| Basic Information | |
|---|---|
| Family ID | F016317 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 248 |
| Average Sequence Length | 41 residues |
| Representative Sequence | PLGRARRQLLRATAAALALTPVLLALTPAVLALALGRLPAA |
| Number of Associated Samples | 195 |
| Number of Associated Scaffolds | 248 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 2.05 % |
| % of genes near scaffold ends (potentially truncated) | 96.77 % |
| % of genes from short scaffolds (< 2000 bps) | 90.73 % |
| Associated GOLD sequencing projects | 187 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.50 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (74.194 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (25.806 % of family members) |
| Environment Ontology (ENVO) | Unclassified (18.548 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (49.194 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 46.38% β-sheet: 0.00% Coil/Unstructured: 53.62% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.50 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 248 Family Scaffolds |
|---|---|---|
| PF09995 | MPAB_Lcp_cat | 5.65 |
| PF03109 | ABC1 | 5.65 |
| PF04264 | YceI | 3.63 |
| PF07883 | Cupin_2 | 1.21 |
| PF03640 | Lipoprotein_15 | 1.21 |
| PF06053 | DUF929 | 0.81 |
| PF01636 | APH | 0.40 |
| PF11774 | Lsr2 | 0.40 |
| PF04545 | Sigma70_r4 | 0.40 |
| PF04101 | Glyco_tran_28_C | 0.40 |
| PF01435 | Peptidase_M48 | 0.40 |
| PF12900 | Pyridox_ox_2 | 0.40 |
| PF02467 | Whib | 0.40 |
| PF01878 | EVE | 0.40 |
| PF12697 | Abhydrolase_6 | 0.40 |
| PF00202 | Aminotran_3 | 0.40 |
| PF08386 | Abhydrolase_4 | 0.40 |
| COG ID | Name | Functional Category | % Frequency in 248 Family Scaffolds |
|---|---|---|---|
| COG0661 | Predicted protein kinase regulating ubiquinone biosynthesis, AarF/ABC1/UbiB family | Signal transduction mechanisms [T] | 5.65 |
| COG2353 | Polyisoprenoid-binding periplasmic protein YceI | General function prediction only [R] | 3.63 |
| COG4315 | Predicted lipoprotein with conserved Yx(FWY)xxD motif (function unknown) | Function unknown [S] | 1.21 |
| COG1673 | Predicted RNA-binding protein, contains PUA-like EVE domain | General function prediction only [R] | 0.40 |
| COG2947 | Predicted RNA-binding protein, contains EVE domain | General function prediction only [R] | 0.40 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 74.19 % |
| All Organisms | root | All Organisms | 25.81 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2189573002|GZIGXIF02F94XJ | Not Available | 530 | Open in IMG/M |
| 3300001131|JGI12631J13338_1007852 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1632 | Open in IMG/M |
| 3300001408|JGI20206J14855_1053372 | Not Available | 580 | Open in IMG/M |
| 3300001418|JGI20188J14859_1001460 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3363 | Open in IMG/M |
| 3300001593|JGI12635J15846_10072434 | All Organisms → cellular organisms → Bacteria | 2545 | Open in IMG/M |
| 3300001593|JGI12635J15846_10166047 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1496 | Open in IMG/M |
| 3300001593|JGI12635J15846_10230554 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1202 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100994335 | Not Available | 723 | Open in IMG/M |
| 3300002568|C688J35102_120981648 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 5029 | Open in IMG/M |
| 3300004635|Ga0062388_102654242 | Not Available | 527 | Open in IMG/M |
| 3300005093|Ga0062594_100367664 | Not Available | 1141 | Open in IMG/M |
| 3300005093|Ga0062594_101947286 | Not Available | 625 | Open in IMG/M |
| 3300005171|Ga0066677_10595659 | Not Available | 628 | Open in IMG/M |
| 3300005174|Ga0066680_10940411 | Not Available | 510 | Open in IMG/M |
| 3300005327|Ga0070658_10748048 | Not Available | 849 | Open in IMG/M |
| 3300005355|Ga0070671_101169733 | Not Available | 676 | Open in IMG/M |
| 3300005435|Ga0070714_102028789 | Not Available | 561 | Open in IMG/M |
| 3300005467|Ga0070706_101714741 | Not Available | 572 | Open in IMG/M |
| 3300005526|Ga0073909_10430977 | Not Available | 626 | Open in IMG/M |
| 3300005542|Ga0070732_10302812 | Not Available | 960 | Open in IMG/M |
| 3300005546|Ga0070696_100972929 | Not Available | 708 | Open in IMG/M |
| 3300005549|Ga0070704_102291090 | Not Available | 502 | Open in IMG/M |
| 3300005577|Ga0068857_100660164 | Not Available | 991 | Open in IMG/M |
| 3300005610|Ga0070763_10550155 | Not Available | 665 | Open in IMG/M |
| 3300005618|Ga0068864_101871722 | Not Available | 606 | Open in IMG/M |
| 3300005842|Ga0068858_100635626 | Not Available | 1037 | Open in IMG/M |
| 3300005843|Ga0068860_102384801 | Not Available | 549 | Open in IMG/M |
| 3300005921|Ga0070766_10057013 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 2212 | Open in IMG/M |
| 3300005993|Ga0080027_10387239 | Not Available | 562 | Open in IMG/M |
| 3300006028|Ga0070717_10290840 | Not Available | 1451 | Open in IMG/M |
| 3300006028|Ga0070717_11345162 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 649 | Open in IMG/M |
| 3300006028|Ga0070717_11902759 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora → Micromonospora carbonacea | 537 | Open in IMG/M |
| 3300006046|Ga0066652_101902376 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300006059|Ga0075017_101256596 | Not Available | 581 | Open in IMG/M |
| 3300006086|Ga0075019_10380455 | Not Available | 861 | Open in IMG/M |
| 3300006173|Ga0070716_100173116 | All Organisms → cellular organisms → Bacteria | 1410 | Open in IMG/M |
| 3300006175|Ga0070712_101063300 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 701 | Open in IMG/M |
| 3300006175|Ga0070712_101993055 | Not Available | 508 | Open in IMG/M |
| 3300006755|Ga0079222_10969441 | Not Available | 726 | Open in IMG/M |
| 3300006804|Ga0079221_10916699 | Not Available | 646 | Open in IMG/M |
| 3300006804|Ga0079221_11138083 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 601 | Open in IMG/M |
| 3300006806|Ga0079220_10110045 | Not Available | 1447 | Open in IMG/M |
| 3300006806|Ga0079220_10743448 | Not Available | 730 | Open in IMG/M |
| 3300006806|Ga0079220_10843792 | Not Available | 701 | Open in IMG/M |
| 3300006806|Ga0079220_11104484 | Not Available | 643 | Open in IMG/M |
| 3300006854|Ga0075425_102059461 | Not Available | 637 | Open in IMG/M |
| 3300006954|Ga0079219_10238890 | Not Available | 1069 | Open in IMG/M |
| 3300006954|Ga0079219_10941230 | Not Available | 706 | Open in IMG/M |
| 3300006954|Ga0079219_12192737 | Not Available | 531 | Open in IMG/M |
| 3300007265|Ga0099794_10188670 | Not Available | 1054 | Open in IMG/M |
| 3300009038|Ga0099829_11692513 | Not Available | 520 | Open in IMG/M |
| 3300009101|Ga0105247_10879415 | Not Available | 690 | Open in IMG/M |
| 3300009101|Ga0105247_11508652 | Not Available | 548 | Open in IMG/M |
| 3300009143|Ga0099792_10986834 | Not Available | 562 | Open in IMG/M |
| 3300009148|Ga0105243_10925352 | Not Available | 869 | Open in IMG/M |
