501 | 3300010866 | Boreal Forest Soil | KTPLDVSLHLLPVINPVDLKRLLMNKNVPETLRTTAGKLQRTRADAKK* |
| Ga0150983_138478901 | 3300011120 | Forest Soil | MLPSLNAVDLKKLSNNKNVPETLRTSATKLIRTRQATK* |
| Ga0137392_101337111 | 3300011269 | Vadose Zone Soil | PMLNAVDLKRLTTNKNVPETLRTTATKLQRTRADLKK* |
| Ga0137392_105548291 | 3300011269 | Vadose Zone Soil | TLHMLPVLTAADLKKLTMNKNVPETLRSSATKLQRTRASVQK* |
| Ga0137391_102773474 | 3300011270 | Vadose Zone Soil | LDVSLHMLPILNALDLKRLCINKNIPETLRSTANKLQLQRQNK* |
| Ga0137391_114908722 | 3300011270 | Vadose Zone Soil | GLLPMLNPPDLKKLGMNKNIPETLRATAVKLMRQRNESKK* |
| Ga0137393_116482122 | 3300011271 | Vadose Zone Soil | TMHMLPMLNGVDLKRLTTNKNIPETLRTTAFKLHRTRAELKK* |
| Ga0137393_117067792 | 3300011271 | Vadose Zone Soil | PLVNPMDLKLLTTNKNIPETLRTTAFKLVRQRKEAREK* |
| Ga0137393_117786822 | 3300011271 | Vadose Zone Soil | LDVSLHMLPMLNAVDLKRLTSNKNVPETLRTTAIKLQRTRAELKK* |
| Ga0137389_102280541 | 3300012096 | Vadose Zone Soil | MLNAVDLKRLTTNKNVPETLRTTAVKLQRTRAELKK* |
| Ga0137388_119196982 | 3300012189 | Vadose Zone Soil | MLNAVDLKRLISNRNVAETLRTTAMKLQRTRVELRK* |
| Ga0137382_112441282 | 3300012200 | Vadose Zone Soil | MLPMLNAVDLKRLTTNKNVPETLRTTAVKLQRTRADLKK* |
| Ga0137363_104233733 | 3300012202 | Vadose Zone Soil | LNAVDLKRLTTNKNVPETLRTTAMKLQRTRVEQKSK* |
| Ga0137399_110624351 | 3300012203 | Vadose Zone Soil | ILNAIDLKRLTTNKNIPETLRTTANKLHRTRAEFKK* |
| Ga0137362_101227852 | 3300012205 | Vadose Zone Soil | APLDVTMHMLPMLNAVDLKRLTTNKNVPETLRTTALKLQRTRAELKK* |
| Ga0137362_105795842 | 3300012205 | Vadose Zone Soil | VTMHMLPMLNAVDLKRLTTNKNVPETLRTTAVKLQRTRADLKK* |
| Ga0137381_116604211 | 3300012207 | Vadose Zone Soil | LDVSLHILPMINAQDLKRLTTNKNIPETLRTTAFKLQRTRVEQKK* |
| Ga0137376_110222721 | 3300012208 | Vadose Zone Soil | MLNAVDLKRLTTNKNVPETLRTTAIKLQRTRADLTK* |
| Ga0137378_103222513 | 3300012210 | Vadose Zone Soil | LLPMLNPTDLKKLGMNKNIPETLRATAVKLMRQRNETKK* |
| Ga0137387_103231321 | 3300012349 | Vadose Zone Soil | SPLDITLHMLPMLNAIDLKRLTTNKNVPETLRTTAMKLQRTRTDLKK* |
| Ga0137384_111057171 | 3300012357 | Vadose Zone Soil | PMLNAIDLKRLTTNKNVPETLRTTAMKLQRTRADLKK* |
| Ga0137360_107079562 | 3300012361 | Vadose Zone Soil | VTLHMLPMLNPLDLKRLCTNKNIPETLRTTANKLQRQRMENKK* |