| 3300009520|Ga0116214_1118374 | Not Available | 978 | Open in IMG/M |
| 3300009683|Ga0116224_10316319 | Not Available | 742 | Open in IMG/M |
| 3300009698|Ga0116216_10016529 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4638 | Open in IMG/M |
| 3300009698|Ga0116216_10351660 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 896 | Open in IMG/M |
| 3300009698|Ga0116216_10904584 | Not Available | 528 | Open in IMG/M |
| 3300009839|Ga0116223_10803334 | Not Available | 538 | Open in IMG/M |
| 3300010371|Ga0134125_13121487 | Not Available | 502 | Open in IMG/M |
| 3300010373|Ga0134128_12669796 | Not Available | 550 | Open in IMG/M |
| 3300010376|Ga0126381_103906307 | Not Available | 581 | Open in IMG/M |
| 3300010379|Ga0136449_100244877 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3339 | Open in IMG/M |
| 3300010379|Ga0136449_104103143 | Not Available | 542 | Open in IMG/M |
| 3300010396|Ga0134126_10387886 | Not Available | 1624 | Open in IMG/M |
| 3300010397|Ga0134124_11338420 | Not Available | 740 | Open in IMG/M |
| 3300010399|Ga0134127_11194077 | Not Available | 827 | Open in IMG/M |
| 3300010876|Ga0126361_10716203 | Not Available | 708 | Open in IMG/M |
| 3300010880|Ga0126350_10159534 | Not Available | 587 | Open in IMG/M |
| 3300010880|Ga0126350_12093054 | Not Available | 500 | Open in IMG/M |
| 3300011003|Ga0138514_100083627 | Not Available | 680 | Open in IMG/M |
| 3300011270|Ga0137391_10763177 | Not Available | 799 | Open in IMG/M |
| 3300011998|Ga0120114_1111145 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300012096|Ga0137389_11784285 | Not Available | 511 | Open in IMG/M |
| 3300012201|Ga0137365_10003764 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 12157 | Open in IMG/M |
| 3300012205|Ga0137362_11361073 | Not Available | 595 | Open in IMG/M |
| 3300012206|Ga0137380_11488537 | Not Available | 561 | Open in IMG/M |
| 3300012210|Ga0137378_10225658 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1744 | Open in IMG/M |
| 3300012359|Ga0137385_10389167 | Not Available | 1190 | Open in IMG/M |
| 3300012359|Ga0137385_11154238 | Not Available | 635 | Open in IMG/M |
| 3300012363|Ga0137390_11557670 | Not Available | 600 | Open in IMG/M |
| 3300012917|Ga0137395_10920193 | Not Available | 631 | Open in IMG/M |
| 3300012955|Ga0164298_11693826 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300013307|Ga0157372_10548889 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1347 | Open in IMG/M |
| 3300013308|Ga0157375_11524412 | Not Available | 789 | Open in IMG/M |
| 3300014201|Ga0181537_11209331 | Not Available | 510 | Open in IMG/M |
| 3300014325|Ga0163163_10544612 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1223 | Open in IMG/M |
| 3300014489|Ga0182018_10377155 | Not Available | 761 | Open in IMG/M |
| 3300014655|Ga0181516_10601541 | Not Available | 567 | Open in IMG/M |
| 3300014968|Ga0157379_12096015 | Not Available | 560 | Open in IMG/M |
| 3300015371|Ga0132258_12471938 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1300 | Open in IMG/M |
| 3300015374|Ga0132255_100154538 | All Organisms → cellular organisms → Bacteria | 3202 | Open in IMG/M |
| 3300016445|Ga0182038_10194111 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1592 | Open in IMG/M |
| 3300017924|Ga0187820_1004515 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 3226 | Open in IMG/M |
| 3300017926|Ga0187807_1021134 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2009 | Open in IMG/M |
| 3300017933|Ga0187801_10114598 | Not Available | 1031 | Open in IMG/M |
| 3300017937|Ga0187809_10175815 | All Organisms → cellular organisms → Bacteria | 750 | Open in IMG/M |
| 3300018007|Ga0187805_10359432 | Not Available | 673 | Open in IMG/M |
| 3300018013|Ga0187873_1329044 | Not Available | 559 | Open in IMG/M |
| 3300018035|Ga0187875_10527180 | Not Available | 626 | Open in IMG/M |
| 3300019887|Ga0193729_1273879 | Not Available | 517 | Open in IMG/M |
| 3300020002|Ga0193730_1152302 | Not Available | 610 | Open in IMG/M |
| 3300020081|Ga0206354_10517997 | Not Available | 502 | Open in IMG/M |
| 3300020580|Ga0210403_11072148 | Not Available | 627 | Open in IMG/M |
| 3300020580|Ga0210403_11284990 | Not Available | 560 | Open in IMG/M |
| 3300020581|Ga0210399_10724376 | Not Available | 816 | Open in IMG/M |
| 3300020581|Ga0210399_10953638 | Not Available | 693 | Open in IMG/M |
| 3300020581|Ga0210399_11523481 | Not Available | 518 | Open in IMG/M |
| 3300020582|Ga0210395_10401499 | Not Available | 1031 | Open in IMG/M |
| 3300020582|Ga0210395_10851685 | Not Available | 678 | Open in IMG/M |
| 3300020582|Ga0210395_11299534 | Not Available | 532 | Open in IMG/M |
| 3300020582|Ga0210395_11403547 | Not Available | 509 | Open in IMG/M |
| 3300021171|Ga0210405_10520005 | Not Available | 932 | Open in IMG/M |
| 3300021178|Ga0210408_10615506 | Not Available | 859 | Open in IMG/M |
| 3300021178|Ga0210408_11202832 | Not Available | 579 | Open in IMG/M |
| 3300021180|Ga0210396_11646226 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 523 | Open in IMG/M |
| 3300021181|Ga0210388_10336980 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1326 | Open in IMG/M |
| 3300021374|Ga0213881_10466476 | Not Available | 571 | Open in IMG/M |
| 3300021401|Ga0210393_10096565 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 2350 | Open in IMG/M |
| 3300021401|Ga0210393_10789893 | Not Available | 773 | Open in IMG/M |
| 3300021402|Ga0210385_10397703 | Not Available | 1034 | Open in IMG/M |
| 3300021402|Ga0210385_11071812 | Not Available | 619 | Open in IMG/M |
| 3300021404|Ga0210389_10204899 | Not Available | 1539 | Open in IMG/M |
| 3300021404|Ga0210389_10630406 | Not Available | 842 | Open in IMG/M |
| 3300021404|Ga0210389_11016558 | Not Available | 643 | Open in IMG/M |
| 3300021405|Ga0210387_10924789 | Not Available | 766 | Open in IMG/M |
| 3300021405|Ga0210387_11632096 | Not Available | 548 | Open in IMG/M |
| 3300021407|Ga0210383_10100044 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2439 | Open in IMG/M |
| 3300021407|Ga0210383_10185439 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1776 | Open in IMG/M |
| 3300021407|Ga0210383_11087462 | Not Available | 676 | Open in IMG/M |
| 3300021407|Ga0210383_11119203 | Not Available | 664 | Open in IMG/M |
| 3300021407|Ga0210383_11412593 | Not Available | 578 | Open in IMG/M |
| 3300021420|Ga0210394_10435551 | Not Available | 1154 | Open in IMG/M |
| 3300021420|Ga0210394_10889398 | Not Available | 775 | Open in IMG/M |
| 3300021420|Ga0210394_11855747 | Not Available | 501 | Open in IMG/M |
| 3300021433|Ga0210391_10374640 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1117 | Open in IMG/M |
| 3300021474|Ga0210390_10190456 | Not Available | 1734 | Open in IMG/M |
| 3300021474|Ga0210390_11249410 | Not Available | 598 | Open in IMG/M |
| 3300021477|Ga0210398_11123912 | Not Available | 623 | Open in IMG/M |
| 3300021478|Ga0210402_11705066 | Not Available | 556 | Open in IMG/M |
| 3300021559|Ga0210409_10744966 | Not Available | 852 | Open in IMG/M |
| 3300021861|Ga0213853_10590041 | Not Available | 915 | Open in IMG/M |
| 3300023259|Ga0224551_1078653 | Not Available | 579 | Open in IMG/M |
| 3300024181|Ga0247693_1029391 | Not Available | 755 | Open in IMG/M |
| 3300024288|Ga0179589_10322460 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 698 | Open in IMG/M |
| 3300025504|Ga0208356_1114594 | Not Available | 506 | Open in IMG/M |
| 3300025509|Ga0208848_1068767 | Not Available | 740 | Open in IMG/M |
| 3300025588|Ga0208586_1015497 | Not Available | 1894 | Open in IMG/M |
| 3300025898|Ga0207692_10377108 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura rupiterrae | 880 | Open in IMG/M |
| 3300025900|Ga0207710_10659039 | Not Available | 548 | Open in IMG/M |
| 3300025901|Ga0207688_10701577 | Not Available | 640 | Open in IMG/M |
| 3300025905|Ga0207685_10590746 | Not Available | 595 | Open in IMG/M |
| 3300025906|Ga0207699_11151585 | Not Available | 574 | Open in IMG/M |
| 3300025906|Ga0207699_11212807 | Not Available | 559 | Open in IMG/M |
| 3300025915|Ga0207693_11133940 | Not Available | 593 | Open in IMG/M |
| 3300025916|Ga0207663_11150359 | Not Available | 624 | Open in IMG/M |
| 3300025920|Ga0207649_10404801 | Not Available | 1022 | Open in IMG/M |
| 3300025922|Ga0207646_10099910 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 2600 | Open in IMG/M |
| 3300025922|Ga0207646_11266075 | Not Available | 645 | Open in IMG/M |
| 3300025922|Ga0207646_11851615 | Not Available | 515 | Open in IMG/M |
| 3300025923|Ga0207681_10762517 | Not Available | 807 | Open in IMG/M |
| 3300025929|Ga0207664_11799279 | Not Available | 535 | Open in IMG/M |
| 3300026285|Ga0209438_1074934 | Not Available | 1096 | Open in IMG/M |
| 3300026374|Ga0257146_1057605 | Not Available | 629 | Open in IMG/M |
| 3300027029|Ga0208731_1035485 | Not Available | 547 | Open in IMG/M |
| 3300027071|Ga0209214_1017710 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 900 | Open in IMG/M |
| 3300027090|Ga0208604_1008151 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 993 | Open in IMG/M |
| 3300027568|Ga0208042_1096147 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales | 750 | Open in IMG/M |
| 3300027576|Ga0209003_1074419 | All Organisms → cellular organisms → Bacteria | 626 | Open in IMG/M |
| 3300027590|Ga0209116_1153451 | Not Available | 500 | Open in IMG/M |
| 3300027692|Ga0209530_1018464 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 2113 | Open in IMG/M |
| 3300027855|Ga0209693_10208553 | Not Available | 961 | Open in IMG/M |
| 3300027867|Ga0209167_10747186 | Not Available | 534 | Open in IMG/M |
| 3300027879|Ga0209169_10089764 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1588 | Open in IMG/M |
| 3300027882|Ga0209590_10642441 | Not Available | 681 | Open in IMG/M |
| 3300027908|Ga0209006_11372207 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
| 3300028047|Ga0209526_10828979 | Not Available | 570 | Open in IMG/M |
| 3300028573|Ga0265334_10089469 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura rupiterrae | 1125 | Open in IMG/M |
| 3300028781|Ga0302223_10324949 | Not Available | 509 | Open in IMG/M |
| 3300028798|Ga0302222_10147066 | Not Available | 929 | Open in IMG/M |
| 3300028799|Ga0307284_10290442 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 655 | Open in IMG/M |
| 3300028801|Ga0302226_10164226 | Not Available | 960 | Open in IMG/M |
| 3300028808|Ga0302228_10183568 | Not Available | 956 | Open in IMG/M |
| 3300028879|Ga0302229_10104623 | All Organisms → cellular organisms → Bacteria | 1337 | Open in IMG/M |
| 3300028906|Ga0308309_11676436 | Not Available | 540 | Open in IMG/M |
| 3300028906|Ga0308309_11828286 | Not Available | 513 | Open in IMG/M |
| 3300029910|Ga0311369_11415403 | Not Available | 525 | Open in IMG/M |
| 3300029922|Ga0311363_10263514 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1985 | Open in IMG/M |
| 3300029999|Ga0311339_10221336 | All Organisms → cellular organisms → Bacteria | 2114 | Open in IMG/M |
| 3300029999|Ga0311339_10579958 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1121 | Open in IMG/M |
| 3300030007|Ga0311338_10183684 | All Organisms → cellular organisms → Bacteria | 2434 | Open in IMG/M |
| 3300030007|Ga0311338_10685021 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1039 | Open in IMG/M |
| 3300030013|Ga0302178_10108246 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia | 1420 | Open in IMG/M |
| 3300030053|Ga0302177_10097393 | Not Available | 1706 | Open in IMG/M |
| 3300030054|Ga0302182_10507729 | Not Available | 501 | Open in IMG/M |
| 3300030520|Ga0311372_11042828 | Not Available | 1072 | Open in IMG/M |
| 3300030580|Ga0311355_10232079 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1905 | Open in IMG/M |
| 3300030618|Ga0311354_10826456 | Not Available | 871 | Open in IMG/M |
| 3300030677|Ga0302317_10328699 | Not Available | 681 | Open in IMG/M |
| 3300030739|Ga0302311_10783745 | Not Available | 621 | Open in IMG/M |
| 3300031236|Ga0302324_100255816 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2727 | Open in IMG/M |
| 3300031572|Ga0318515_10089512 | Not Available | 1604 | Open in IMG/M |
| 3300031708|Ga0310686_111006876 | Not Available | 670 | Open in IMG/M |
| 3300031713|Ga0318496_10227505 | Not Available | 1027 | Open in IMG/M |
| 3300031715|Ga0307476_10835491 | Not Available | 681 | Open in IMG/M |
| 3300031715|Ga0307476_10898562 | Not Available | 654 | Open in IMG/M |
| 3300031715|Ga0307476_11439018 | Not Available | 501 | Open in IMG/M |
| 3300031718|Ga0307474_11088125 | Not Available | 633 | Open in IMG/M |
| 3300031720|Ga0307469_10603180 | Not Available | 982 | Open in IMG/M |
| 3300031748|Ga0318492_10776535 | Not Available | 515 | Open in IMG/M |
| 3300031769|Ga0318526_10398390 | Not Available | 563 | Open in IMG/M |
| 3300031770|Ga0318521_10237214 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1062 | Open in IMG/M |
| 3300031770|Ga0318521_10916210 | Not Available | 536 | Open in IMG/M |
| 3300031770|Ga0318521_11020880 | Not Available | 507 | Open in IMG/M |
| 3300031797|Ga0318550_10282138 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 806 | Open in IMG/M |
| 3300031798|Ga0318523_10304924 | Not Available | 794 | Open in IMG/M |
| 3300031799|Ga0318565_10002785 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 6234 | Open in IMG/M |
| 3300031799|Ga0318565_10274104 | Not Available | 820 | Open in IMG/M |
| 3300031799|Ga0318565_10414161 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 653 | Open in IMG/M |
| 3300031805|Ga0318497_10146591 | Not Available | 1290 | Open in IMG/M |
| 3300031835|Ga0318517_10036634 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1999 | Open in IMG/M |
| 3300031845|Ga0318511_10391441 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 636 | Open in IMG/M |
| 3300031910|Ga0306923_11555776 | Not Available | 689 | Open in IMG/M |
| 3300031942|Ga0310916_11244981 | Not Available | 614 | Open in IMG/M |