| Ga0137360_109457601 | 3300012361 | Vadose Zone Soil | KTPLDVSLHMLPLINAMYLKRLTTNKNIPETLRTTALKLHKQRQEFKK* |
| Ga0137360_110008881 | 3300012361 | Vadose Zone Soil | MLNAVDLKRLVSNRNVAETLRTTAMKLQRTRVELRK* |
| Ga0137358_102718881 | 3300012582 | Vadose Zone Soil | MLPILNPIDLKRLTTNKNIPETLRTTANKLHRTRLEFKK* |
| Ga0137358_105504142 | 3300012582 | Vadose Zone Soil | HMLPMLNPLDLKRLCTNKNIPETLRTTANKLQRQRMENKK* |
| Ga0137398_102457321 | 3300012683 | Vadose Zone Soil | PLDVTMHMLPMLNAVDLKRLTTNKNVPETLRATAVKLQRTRIELKK* |
| Ga0137395_103924771 | 3300012917 | Vadose Zone Soil | VSLHMLPMLNAVDLKRLTTNKNIPETLRSTAMKLQRTRVELKSK* |
| Ga0137395_111763951 | 3300012917 | Vadose Zone Soil | MLPMLNAVDLKRLVSNRNVAETLRTTAMKLQRTRVELRK* |
| Ga0137394_112210001 | 3300012922 | Vadose Zone Soil | SLHMLPILNAIDLKRLTTNKNIPETLRTTANKLHRTRLEFKK* |
| Ga0137359_101079721 | 3300012923 | Vadose Zone Soil | HMLPMLNAVDLKRLTTNKNVPETLRTTALKLQRTRAELKK* |
| Ga0137419_105734313 | 3300012925 | Vadose Zone Soil | LNTIDLKRLASNKNAPETLRTTAAKLQRTRAELKK* |
| Ga0137416_100603021 | 3300012927 | Vadose Zone Soil | NAVDLKRLTTNKNVPETLRTTALKLQRTRAELKK* |
| Ga0137416_107100831 | 3300012927 | Vadose Zone Soil | NAVDLKRLTTNKNVPETLRTTATKLQRTRADLKK* |
| Ga0137404_120264001 | 3300012929 | Vadose Zone Soil | LPMLNAVDLKRLTTNKNVPETLRTTAMKLQRTRVELKSK* |
| Ga0153915_107953074 | 3300012931 | Freshwater Wetlands | LHMLPLLNAQDLKMLITNKNVPETLRTTAQKMHRQRMTKSGG* |
| Ga0153915_110060403 | 3300012931 | Freshwater Wetlands | VTLHMLPLLNAQDLKMLISNKNVPETLRTTALKMHRQRTMKSGG* |
| Ga0137410_108095901 | 3300012944 | Vadose Zone Soil | NAIDLKRLTTNKNIPETLRTTANKLHRTRLEFKK* |
| Ga0134076_102238321 | 3300012976 | Grasslands Soil | NPKAPLDVTMHMLPMLNAVDLKRLTTNKNIPETLRTTAFKLQRTRAALKK* |
| Ga0134087_102607122 | 3300012977 | Grasslands Soil | KSPLDVTLHMLPMLNAVDLKRLTSNKNVPETLRTTAMKLQRTRADLKK* |
| Ga0157375_125888302 | 3300013308 | Miscanthus Rhizosphere | NPMDLKKLTMSKNVPETLRTTAIKLQRQRAESKK* |
| Ga0181533_11394371 | 3300014152 | Bog | LPILNAADLKRLSMNKNIPETLRSTANKLMRTRADQKR* |
| Ga0181527_10569611 | 3300014153 | Bog | LDVSLHMLPILNAADLKRLSMNKNIPETLRSTANKLMRTRADQRR* |
| Ga0181527_11408741 | 3300014153 | Bog | LDVSLHMLPILNAADLKRLSMNKNIPETLRSTANKLMRTRADQKR* |