| 3300031946|Ga0310910_10299032 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1266 | Open in IMG/M |
| 3300031947|Ga0310909_10609593 | Not Available | 912 | Open in IMG/M |
| 3300031962|Ga0307479_11429055 | Not Available | 650 | Open in IMG/M |
| 3300032008|Ga0318562_10355848 | Not Available | 851 | Open in IMG/M |
| 3300032009|Ga0318563_10585679 | Not Available | 602 | Open in IMG/M |
| 3300032060|Ga0318505_10583718 | Not Available | 525 | Open in IMG/M |
| 3300032063|Ga0318504_10338976 | Not Available | 714 | Open in IMG/M |
| 3300032066|Ga0318514_10078030 | Not Available | 1650 | Open in IMG/M |
| 3300032066|Ga0318514_10117754 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1360 | Open in IMG/M |
| 3300032076|Ga0306924_10508780 | Not Available | 1371 | Open in IMG/M |
| 3300032174|Ga0307470_10194868 | Not Available | 1289 | Open in IMG/M |
| 3300032261|Ga0306920_101748382 | Not Available | 879 | Open in IMG/M |
| 3300032783|Ga0335079_12283470 | Not Available | 514 | Open in IMG/M |
| 3300032893|Ga0335069_10008817 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 14393 | Open in IMG/M |
| 3300032896|Ga0335075_11226637 | Not Available | 648 | Open in IMG/M |
| 3300034124|Ga0370483_0201290 | Not Available | 677 | Open in IMG/M |
| 3300034163|Ga0370515_0242590 | Not Available | 765 | Open in IMG/M |
| 3300034163|Ga0370515_0461798 | Not Available | 536 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 25.81% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 7.66% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 7.26% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.05% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 5.24% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 4.03% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.23% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 3.63% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.82% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.42% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.02% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.02% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 2.02% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.61% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.21% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.21% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 1.21% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.21% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.21% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 1.21% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.81% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.81% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.81% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.81% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.81% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.81% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.81% |
| Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 0.40% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.40% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.40% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.40% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.40% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.40% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.40% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.40% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.40% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.40% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.40% |
| Exposed Rock | Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock | 0.40% |
| Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 0.40% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.40% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.40% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.40% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.40% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.40% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.40% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.40% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.40% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.40% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2189573002 | Grass soil microbial communities from Rothamsted Park, UK - FE1 (NaCl 30g/L 5ml) | Environmental | Open in IMG/M |
| 3300001131 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O1 | Environmental | Open in IMG/M |
| 3300001408 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample F52-2 deep-092012 | Environmental | Open in IMG/M |
| 3300001418 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-2 shallow-072012 | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300005993 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
| 3300009683 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG | Environmental | Open in IMG/M |
| 3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
| 3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010876 | Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010880 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011003 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t9i015 | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011998 | Permafrost microbial communities from Nunavut, Canada - A30_35cm_6M | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014201 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaG | Environmental | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014489 | Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaG | Environmental | Open in IMG/M |
| 3300014655 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_10_metaG | Environmental | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
| 3300017924 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5 | Environmental | Open in IMG/M |
| 3300017926 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2 | Environmental | Open in IMG/M |
| 3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
| 3300017937 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
| 3300018013 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_100 | Environmental | Open in IMG/M |
| 3300018035 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10 | Environmental | Open in IMG/M |
| 3300019887 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2 | Environmental | Open in IMG/M |
| 3300020002 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a1 | Environmental | Open in IMG/M |
| 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021374 | Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R08 | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021861 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300023259 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P3 20-24 | Environmental | Open in IMG/M |
| 3300024181 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK34 | Environmental | Open in IMG/M |
| 3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300025504 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-1 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025509 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-1 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025588 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-3 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026285 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026374 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-08-A | Environmental | Open in IMG/M |
| 3300027029 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF045 (SPAdes) | Environmental | Open in IMG/M |
| 3300027071 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027090 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF016 (SPAdes) | Environmental | Open in IMG/M |
| 3300027568 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027576 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027590 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027692 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Host-Associated | Open in IMG/M |
| 3300028781 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_3 | Environmental | Open in IMG/M |
| 3300028798 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_2 | Environmental | Open in IMG/M |
| 3300028799 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123 | Environmental | Open in IMG/M |
| 3300028801 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_3 | Environmental | Open in IMG/M |
| 3300028808 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_2 | Environmental | Open in IMG/M |
| 3300028879 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_3 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029910 | III_Palsa_E2 coassembly | Environmental | Open in IMG/M |
| 3300029922 | III_Fen_E1 coassembly | Environmental | Open in IMG/M |
| 3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300030013 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_3 | Environmental | Open in IMG/M |
| 3300030053 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_2 | Environmental | Open in IMG/M |
| 3300030054 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_1 | Environmental | Open in IMG/M |
| 3300030520 | III_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300030580 | II_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300030618 | II_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030677 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N3_3 | Environmental | Open in IMG/M |
| 3300030739 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_3 | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
| 3300031769 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
| 3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
| 3300031799 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21 | Environmental | Open in IMG/M |
| 3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
| 3300031835 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21 | Environmental | Open in IMG/M |
| 3300031845 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032008 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18 | Environmental | Open in IMG/M |
| 3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
| 3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
| 3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
| 3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
| 3300032896 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4 | Environmental | Open in IMG/M |
| 3300034124 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_06D_14 | Environmental | Open in IMG/M |
| 3300034163 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_04D_14 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| FE1_07905150 | 2189573002 | Grass Soil | LGPCEPLGRARRRLLLATVAALALTPVLLALTPAVLALALGRLPAA |
| JGI12631J13338_10078521 | 3300001131 | Forest Soil | GRVRRQLLRAAAAALALTPVLLALTPAVVALALGKLPGA* |
| JGI20206J14855_10533722 | 3300001408 | Arctic Peat Soil | EPLGRARRQLLRAAAASLAVTPVLLALAPALLALALGRLPAA* |
| JGI20188J14859_10014601 | 3300001418 | Arctic Peat Soil | YRLLEPAEPLGRARRQLLRAAAASLAVTPVLLALAPALLALALGRLPAA* |
| JGI12635J15846_100724341 | 3300001593 | Forest Soil | EPLGRTRRQLLRTSAAALALTPVLLALAPAVLALALGRVPTA* |
| JGI12635J15846_101660474 | 3300001593 | Forest Soil | RRQLLRAAAAALALTPVLLALTPAVVALALGKLPGA* |
| JGI12635J15846_102305541 | 3300001593 | Forest Soil | EPLGRARRRLLRATAAALALTPVLLALTPAVVALALGKLPAA* |
| JGIcombinedJ26739_1009943354 | 3300002245 | Forest Soil | RARRQLLCATAAALALIPVLLALTPALVALALGRIPVA* |
| C688J35102_1209816481 | 3300002568 | Soil | LSRLRRQLLRAGAAGLALTPLLLALAPAVVALALGRVPAA* |
| Ga0062388_1026542421 | 3300004635 | Bog Forest Soil | CEPLGPVRRRLLLATAAAIALTPVLLALTPAVLALALGKLPGA* |
| Ga0062594_1003676641 | 3300005093 | Soil | PLGHARRQLLRATAAALALTPVLLALTPALVALALGRSPAA* |
| Ga0062594_1019472862 | 3300005093 | Soil | VSRIRRQLLRAGVAALALTPALLALTPAIVALALGRVPSA* |
| Ga0066677_105956591 | 3300005171 | Soil | LLGPSEPLGRVRRHVLRATAAALALNPVLLALTPAVIALALGKVPAA* |
| Ga0066680_109404111 | 3300005174 | Soil | RLLGPSEPLGRVRRQLLRAGAAALALTPVLLALTPAVVALALGRLPGG* |
| Ga0070658_107480481 | 3300005327 | Corn Rhizosphere | SEPLGRVRRHLLRATAAALALTPVLLALTPAVIALALGKLPGA* |
| Ga0070671_1011697331 | 3300005355 | Switchgrass Rhizosphere | CEPLGRMRRRLLRATAAALALTPVLLALTPAVIALALGKLPGA* |
| Ga0070714_1020287892 | 3300005435 | Agricultural Soil | GRVRRRLLGAGACVLALTPVLLALTPAVLALALGRVSVA* |
| Ga0070706_1017147412 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | PAEPLGRARRQLLGTIAAALALTPVALALAPAVLALALGRLPAT* |
| Ga0073909_104309772 | 3300005526 | Surface Soil | RRQLLRTIAAALALTPVALALAPAVLALALGRLPAT* |
| Ga0070732_103028123 | 3300005542 | Surface Soil | PLSRLRRQLLGAGAAVLALTPLLLALTPAIVAVALGHVPVA* |
| Ga0070696_1009729291 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | GPCEPLGRMRRRLLRATAAALALTPVLLALTPAVVALALGKLPGA* |
| Ga0070704_1022910901 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | SRLRRHLLRATAAILALAPVLVASTPAVAALALGRIPAG* |
| Ga0068857_1006601641 | 3300005577 | Corn Rhizosphere | GPCEPLGRMRRRLLRATAAALALTPVLLALTPAVIALALGKLPGA* |
| Ga0070763_105501552 | 3300005610 | Soil | GRARRQLLRATATALALTPVLLALTPAVVALVLGKLPAA* |
| Ga0068864_1018717221 | 3300005618 | Switchgrass Rhizosphere | LLRPAEPLGRLRRQLLRAAAGGLALTPVLLALTPALVALALGRVPAA* |
| Ga0068858_1006356261 | 3300005842 | Switchgrass Rhizosphere | LGRARRQLLRATAAALALTPVLLALTPALVALALGRSPAA* |
| Ga0068860_1023848011 | 3300005843 | Switchgrass Rhizosphere | QLLRTIAAALALTPVVLALAPAVLALALGRLPAA* |
| Ga0070766_100570131 | 3300005921 | Soil | LGRARRQMLCATAAALALTPVLLALTPALVALALGRIPAA* |
| Ga0080027_103872392 | 3300005993 | Prmafrost Soil | LSRGRRQVLRATAAALALAPVLLALAPAVLALALGRVPSA* |
| Ga0070717_102908404 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | RPDEPLGRLSRHLLRTAAAALALAPVLVALTPAVAALALGKVPTA* |
| Ga0070717_113451621 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | LTPAEPVGQIRRLLLRATVAAIAVTPVLLALIPAIMALALGRVPAA* |