| Ga0181524_101198473 | 3300014155 | Bog | LNAADLKRLSMNKNIPETLRSTANKLMRTRADQRR* |
| Ga0181524_102437702 | 3300014155 | Bog | NAADLKRLSMNKNIPETLRSTANKLMRTRADQKR* |
| Ga0134078_100397702 | 3300014157 | Grasslands Soil | PLDVTMHMLPMLNAVDLKRLTTNKNVPETLRTTAVKLQRTRAELKK* |
| Ga0181526_109760802 | 3300014200 | Bog | PMLNVADVKKLSLNKNVPETLRTTAAKLIRTRADLKK* |
| Ga0137405_13040242 | 3300015053 | Vadose Zone Soil | MLNPLDLKRLCTNKNVPETLRTTANKLQRQRMENKK* |
| Ga0137420_13952192 | 3300015054 | Vadose Zone Soil | MSASTCAVLNAIDLKRLTTNKNVPETLRTTANKSSHRLEFKK* |
| Ga0137418_100360651 | 3300015241 | Vadose Zone Soil | PLDVSLHMLPMLNAVDLKRLTTNKNVPETLRTTAMKLQRTRVEQKSK* |
| Ga0137418_101274394 | 3300015241 | Vadose Zone Soil | PLDVSLHMLPMLNAVDLKRLTTNKNIPETLRSTAMKLQRTRVELKSK* |
| Ga0137418_104902251 | 3300015241 | Vadose Zone Soil | DVSLHMLPILNAIDLKRLTTNKNIPETLRTTANKLHRTRAEFKK* |
| Ga0137403_114433401 | 3300015264 | Vadose Zone Soil | LPMLNAVDLKRLTTNKNIPETLRTTAMKLQRTRVELKSK* |
| Ga0134089_105490551 | 3300015358 | Grasslands Soil | TLHMLPMLNAVDLKRLTSNKNVPETLRTTAMKLQRTRADLKK* |
| Ga0132258_116705194 | 3300015371 | Arabidopsis Rhizosphere | NLLPMLNPMDLKRLTMNKNVPETLRTTAVKLQRQRSESKK* |
| Ga0182035_121536222 | 3300016341 | Soil | LLNAVDLKKLSMNKNVPETLRSTAAKLMRTRADQKK |
| Ga0182032_105858282 | 3300016357 | Soil | VTLHMLPLLNVMDLKKLGMNKNVPETLRTTAAKLLRTRIEQKK |
| Ga0182037_108672801 | 3300016404 | Soil | MSNAMDLKRLCLNKNIAETLRSTAIKLQRQRQAAAKK |
| Ga0182038_118404862 | 3300016445 | Soil | DVSLHMLPMLNAMDLKKLTMNKNIPETLRSTSLKLQRTRKELQK |
| Ga0134074_14090071 | 3300017657 | Grasslands Soil | DVSLHLLPIINGVDLKRLTMNKNVPETLRSSAVKLQRQRAEFKK |
| Ga0187818_103977672 | 3300017823 | Freshwater Sediment | MINVMDLKKLTSNKNIPETLRTTALKLQRTRAELKK |
| Ga0187801_100558201 | 3300017933 | Freshwater Sediment | ILNALDLKRLSMNKNIPETLRSTASKLMRTRADQRR |
| Ga0187809_104013131 | 3300017937 | Freshwater Sediment | MLPMLNAMDLKKLAINKNVPETLRTSAAKLIRTRADLKK |
| Ga0187785_101957633 | 3300017947 | Tropical Peatland | DVSLHMLPLLNVVDLKKLSMSENVPETLRSTAQKLLRTRADLKK |
| Ga0187817_105737621 | 3300017955 | Freshwater Sediment | IDVSLHMLPLLNPGDLKKLSMNKNVPDTLRSSALKLMRTRAEQKR |
| Ga0187783_110788711 | 3300017970 | Tropical Peatland | LPLLNLADLKKLSLNKNVPDTLRTSAAKLLRTRSDQNK |