| Ga0070717_119027591 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | LGRARRQLLRATAGSLVLAPVLLALAPAVAALALGQVPAA* |
| Ga0066652_1019023761 | 3300006046 | Soil | GPCEPLGPVRRRLLRATAAALALTPVLLALTPAMVALALGKLPVA* |
| Ga0075017_1012565961 | 3300006059 | Watersheds | RRQLLRATAAALALTPVLLALTPAVIALALGKLPTA* |
| Ga0075019_103804551 | 3300006086 | Watersheds | PLGRARRQLLRATATALALTAVLLALTPALVALALGRLPAA* |
| Ga0070716_1001731161 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | AEPLGRARRQLLRTIAAALALTPVALALAPAVLALALGRLPAA* |
| Ga0070712_1010633001 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | HRLLVPAEPLGRARRQLLRTIAAALALTPVVLALAPAVLALALGRLPAA* |
| Ga0070712_1019930551 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | RLLGPCEPLGRVRRHLLRATAAALALTPVLLALTPAVIALALGKLPGA* |
| Ga0079222_109694412 | 3300006755 | Agricultural Soil | AEPLGRLRRHLLRTTAATLAITPVLVALAPAVVALALGRVPAA* |
| Ga0079221_109166993 | 3300006804 | Agricultural Soil | HLLRATAATLALTPVLVALAPAALALALGRVPTA* |
| Ga0079221_111380832 | 3300006804 | Agricultural Soil | RLLGPAEPLSRVRRQLVRAGASALALTPVLLALTPAVVALALGRVPAT* |
| Ga0079220_101100453 | 3300006806 | Agricultural Soil | LGPAEPLGRVRRHLLRAGAAGLALTPVLLALTPAVVALVLGRVPAA* |
| Ga0079220_107434481 | 3300006806 | Agricultural Soil | EPLGRLRRHLLRATAATLALAPVLVALTPAVAALALGRVPTA* |
| Ga0079220_108437921 | 3300006806 | Agricultural Soil | RRQLLRTIAAALALTPVVLALAPAVLALALGRLPAA* |
| Ga0079220_111044842 | 3300006806 | Agricultural Soil | SRLRQHLLRATATNLALTPVLVAFAPAVAALALGKVPAG* |
| Ga0075425_1020594613 | 3300006854 | Populus Rhizosphere | GRARRQLLRATAAALALTPVLLALTPALVALALGRIPAA* |
| Ga0079219_102388901 | 3300006954 | Agricultural Soil | PLSRVRRQLLRAGAAALALTPVLLALTPAVVALALGRVPTA* |
| Ga0079219_109412302 | 3300006954 | Agricultural Soil | WAGVHRQLLRATAAPLSLAPVLLALAPAMAALALGRVPAA* |
| Ga0079219_121927372 | 3300006954 | Agricultural Soil | RRHLLRTTAATLAITPLLVALAPAVVALALGRVPAA* |
| Ga0099794_101886702 | 3300007265 | Vadose Zone Soil | LGRLHRHLLRAAAAALALAPLLLALTPAVVALALGRIPAA* |
| Ga0099829_116925131 | 3300009038 | Vadose Zone Soil | LRRHLLRATAVIVAIAPVIVASTPAIAALLLGKLPAA* |
| Ga0105247_108794152 | 3300009101 | Switchgrass Rhizosphere | RRRLLRATAAALALTPVLLALTPAMVALALGKLPAA* |
| Ga0105247_115086522 | 3300009101 | Switchgrass Rhizosphere | RARRQLLGTIAAALALTPVALALAPAVLALALGRLPAT* |
| Ga0099792_109868342 | 3300009143 | Vadose Zone Soil | VRRQLLRAGAAALALTPVLLALTPAIVALALGRFPAA* |
| Ga0105243_109253523 | 3300009148 | Miscanthus Rhizosphere | VRGQLLRAGAAALALTPVLLALTPAIVALVLGRVPAA* |
| Ga0116214_11183741 | 3300009520 | Peatlands Soil | AEPLGRSRRLLLRAMAAGLVLGPPVMALAPAVLALALGRVPHP* |
| Ga0116224_103163191 | 3300009683 | Peatlands Soil | RQLLRATAAALALTPVLLALTPALVALALGRIPAA* |
| Ga0116216_100165296 | 3300009698 | Peatlands Soil | MGRVRRQLLRATAAALALTPVLLALTPAIVALALGKLPGA* |
| Ga0116216_103516602 | 3300009698 | Peatlands Soil | LRPAEPLGRSRRLLLRAAAAALVLGPLAMALAPAVLALALGRVPHA* |
| Ga0116216_109045841 | 3300009698 | Peatlands Soil | LGRVRRQLLRATAAALALTPVLLALTPAIVALALGKLPGA* |
| Ga0116223_108033342 | 3300009839 | Peatlands Soil | RLLGPCEPLGRVRRQLLRATAAALALTPVLLALTPAIVALALGKLPGA* |
| Ga0134125_131214871 | 3300010371 | Terrestrial Soil | PLGHRRRLLLRAGVAALALTPVVLALVPAVIALVLGPVRGG* |
| Ga0134128_126697961 | 3300010373 | Terrestrial Soil | RLLGPAEPLSRVRRQLVRAGASALALTPVLLALTPAVVALALGRVPAS* |
| Ga0126381_1039063072 | 3300010376 | Tropical Forest Soil | APPLARRHRLLLRAAVLALALSPVLLALTPALLALALGPVPAA* |
| Ga0136449_1002448774 | 3300010379 | Peatlands Soil | RHLLGAGAVVLALTPVLLAIVPAVVALALGRVPGA* |
| Ga0136449_1041031431 | 3300010379 | Peatlands Soil | GRVRRQLLRAGAGALALAPVLLALTPAVVALALGRVPAA* |
| Ga0134126_103878861 | 3300010396 | Terrestrial Soil | RARRQLLRATAAALALTPVLLALTPALVALALGRSPAA* |
| Ga0134124_113384201 | 3300010397 | Terrestrial Soil | RRHLLRATAAILALAPVLVASTPAVAALALGRIPAG* |
| Ga0134127_111940771 | 3300010399 | Terrestrial Soil | RMRRRLLRATAAALALTPVLLALTPAVIALALGKLPGA* |
| Ga0126361_107162032 | 3300010876 | Boreal Forest Soil | GPARPLGRARRRLLGATAAALALTPVLLALAPAVLALALGRLPAA* |
| Ga0126350_101595342 | 3300010880 | Boreal Forest Soil | LGPSEPLGRARRRLLGAAAAVLALTPVLLALTPAVVALALGKLPAA* |
| Ga0126350_120930541 | 3300010880 | Boreal Forest Soil | LNPGRRHLLRGAAAVLALTPLLLALAPAVLALALGRVPGA* |
| Ga0138514_1000836271 | 3300011003 | Soil | LLRPGEPLGRLWRQLLGATAAALALTPVLLALTPAVVALALGKVPAA* |
| Ga0137391_107631772 | 3300011270 | Vadose Zone Soil | RPAEPLGAARRQLLRATAASLALTPVLLALAPALLALALGRVA* |
| Ga0120114_11111452 | 3300011998 | Permafrost | PLGRARRHLLRGTAAALALTPVLLALAPAVVALVLGRRRR* |
| Ga0137389_117842851 | 3300012096 | Vadose Zone Soil | RRQLLRATAAALALTPVLLALTPALVALALGRIPAA* |
| Ga0137365_100037641 | 3300012201 | Vadose Zone Soil | EPLGRVRRRLLRATAAALALTPVLLALTPAMVALALGKLPGA* |
| Ga0137362_113610731 | 3300012205 | Vadose Zone Soil | RHLLRAGAAALALTPLLLALTPAAVALALGRVPPV* |
| Ga0137380_114885372 | 3300012206 | Vadose Zone Soil | LLGPAKPLGRARRQLLRATAAALALTPVLLALTPALVALALGRIPAA* |
| Ga0137378_102256583 | 3300012210 | Vadose Zone Soil | LGPAEPLSRVSRQLLRGTAAALALSPVLLAVAPAVVALALGRAPAA* |
| Ga0137385_103891672 | 3300012359 | Vadose Zone Soil | EPLGRARRQLLRATAAALALTPVLLALAPAVLALALGRVPAA* |
| Ga0137385_111542381 | 3300012359 | Vadose Zone Soil | EPLGRARRQLLRATAAALALTPVLLALAPAVLALALGRVPGA* |
| Ga0137390_115576701 | 3300012363 | Vadose Zone Soil | AEPLSRPRQHLLRATTALLALAPVLVALAPAVAALALGRVPAA* |
| Ga0137395_109201931 | 3300012917 | Vadose Zone Soil | RLLGPAEPLGRARRQLLRTIAAALALTPVVLALTPAVLALALGRLPAA* |
| Ga0164298_116938261 | 3300012955 | Soil | QLLGTIAAALALTPVALALAPAVLALALGRLPAA* |
| Ga0157372_105488891 | 3300013307 | Corn Rhizosphere | PLGRARRQLLRATAAALALTPVLLALTPALVALALGRSPAA* |
| Ga0157375_115244122 | 3300013308 | Miscanthus Rhizosphere | MRRRLLRATAAALALTPVLLALTPAVVALALGKLPGA* |
| Ga0181537_112093312 | 3300014201 | Bog | PGEPLGRVRRRLLRVAAVAFAVTPVLLALTPAMVALALGKLPAA* |
| Ga0163163_105446123 | 3300014325 | Switchgrass Rhizosphere | EPLGRLRRQLLRAAAGGLALTPVLLALTPALVALALGRVPAA* |
| Ga0182018_103771552 | 3300014489 | Palsa | RLLGPAEPLGRARRQLLRATAAALALTPVLLALTPAVVALALGRIPAA* |
| Ga0181516_106015412 | 3300014655 | Bog | GRARRQLLRATAAALALTPVLLALTPAVVALALGKLPAA* |
| Ga0157379_120960152 | 3300014968 | Switchgrass Rhizosphere | MRRRLLRATAAALALTPLLLALTPAVVALALGKLPGA* |
| Ga0132258_124719383 | 3300015371 | Arabidopsis Rhizosphere | RQLLRTIVAAFALTPVALALAPAVLALALGRLPAA* |
| Ga0132255_1001545381 | 3300015374 | Arabidopsis Rhizosphere | PLSRVRRQLLRAGAAALALTPVLLALTPAIVALALGRLPAA* |
| Ga0182038_101941113 | 3300016445 | Soil | RRQLLGAGAAALALTPVLLALTPAIVALALGRVPAA |
| Ga0187818_102138782 | 3300017823 | Freshwater Sediment | LRPAEPLGGPRRLLLRAMAAGLVLGPLIMALAPAVLALALGRVPHP |
| Ga0187820_10045155 | 3300017924 | Freshwater Sediment | SRVRRQLLGAGAAALALTPVLLALTPAIVALALGKVPGA |
| Ga0187807_10211341 | 3300017926 | Freshwater Sediment | QLLRALAAGLVLLPAFLALAPAVLALALGRVPSGPM |
| Ga0187807_11408381 | 3300017926 | Freshwater Sediment | RGPWRLLLQAMAAGLVLGPLVMALAPAALALALGRVPHP |
| Ga0187801_101145983 | 3300017933 | Freshwater Sediment | EPLGRSRRLLLRAVATGLVLGPLIMALAPAVLALALGRVPHP |
| Ga0187809_101758151 | 3300017937 | Freshwater Sediment | SPRPAAPMSMPRRLLSAGAAGLALAPVLLALTPAVLALALGRVPGA |
| Ga0187817_103020063 | 3300017955 | Freshwater Sediment | LDRPRRLLMQSVAAALVLGPLVMALAPAVLALALGRVPHA |
| Ga0187805_103594322 | 3300018007 | Freshwater Sediment | RLLRPAEPLGRPRRLLLRAMAAGLALGPLVMALAPAVLALALGRVPHP |
| Ga0187873_13290442 | 3300018013 | Peatland | RRLLRAAAAAFALAPVLLALAPAMLALVLGRVPGA |
| Ga0187875_105271801 | 3300018035 | Peatland | AEPLGRARRQLLRTTAAALALTPVLLALTPALVALALGRIPAP |
| Ga0193729_12738792 | 3300019887 | Soil | GRRQLLRTTAAALALTPVLLALAPAVLALALGRLPTA |
| Ga0193730_11523022 | 3300020002 | Soil | RQLLRAAAAALALTPVLLALTPAVVALALGKLPGA |
| Ga0206354_105179971 | 3300020081 | Corn, Switchgrass And Miscanthus Rhizosphere | LGRARRQLLRATAAALALTPVLLALTPALVALALGRSPAA |
| Ga0210403_110721482 | 3300020580 | Soil | RLLLPAEPLGRARRRLLRATAASLAATPVLLALAPAMLALALGRVA |
| Ga0210403_112849901 | 3300020580 | Soil | RRRLLGATAAALALTPVLLALTPAVVALALGKLPAA |
| Ga0210399_107243762 | 3300020581 | Soil | QRLLRPTEPLSRVRRQLLRAGAAALALTPVLLALTPAIVALALGRVPAA |
| Ga0210399_109536381 | 3300020581 | Soil | EPLGPVRRRLLRATAAALALTPVLLALTPAMVALALGKLPVA |
| Ga0210399_115234811 | 3300020581 | Soil | LGRVRRQLLRTGAGALALAPVLLALTPAVVALALGRVPVA |
| Ga0210395_104014992 | 3300020582 | Soil | ARRQLLRATAAALALTPVLLALTPALVALALGRIPAA |
| Ga0210395_108516852 | 3300020582 | Soil | GRVRRQLLRTGAGALALAPVLLALTPAVVALALGRVPVA |
| Ga0210395_112995341 | 3300020582 | Soil | RQLLRATAAALALTPVLLALTPALVALALGRIPAA |
| Ga0210395_114035472 | 3300020582 | Soil | LPAEPLGRARRRLLRATAASLAVTPVLLALAPAMLALALGRVA |
| Ga0210405_105200051 | 3300021171 | Soil | RGRRQLLRGTAAALALAPVLLALAPALVALALGRVPAA |
| Ga0210408_106155061 | 3300021178 | Soil | RRLLGPSEPLGRVRRQLLRATAAALVLTPVLLALTPAVVALALGKLPGA |
| Ga0210408_112028322 | 3300021178 | Soil | LSRARRQLLGAGAAALALTPVLLALTPAIVALALGKVPGA |
| Ga0210396_116462262 | 3300021180 | Soil | LLGPSEPLGRVRRQLLRAAAAAFAVTPLLLALTPAVLALALGKLPAA |
| Ga0210388_103369801 | 3300021181 | Soil | PLGAARRQLLRATAAALALTPVLLALTPALVALALGRIPAA |
| Ga0213881_104664761 | 3300021374 | Exposed Rock | GPARRHLLRAAVAALAVAPVLLALAPAAIALVLGRVPTA |
| Ga0210393_100965654 | 3300021401 | Soil | HRLLAPAQPLGRARRQLLRATAAALALTPVLLALTPAVLALALGRLPAA |
| Ga0210393_107898931 | 3300021401 | Soil | LGRTRQRLLGAAAAALALIPVLLALTPAVVALALGKLPTA |
| Ga0210385_103977031 | 3300021402 | Soil | PLGRARRQLLRATAAALALTPVLLALTPAVLALALGRLPAA |
| Ga0210385_110718122 | 3300021402 | Soil | PLSAGRRQLLRATAASLALTPVLLALAPAMLALALGRVA |
| Ga0210389_102048991 | 3300021404 | Soil | LLPAEPLGRARRRWLRATAASLAATPVLLALAPAMLALALGRVA |
| Ga0210389_106304061 | 3300021404 | Soil | RQLLRGTAAAFAVAPLLLALAPALVALVLGRVPVA |
| Ga0210389_110165582 | 3300021404 | Soil | LLGPGEPLGRVRRQLLRATAAALALTPVLLALTPAVIALALGKLPGA |
| Ga0210387_109247891 | 3300021405 | Soil | SEPLGRARRQLLRAAAAALAVTPVLLALTPALVALALGRIPAA |
| Ga0210387_116320961 | 3300021405 | Soil | LGPSEPLGRARRQLLRAAAAALAVTPVLLALTPALVALALGRIPAA |
| Ga0210383_101000444 | 3300021407 | Soil | AEPLGRARRQLLRATAAALALTPVLLALTPALVALALGRIPTT |
| Ga0210383_101854393 | 3300021407 | Soil | LGRARRQLLRATAAALALTPVLLALTPAVLALALGRLPAA |
| Ga0210383_110874622 | 3300021407 | Soil | HRLLGPGEPLGRARRHLLRATAAALALTPVLLALTPAVVALALGKLPAA |
| Ga0210383_111192032 | 3300021407 | Soil | LAPAQPLGRARRQLLRATATALALTPVLLALTPAVLALVLGKLPAA |
| Ga0210383_114125931 | 3300021407 | Soil | GRRLLLRAAAGSLALIPVLLALTPALVALALGRLPVA |
| Ga0210394_104355513 | 3300021420 | Soil | GLVRRHLLRARAAAFALTPVLLALTPAVIALALGRVPTA |
| Ga0210394_108893982 | 3300021420 | Soil | LGPAKPLGRGRRQLLRATAAALALTPVLLALTPALVALALGRIPVA |
| Ga0210394_118557471 | 3300021420 | Soil | GRTRRQLLRAAAAALTVTPVLLALTPALMALALGRIPAA |
| Ga0210391_103746401 | 3300021433 | Soil | IHRLLGRGEPLGRARRHLLRATATALALTPVVLALTPAVVALALGKLPAA |
| Ga0210390_101904563 | 3300021474 | Soil | LGPARRQLLRATAAALAVTPLLLALTPALAALALGRLPAA |
| Ga0210390_112494101 | 3300021474 | Soil | ARRQLLRATAAALALTPVLLALTPALVALALGRIPTA |
| Ga0210398_111239122 | 3300021477 | Soil | PLGRARRQLLRATAAALALTPVLLALTPAVVALALGKLPAA |
| Ga0210402_117050662 | 3300021478 | Soil | PLGRARRQLLRAAAAALALTPVLLALTPALVALVLGRIPAA |
| Ga0210409_107449661 | 3300021559 | Soil | LGPAEPLGRARRQLLRATAAALALTPVLLALTPALVALALGRIPTA |
| Ga0213853_105900412 | 3300021861 | Watersheds | LGRARRQLLRGTAAALALTPVLLALAPAVLALALGRVRGA |
| Ga0224551_10786531 | 3300023259 | Soil | PAQPLAPARRHLLQAAAAALALTPLLLALAPAALALALGRVHGA |
| Ga0247693_10293912 | 3300024181 | Soil | TRRRLLRATAAALALTPVLLALTPAVVALALGKLPGA |
| Ga0179589_103224602 | 3300024288 | Vadose Zone Soil | LLSPAEPLGRVRRQLLRAGAAALALTPVLLALTPAIVALALGRVPAA |
| Ga0208356_11145942 | 3300025504 | Arctic Peat Soil | EPLGRSRRQLLRTTAAALALTPVLLALAPAVLALALGRLPTA |
| Ga0208848_10687671 | 3300025509 | Arctic Peat Soil | LLGPAEPLGRGRRQLLRTTAAALALTPVLLALAPAVLALALGQLPTA |
| Ga0208586_10154972 | 3300025588 | Arctic Peat Soil | RRHLLRGAAAALALTPLLLALAPAVLALALGRVPGA |
| Ga0207692_103771081 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | TRLVRPAPPLGPRRRLLLRAAVLALAVSPVLLALTPALLALALGPVPAA |
| Ga0207710_106590392 | 3300025900 | Switchgrass Rhizosphere | RARRQLLGTIAAALALTPVALALAPAVLALALGRLPAT |
| Ga0207688_107015771 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | KPLGRARRQLLRATAAALALTPVLLALTPALVALALGRSPAA |
| Ga0207685_105907462 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | RRLLRATAAALALTPVLLALTPAVIALALGKLPGA |
| Ga0207699_111515851 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | HRVTRLVRPAPPLGPRRRLLLRAAVLALAVSPVLLALTPALLALALGPVPAA |
| Ga0207699_112128071 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | RPAEPLSRVRRQLLRAGAAALALTPVLVALTPAMVALALGRVPAA |
| Ga0207693_111339401 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | LGRMRRQLLRAAAGGLALTPVLLALTPALVALILGRVPSA |
| Ga0207663_111503592 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | AEPLSRVRRQLLRAGAAALALTPVLVALTPAMVALALGRVPAA |
| Ga0207649_104048011 | 3300025920 | Corn Rhizosphere | RQLLRATAAALALTPVLLALTPALVALALGRSPAA |
| Ga0207646_100999101 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | AQPLGHARRQLLRATAAALALTPVLLALTPAVLALALGRLPAA |
| Ga0207646_112660752 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | GTARRQLLCVTAAVLALTPLLLALVPAVVALALGRVRGA |
| Ga0207646_118516151 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | LGPSEPLGRARRRLLRATAAALALTPVLLALTPAVVALALGKLPGA |
| Ga0207681_107625172 | 3300025923 | Switchgrass Rhizosphere | LGRVRRHLLRATAAALALTPVLLALTPAVIALALGKLPGA |
| Ga0207664_117992791 | 3300025929 | Agricultural Soil | AGRRMLRATAASLAVTPVLLALAPALLALALGRVA |
| Ga0209438_10749343 | 3300026285 | Grasslands Soil | GRLHRHLLRAAAAALALAPLLLALTPAVVALALGRIPAA |
| Ga0257146_10576051 | 3300026374 | Soil | RRQLLRAAAAALALTPVLLALTPAVVALALGKLPGA |
| Ga0208731_10354852 | 3300027029 | Forest Soil | LGPGEPLGRARRQLLRATAAALALTPVLLAMTPAVVALALGKLPAA |
| Ga0209214_10177101 | 3300027071 | Forest Soil | PAEPLSRVRRQLLGAGAAALALTPVLLALTPAIVALALGKVPGA |
| Ga0208604_10081511 | 3300027090 | Forest Soil | AKPLGRARRQLLRATAAALALTPVLLALTPALVALALGRIPAA |