| Ga0187781_100280165 | 3300017972 | Tropical Peatland | MLPLLNPADLKKLSINKNVPDTLRSSAAKLMRVRAEQKR |
| Ga0187781_110052122 | 3300017972 | Tropical Peatland | LPLLNPADLKKLSMNKNVPDTLRTSAAKLMRVRAEQKQ |
| Ga0187810_104894362 | 3300018012 | Freshwater Sediment | PMINVMDLKKLTSNKNIPETLRTTALKLQRTRAELKK |
| Ga0187765_101023884 | 3300018060 | Tropical Peatland | LHMLPLLNALDLKRLSMNKNVPETLRTTAHKLMRTRAEQKK |
| Ga0187771_118301241 | 3300018088 | Tropical Peatland | PLDVSLHMLPILNALDLKRLCMNKNIPETLRSTANKLMRTRAEQRK |
| Ga0187774_107751271 | 3300018089 | Tropical Peatland | KTPIDVSLHLLQRLTTPDLKQLGMNKNIPETVRSVAVKMSRVRAVKG |
| Ga0066662_114030561 | 3300018468 | Grasslands Soil | PIDVSLHILPQLNAQDLKRLTMNKNIPETLRSTAMKLNRQRQENRPGSR |
| Ga0066669_124191592 | 3300018482 | Grasslands Soil | PMLNPTDLKKLGMNKNIPETLRATAVKLMRQRSETKK |
| Ga0193728_10791013 | 3300019890 | Soil | HMLPSLNAVDLKKLSNNKNVPETLRTTAAKLIRTRQTLK |
| Ga0179590_11652122 | 3300020140 | Vadose Zone Soil | GLLPMLNPPDLKKLGMNKNIPETLRATAVKLMRQRSETKK |
| Ga0210407_105265461 | 3300020579 | Soil | MLPMLNAVDLKRLTSNKNVPETLRTTAIKLQKTRAELKK |
| Ga0210407_110451512 | 3300020579 | Soil | PLDVSLHMLPMLNAVDLKRLTTNKNVPETLRTTANKLQRTRIDMKK |
| Ga0210407_111501992 | 3300020579 | Soil | MLPMLNAADLKRLTMNKNVPETLRTTAVKLQRTRADLKKQ |
| Ga0210403_103890901 | 3300020580 | Soil | KTPLDVSLHMLPILNALDLKRLCVNKNIPETLRTTANKLQRQRQNK |
| Ga0210399_102077064 | 3300020581 | Soil | DVTLHMLPVLTPSDLKKLTMNKNVPETLRSSALKLQRTRASTQK |
| Ga0210399_106012631 | 3300020581 | Soil | MLNALDLKKLTMNKNIPETLRSTSLKLQRTRKELQK |
| Ga0210399_109707832 | 3300020581 | Soil | HMLPMLNAVDLKRLTTNKNVPETLRTTATKLQRTRIELKK |
| Ga0210395_112043232 | 3300020582 | Soil | PLLNAVDLKKLANNKNVPETLRTSAAKLIRTRADQKK |
| Ga0179596_104736411 | 3300021086 | Vadose Zone Soil | MHMLPMLNAVDLKRLTTNKNVPETLRATAVKLQRTRIELKK |
| Ga0210406_104159661 | 3300021168 | Soil | HMLPVLNAADLKKLALNKNVPETLRTSAVKLQRTRASLKH |
| Ga0210400_103786631 | 3300021170 | Soil | DVTMHMLPMLNAVDLKRLTTNKNVPETLRTTAIKLQRTRADLKR |
| Ga0210400_115740042 | 3300021170 | Soil | MLPMINPIDLKRLCNNKNVPETLRTTAIKLQRQRQEFKK |
| Ga0210388_102783581 | 3300021181 | Soil | SLHLLPRMNATDLKLLTTNKNIPETLRSTAMKLHRQRYAPKAQD |
| Ga0210388_113699362 | 3300021181 | Soil | HMLPMCNVMDLKKLTSNKNVPETLRTTAIKLQRTRAELKK |
| Ga0210391_108279052 | 3300021433 | Soil | LDVTMHMLPMLNASDLKKLSMNKNVPETLRTTAAKLIRTRAAQKN |
| Ga0210402_100653944 | 3300021478 | Soil | MLNAVDLKRLTSNKNVPETLRTTAIKLQKTRAELKK |
| Ga0224551_10140741 | 3300023259 | Soil | MVNPIDLKKLCTNKNVPETLRTSAVKLQKQRAEFKK |
| Ga0247680_10569192 | 3300024246 | Soil | PIINAVDLKKLTMNKNVPETLRSSAVKLQRQRAEFKK |
| Ga0179589_102534732 | 3300024288 | Vadose Zone Soil | PLDVTLHMLPMLNPLDLKRLCTNKNIPETLRTTANKLQRQRMENKK |
| Ga0247667_10009438 | 3300024290 | Soil | LLPIINAVDLKKLTMNKNVPETLRSSAVKLQRQRAEFKK |
| Ga0137417_12530523 | 3300024330 | Vadose Zone Soil | PNAPLDVTMHMPPMLNAVDLKRLTTNKNVPETLRTTATKLQRTRADLKK |
| Ga0137417_13604303 | 3300024330 | Vadose Zone Soil | MHMLPMLNAVDLKRLTTNKNVPETLAHGTKLQRTRADLKK |
| Ga0208692_10359641 | 3300025472 | Peatland | LHMLPILNALDLKRLSMNKNIPETLRSTASKLMRTRADQRR |
| Ga0208478_10465801 | 3300025475 | Arctic Peat Soil | TPLDVTLHMLPILNAIDLKKLTTNKNVPETLRTTATKLHKVRGEQKK |
| Ga0207692_102304373 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | MLPMLNALDLKKLTMNKNIPETLRSTSLKLQRTRKELQK |
| Ga0207712_111761012 | 3300025961 | Switchgrass Rhizosphere | MNLLPMLNPMDLKKLTMNKNVPETLRTTAIKLQRQRAETKK |
| Ga0209647_11069591 | 3300026319 | Grasslands Soil | PMLNATDLKKLGMNKNIPETLRSTAVKLMRQRSAPKN |
| Ga0209131_11713731 | 3300026320 | Grasslands Soil | LDVSLHMLPMLNAVDLKRLTTNKNIPETLRTTAMKLQRTRVELKSK |
| Ga0209152_101106933 | 3300026325 | Soil | DVTLHMLPMLNAVDLKRLTTNKNVPETLRTTAMKLQRTRAELKK |
| Ga0209152_101428502 | 3300026325 | Soil | LPMLNPLDLKRLCNNKNVPETLRTTANKLQRQRMENKK |
| Ga0209802_11700603 | 3300026328 | Soil | LNPTDLKKLGMNKNIPETLRATAVKLMRQRNETKK |
| Ga0209803_13409491 | 3300026332 | Soil | PIDVSLHILPQLNAQDLKRLTMNKNIPETLRSTAMKLNRQRMENRPGSR |
| Ga0257154_10782451 | 3300026467 | Soil | LDVSLHMLPMINAVDLKRLTTSKNIPETLRTTAVKLQRQRSEFKK |
| Ga0209474_100412151 | 3300026550 | Soil | HMLPMLNAIDLKRLTSNKNVPETLRTTAMKLQRTRAELKK |
| Ga0209648_103047441 | 3300026551 | Grasslands Soil | PLDVSLHMLPILNVMDLKKLCLNKNIPETLRSTAGKLQRQRQDKK |
| Ga0179593_10806663 | 3300026555 | Vadose Zone Soil | MHMLPMLNVVDLKRLTSNKNVPETLRTTAIKLQKTRAELKK |
| Ga0179593_11151835 | 3300026555 | Vadose Zone Soil | VTLHMLPVLTAADLKKLTMNKNVPETLRSSALKLQRTRASTQK |