| Ga0208042_10961471 | 3300027568 | Peatlands Soil | HRLLGPSEPLGRARRQLLRATAAALALTPVLLALTPAVVALALGRIPAA |
| Ga0209003_10744191 | 3300027576 | Forest Soil | RRQLLRAGAAALALTPVLLALTPAIVALALGRVPAA |
| Ga0209116_11534512 | 3300027590 | Forest Soil | SARRRLLRVAAAALALTPVLLALTPAAVALALGKLPAA |
| Ga0209530_10184641 | 3300027692 | Forest Soil | EPLGRARRRLLRATAAALALTPVLLALTPAVVALALGKLPAA |
| Ga0209693_102085533 | 3300027855 | Soil | RLLAPAQPLGRARRQLLRATAAALALTPVLLALTPAVLALALGRLPAA |
| Ga0209167_107471862 | 3300027867 | Surface Soil | AEPLSRPRRRLLSAAAAMLTLTPVLLALIPALLALALGRVPAA |
| Ga0209169_100897642 | 3300027879 | Soil | RRQMLCATAAALALTPVLLALTPALVALALGRIPAA |
| Ga0209590_106424411 | 3300027882 | Vadose Zone Soil | LRPAEPLGTARRRMLRATAASLALTPVLLALAPALLALVLGRVA |
| Ga0209006_113722072 | 3300027908 | Forest Soil | SRVRRQLLGAGAAALALTPVLLALVPAIVALALGRVPAA |
| Ga0209526_108289792 | 3300028047 | Forest Soil | GRVRRQLLRASAAALAVTPLLLALTPAVLALALGKLPAA |
| Ga0265334_100894691 | 3300028573 | Rhizosphere | HRLLLRAAVLALAIGPVLLALTPALLALALGPVPAA |
| Ga0302223_103249491 | 3300028781 | Palsa | EPLGRPRRLLLRTAAAALALTPVLLALTPAVVALALGKLPAA |
| Ga0302222_101470663 | 3300028798 | Palsa | RLLGPGEPLGRPRRLLLRTAAAALALTPVLLALTPAVVALALGKLPAA |
| Ga0307284_102904421 | 3300028799 | Soil | VLGPRLLGRAEPLGRVRRHLLRAAAAGLALVPLLLALAPAVVALALGR |
| Ga0302226_101642262 | 3300028801 | Palsa | HRLLGPAEPLGRARRQLLRATAAALALTPVLLALTPALVALALGRIPAA |
| Ga0302228_101835681 | 3300028808 | Palsa | RARRQLLRATAAALALTPVLLALTPALVALALGRIPAA |
| Ga0302229_101046231 | 3300028879 | Palsa | RRQLLRATAAALALTPVLLALTPAVVALALGKLPAA |
| Ga0308309_116764362 | 3300028906 | Soil | RHLLRATVAALALTPVLLALAPAAMALILGRVPGA |
| Ga0308309_118282861 | 3300028906 | Soil | HRLLRPSEPLGRARRRLLGAAAAALALTPVLLALTPAVVALALGKLPTA |
| Ga0311369_114154032 | 3300029910 | Palsa | PRLLLLRTAAAALALTPVLLALTPAVVALALGKLPAA |
| Ga0311363_102635141 | 3300029922 | Fen | GRTRRRLLRTTAAALALAPVLLALAPAVLALALGRVPGA |
| Ga0311339_102213361 | 3300029999 | Palsa | RARRQLLRATAAALALTPVLLALTPAVVALALGKLPAA |
| Ga0311339_105799583 | 3300029999 | Palsa | GEPLGRARRQLLRATAAALALTPVLLALTPAVVALVLGKLPAA |
| Ga0311338_101836841 | 3300030007 | Palsa | GRARRQLLRATAAALALTPVLLALTPALVALALGRIPAA |
| Ga0311338_106850213 | 3300030007 | Palsa | RRQLLRATAAALALTPVLLALTPAVVALLLGKLPAA |
| Ga0302178_101082462 | 3300030013 | Palsa | GPAEPLGRARRQLLRTTAVALALTPVLLALTPAVVALALGKLPAA |
| Ga0302177_100973931 | 3300030053 | Palsa | PLGRARRRLLGAAAAALALTPVLLALTPAVVALALGKLPTA |
| Ga0302182_105077291 | 3300030054 | Palsa | LLNPAQPLGHARRHLLRATAAALALTPVLLALAPAVLALALGRVPAA |
| Ga0311372_110428281 | 3300030520 | Palsa | LGRARRQLLRATAAALALTPVLLALTPALVALALGRIPAA |
| Ga0311355_102320794 | 3300030580 | Palsa | LGPGEPLGRARRQLLRATAAALALTPVLLALTPAVVALVLGKLPAA |
| Ga0311354_108264562 | 3300030618 | Palsa | AEPLGRARRQLLRTTAVALALTPVLLALTPAVVALALGKLPAA |
| Ga0302317_103286991 | 3300030677 | Palsa | IHRLLGPAEPLGRARRQLLRATAAALALTPVLLALTPALVALALGRIPAA |
| Ga0302311_107837452 | 3300030739 | Palsa | GRARRQLLRIAAAALALTPLLLALVPAVLALALGRLPTA |
| Ga0302324_1002558164 | 3300031236 | Palsa | LGRARRQLLRATAAALALTPVLLALTPAVVALALGKLPAA |
| Ga0318515_100895122 | 3300031572 | Soil | LGPAEPLGRVRVQLLRAGAGGLALAPVLLALVPAAVALALGRVPVA |
| Ga0310686_1110068761 | 3300031708 | Soil | PAEPLSRTRRHLLRAAATSLALTPVVLAITPALVALALGRLPGA |
| Ga0318496_102275053 | 3300031713 | Soil | LSRLRRQLLGAGAAALALTPVLLALTPALVALALGRVPAA |
| Ga0307476_108354912 | 3300031715 | Hardwood Forest Soil | LGPCEPLGRVRRRLLRATAAALALTPVLLALTPAMVALALGKLPGA |
| Ga0307476_108985622 | 3300031715 | Hardwood Forest Soil | DPLSRLRRQLLGAGAAALALTPVLLALTPAVVALALGRVPAA |
| Ga0307476_114390181 | 3300031715 | Hardwood Forest Soil | PAEPLGRARRQLLRATAAALAVAPVLLALTPALVALALGRIPAA |
| Ga0307474_110881252 | 3300031718 | Hardwood Forest Soil | AEPLSRARRQLLGAGAAALALTPVLLALTPAIVALALGKVPGA |
| Ga0307469_106031802 | 3300031720 | Hardwood Forest Soil | SRQRRHLLRATAAILALAPVLVASTPAVAALALGRIPAG |
| Ga0318492_107765351 | 3300031748 | Soil | RLLRPNEPLSRLRRQLLGAGAAALALTPVLLALTPALVALALGRVPAA |
| Ga0318526_103983902 | 3300031769 | Soil | VRRQLLRAGAAALALTPVLLALTPAIVALALGRVPAA |
| Ga0318526_104677502 | 3300031769 | Soil | RRLLLRAMAAALVLGPLVMALAPAVLALALGRVPHP |
| Ga0318521_102372141 | 3300031770 | Soil | RLLRPVEPLSRIRRQLLRAGAGVLALTPVLLALTPAMVALALGRVPAA |
| Ga0318521_109162102 | 3300031770 | Soil | RRQLLRAGAAALILTPVLLALTPAIVALALGRVPAA |
| Ga0318521_110208801 | 3300031770 | Soil | PLDRVRLQLLRAGAGALALAPVLLAMVPAAVALALGRVPVA |
| Ga0318550_102821381 | 3300031797 | Soil | QRLLRPAEPLSRVRRQLLRAGAAALALTPVLLALTPAIVALALGRVPAA |
| Ga0318523_103049242 | 3300031798 | Soil | AEPLGRVRVQLLRAGAGGLALAPVLLALVPAAVALALGRVPVA |
| Ga0318565_100027851 | 3300031799 | Soil | RVQLLRAGAGGLALAPVLLALVPAAVALALGRVPVA |
| Ga0318565_102741041 | 3300031799 | Soil | AEPLGGLRRQLLRAMAAGFVLLPVVLALAPAVLALALGRVPSSPV |
| Ga0318565_104141611 | 3300031799 | Soil | RQLLRAGAAALALTPVLLALTPAIVALALGRVPAA |
| Ga0318497_101465912 | 3300031805 | Soil | PLSRVRRQLLGAGAAALALTPVLLALTPAIVALALGRVPAA |
| Ga0318517_100366341 | 3300031835 | Soil | RPVEPLSRIRRQLLRAGAGVLALTPVLLALTPAMVALALGRVPAA |
| Ga0318511_103914411 | 3300031845 | Soil | PLSRVRRELLLARAAALAFIPVLLALTPAAVALALGRVPVA |
| Ga0306923_115557761 | 3300031910 | Soil | RRHLLRVTAAALALTPGLVALTPAVAALALGRVPGG |
| Ga0310916_112449811 | 3300031942 | Soil | IQRLLRPVEPLSRIRRQLLRAGAGVLALTPVLLALTPAMVALALGRVPAA |
| Ga0310910_102990321 | 3300031946 | Soil | LRPVEPLSRIRRQLLRAGAGVLALTPVLLALTPAMVALALGRVPAA |
| Ga0310909_106095932 | 3300031947 | Soil | VRRQLLGAGAAALALTPVLLALTPAIVALALGRVPAA |
| Ga0307479_114290552 | 3300031962 | Hardwood Forest Soil | EPLSRARRGLLRAGAVAVALVPVLLALAPAVAALALGRVPAS |
| Ga0318562_103558481 | 3300032008 | Soil | LRPADPLSRVRRQLLGAGAAALALTPVLLALTPAIVALALGRVPAA |
| Ga0318563_105856792 | 3300032009 | Soil | PRPAEPLGRSGRLLVRAAAAALVLGPLAMALAPAVLALALGRVPRA |
| Ga0318505_105837181 | 3300032060 | Soil | LSRIRRQLLRAGAGVLALTPVLLALTPAMVALALGRVPAA |
| Ga0318504_103389761 | 3300032063 | Soil | RPAEPLGGLRRQLLRAMAAGFVLLPVVLALAPAVLALALGRVPSSPV |
| Ga0318514_100780301 | 3300032066 | Soil | AEPLSRVRRQLLRAGAAALALTPVLLALTPAIVALALGRVPAA |
| Ga0318514_101177541 | 3300032066 | Soil | PLSRVRRQLLRAGAAALALTPVLLALTPAMVALALGRVPAA |
| Ga0306924_105087803 | 3300032076 | Soil | VRRQLLRAGAAALALTPVLLALTPAMVALALGRVPAA |
| Ga0307470_101948682 | 3300032174 | Hardwood Forest Soil | RRQLLGTIAAALALTPVALALAPAVLALALGRLPAA |
| Ga0306920_1017483821 | 3300032261 | Soil | LSRVRRQLLGAGAAAVALTPVLLALTPAIVALALGRVPAA |
| Ga0335079_122834701 | 3300032783 | Soil | EPLSRVRMHLLRAGAAVLAVTPVLLALTPAVVALALGRVPAA |
| Ga0335069_100088171 | 3300032893 | Soil | TPAEPLSRVRRHLLRAAAAVLALIPLLLALAPAVLALALGRIQPV |
| Ga0335075_112266371 | 3300032896 | Soil | RPVEPLGRGRRHLLRAGAAVLAMTPLLLAFTPAAVALSLGRVRPA |
| Ga0370483_0201290_1_123 | 3300034124 | Untreated Peat Soil | LGRARRQLLRAAAAALALTPVLLAMTPAVVALALGKLPAA |
| Ga0370515_0242590_3_143 | 3300034163 | Untreated Peat Soil | LGPARPLGRGRRQLLRATAAALALTPVLLALAPAVLALALGRLPAA |
| Ga0370515_0461798_427_534 | 3300034163 | Untreated Peat Soil | LLLLRAAAAALALTPVLLALTPALVALALGRIPAA |
| ⦗Top⦘ |