| Ga0179593_11182865 | 3300026555 | Vadose Zone Soil | MLNPPDLKKLGMNKNIPETLRATAVKLMRQRNESKK |
| Ga0179587_109162321 | 3300026557 | Vadose Zone Soil | LNAVDLKRLTTNKNIPETLRATAVKLQRTRIELKK |
| Ga0207741_10066853 | 3300026941 | Tropical Forest Soil | KTPLDVTLHMLPLLNAIDLKRLGMNKNVPETLRTTANKLMRTRAELKK |
| Ga0208603_10343951 | 3300027109 | Forest Soil | LDVSLHMLPMCNVMDLKKLTTNKNVPETLRTTAFKLQRTRAELRK |
| Ga0209004_10265803 | 3300027376 | Forest Soil | LDVTLHMLPVLTAADLKKLTMNKNVPETLRSSAVKLQRTRASTQK |
| Ga0209007_10546963 | 3300027652 | Forest Soil | TLHMLPMINAIDLKRLCTNKNIPETLRSTAVKLQRQRQEFKK |
| Ga0209588_10202381 | 3300027671 | Vadose Zone Soil | LDVTMHMLPMLNAVDLKRLTTNKNIPETLRTTAMKLQRTRAELKK |
| Ga0209588_11218811 | 3300027671 | Vadose Zone Soil | SLHMLPLLNPMDLKLLTTNKNIPETLRTTAYKLVRQRKEARENR |
| Ga0209447_100039657 | 3300027701 | Bog Forest Soil | LDVSLHMLPMLNAMDLKKLTTNKNIPETLRSTATKLQRQRQDFKK |
| Ga0209038_100398161 | 3300027737 | Bog Forest Soil | PLDVSLHLLPMINAIDLKKLACNKNIPETLRTTSGKLLRTRAELKK |
| Ga0209038_102536702 | 3300027737 | Bog Forest Soil | TPLDLTLGMLPMLNPLDLKKLTSNKNVPETLRTTALKLQRTRKEAKK |
| Ga0209177_103843012 | 3300027775 | Agricultural Soil | TPLDVTLHMLPMLNPQDLKRLTTNKNIPETLRTTASKLQRTRADQKK |
| Ga0209139_102209512 | 3300027795 | Bog Forest Soil | INAIDLKKLAANKNIPETLRTTAGKLQRTRAEFKK |
| Ga0209811_100825431 | 3300027821 | Surface Soil | LDVSLHMLPMINAIDLKKLTTNKNIPETLRTTAGKLQRTRTELKK |
| Ga0209166_101806971 | 3300027857 | Surface Soil | NPTDLKRLGMNKNIPETLRSSAVKLVRQRSQKKDD |
| Ga0209465_101791661 | 3300027874 | Tropical Forest Soil | MLNPQDLKRLTNNKNVPETLRTTANKLQRTRAEQKK |
| Ga0209283_100127046 | 3300027875 | Vadose Zone Soil | LHMLPLVNPMDLKLLTTNKNIPETLRTTAFKLARQRKEAREKK |
| Ga0209283_102586404 | 3300027875 | Vadose Zone Soil | LINNPKVPLDITMHMLPMLNAVDLKRLTTNKNVPDTLRTTAFKLQRTRAELKK |
| Ga0209283_105996891 | 3300027875 | Vadose Zone Soil | PLDVTLHMLPMLNAVDLKRLNTNKNVAETLRTTAMKLQRTRAALKK |
| Ga0209283_108987072 | 3300027875 | Vadose Zone Soil | HMLPMLNPLDLKRLCTNKNIPETLRTTANKLQRQRMENKK |
| Ga0209380_102208721 | 3300027889 | Soil | LPTANAIDLKKLMTNKNVPETLRTTAQKLHRTRAEFKK |
| Ga0209006_112785572 | 3300027908 | Forest Soil | PLDVSLHMLPMCNVMDLKKLTNNKNVPETLRTTAIKLQRTRAELKK |
| Ga0209526_100366611 | 3300028047 | Forest Soil | LPMINPIDLKRLCTNKNVPETLRTTALKLQRQRQEFKK |
| Ga0308309_113388642 | 3300028906 | Soil | PLDVTLHMLPILNAIDLKKLSMNKNVPETLRTTANKLMRTRADQKN |
| Ga0311352_101673401 | 3300029944 | Palsa | LPAINAMDLKKLTTNKNVPETLRTTATKLQRTRAEFKK |
| Ga0170824_1003213301 | 3300031231 | Forest Soil | LPMLNALDLKKLTMNKNIPETLRSTSLKLQRTRKELQK |
| Ga0170824_1145941251 | 3300031231 | Forest Soil | LLPMLNPPDLKKLGMNKNIPETLRATAVKLMRQRNESKK |
| Ga0302325_103559733 | 3300031234 | Palsa | LDVSLHLLPAINAMDLKKLTSNKNVPETLRTTATKLQRTRAEFKK |
| Ga0170818_1113315752 | 3300031474 | Forest Soil | HMLPSLNAVDLKKLSNNKNVPETLRTSATKLIRTRQTLK |
| Ga0318572_109283452 | 3300031681 | Soil | LLNPVDLKKLSINKNVPDTLRTSAAKLIRTRADQKK |
| Ga0307476_113559262 | 3300031715 | Hardwood Forest Soil | LNPADLKKLTTNKNIPETLRTTAYKLQKQRAETKKG |
| Ga0307469_102117875 | 3300031720 | Hardwood Forest Soil | HMLPMLNALDLKKLTMNKNIPETLRSTSLKLQRTRKELQK |
| Ga0307469_119716411 | 3300031720 | Hardwood Forest Soil | HILPMINQIDLKRLCTNKNVPETLRTTAVKLQRQRQEFKK |
| Ga0318501_106295431 | 3300031736 | Soil | HMLPLLNALDLKKLSMNKNVPETLRTTAAKLMRTRADQKK |
| Ga0307475_104199573 | 3300031754 | Hardwood Forest Soil | NNGKAPLDITLGLLPMINATDLKKLGMNKNIPETLRSTAVKLMRQRAAPKN |
| Ga0307475_111108792 | 3300031754 | Hardwood Forest Soil | HMLPILNALDLKRLCINKNIPETLRSTANKLKLQRLNK |
| Ga0318509_101027654 | 3300031768 | Soil | PMLNPLDLKKLTMNKNVPETLRTTAVKLQRQRAEAKK |
| Ga0318526_104408882 | 3300031769 | Soil | DVTLHMLPLLNPMDLKKLTMNKNVPETLRTTAVKLQRTRAASQQQK |
| Ga0318521_107907471 | 3300031770 | Soil | DVTLNLLPMLNPLDLKKLTMNKNVPETLRTTAVKLQRQRAEAKK |
| Ga0307478_113092491 | 3300031823 | Hardwood Forest Soil | LDVTLHMLPMLNAVDLKRLTSNKNVPETLRTTAIKLQRTRADLKK |
| Ga0307478_115596441 | 3300031823 | Hardwood Forest Soil | PLDVSLHMLPILNALDLKRLCINKNIPETLRSTANKLKLQRQQNK |
| Ga0307478_116836991 | 3300031823 | Hardwood Forest Soil | LNNAKTPLDVTLGMLPLLNPADLKKLTTNKNIPETLRTTAYKLQKQRAETKKG |
| Ga0318544_101682612 | 3300031880 | Soil | LPLLNAIDLKKLAMNKNVPDTLRTTAAKLMRTRAEQKK |
| Ga0306925_110802411 | 3300031890 | Soil | SLHMLPLLNAVDLKKLAMNKNVPDTLRTTAAKLMRTRAEQKK |
| Ga0306921_125488521 | 3300031912 | Soil | LPMLNPQDLKRLTTNKNVPETLRTTAFKLQRTRAEQKK |
| Ga0306926_129121352 | 3300031954 | Soil | LMLPLLNPIDLKKLTMNKNVPETLRSTAVKLQRTRAAAQQQK |
| Ga0307479_102273422 | 3300031962 | Hardwood Forest Soil | LHMLPMLNAVDLKRLTTNKNVPETLRTTATKLQRTRVELKK |
| Ga0306922_104333043 | 3300032001 | Soil | LDVSLHMLPLLNAIDLKKLAMNKNVPDTLRTTAAKLMRTRAEQKK |
| Ga0310911_106565272 | 3300032035 | Soil | PMLNPLDLKKLTMNKNVPETLRTTARKLQQQRAEAKK |
| Ga0318545_102255032 | 3300032042 | Soil | TLNLLPMLNPLDLKKLTLNKNIPETLRTTARKLQQQRAETRK |
| Ga0306924_105486413 | 3300032076 | Soil | LNAIDLKKLAMNKNVPDTLRTTAAKLMRTRAEQKK |
| Ga0306924_106081821 | 3300032076 | Soil | VTLHMLPLLNPMDLKKLTMNKNVPETLRTTAVKLQRTRAASQQQK |
| Ga0306924_106498323 | 3300032076 | Soil | VSLHMLPLLNAVDLKKLSMNKNVPETLRTAAAKLMRTRADQKK |
| Ga0318577_104356502 | 3300032091 | Soil | LMNNAKTPLDVTLHMLPLLNPVDLKKLSLNKNVPDTLRTSAAKLIRTRADQKK |
| Ga0307470_114945461 | 3300032174 | Hardwood Forest Soil | PLDVSLHMLPMLNALDLKRLCTNKNIPETLRTTANKLQRQRMENKK |
| Ga0307471_10000383112 | 3300032180 | Hardwood Forest Soil | MLPMLNPIDLKRLTTNKNVPETLRTTALKLQRTRAEFKK |
| Ga0307471_1001670745 | 3300032180 | Hardwood Forest Soil | MLPMLNALDLKKLTMNKNIPETLRSTSLKLQRTRKEVQK |
| Ga0307471_1003833631 | 3300032180 | Hardwood Forest Soil | VSLNLLPMLNPPDLKKLGMNKNIPETLRSTAVKLMRQRSESKK |
| Ga0335081_100438921 | 3300032892 | Soil | MINAIDLKRLTTNKNIPETLRSTAAKLQRTRAEQKK |
| Ga0335072_105700591 | 3300032898 | Soil | MLPMLNAADLKKLSMNKNVPETLRTSSAKLIRTRADKK |
| Ga0335072_117092552 | 3300032898 | Soil | TLHMLPLLNAIDLKRLSMNKNVPETLRTSAAKLIRTRSDQKK |
| Ga0335083_102237213 | 3300032954 | Soil | LNPMDLKKLTMNKNVPETLRTTAYKLQKQRAETKKG |
| Ga0335083_110436822 | 3300032954 | Soil | LPMLNAMDLKRLSINKNVPETLRTSAAKLIKTRADQKK |
| Ga0335076_101733971 | 3300032955 | Soil | MLNALDLKRLGMNKNVPETLRTSANKLVRTRAEQNK |
| Ga0335076_115427651 | 3300032955 | Soil | TLHMLPMLNALDLKRLGMNKNVPETLRTSANKLVRTRAEQNK |
| Ga0310914_118306902 | 3300033289 | Soil | PLLNPMDLKKLTMNKNVPETLRTTAVKLQRTRAASQQQK |
| Ga0326728_101060747 | 3300033402 | Peat Soil | ILNAADLKRLSMNKNIPETLRSTANKLMRTRADQKR |
| Ga0316620_109391901 | 3300033480 | Soil | LDVSLHMLPMINAIDLKRLTTNKNIPETLRTTAGKLQRTRTELKK |
| Ga0371488_0154166_26_145 | 3300033983 | Peat Soil | MLPILNALDLKRLCMNKNIPETLRSTANKLMRTRADQKR |
| ⦗Top⦘ |