| Basic Information | |
|---|---|
| Family ID | F016316 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 248 |
| Average Sequence Length | 45 residues |
| Representative Sequence | VSERLRLWLERGERGFHLRDAATGEPVRWEDPRLRVVPVAGVS |
| Number of Associated Samples | 210 |
| Number of Associated Scaffolds | 248 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 49.19 % |
| % of genes near scaffold ends (potentially truncated) | 97.98 % |
| % of genes from short scaffolds (< 2000 bps) | 95.56 % |
| Associated GOLD sequencing projects | 202 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.59 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (68.548 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (22.581 % of family members) |
| Environment Ontology (ENVO) | Unclassified (26.613 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (45.565 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 18.31% Coil/Unstructured: 81.69% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.59 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 248 Family Scaffolds |
|---|---|---|
| PF03069 | FmdA_AmdA | 41.94 |
| PF02780 | Transketolase_C | 38.31 |
| PF13302 | Acetyltransf_3 | 6.05 |
| PF00676 | E1_dh | 3.63 |
| PF06475 | Glycolipid_bind | 1.21 |
| PF12688 | TPR_5 | 0.81 |
| PF07883 | Cupin_2 | 0.40 |
| PF07726 | AAA_3 | 0.40 |
| PF04321 | RmlD_sub_bind | 0.40 |
| PF00440 | TetR_N | 0.40 |
| PF08797 | HIRAN | 0.40 |
| COG ID | Name | Functional Category | % Frequency in 248 Family Scaffolds |
|---|---|---|---|
| COG2421 | Acetamidase/formamidase | Energy production and conversion [C] | 41.94 |
| COG0567 | 2-oxoglutarate dehydrogenase complex, dehydrogenase (E1) component, and related enzymes | Energy production and conversion [C] | 3.63 |
| COG1071 | TPP-dependent pyruvate or acetoin dehydrogenase subunit alpha | Energy production and conversion [C] | 3.63 |
| COG3554 | Uncharacterized conserved protein | Function unknown [S] | 1.21 |
| COG0451 | Nucleoside-diphosphate-sugar epimerase | Cell wall/membrane/envelope biogenesis [M] | 0.81 |
| COG0702 | Uncharacterized conserved protein YbjT, contains NAD(P)-binding and DUF2867 domains | General function prediction only [R] | 0.81 |
| COG1086 | NDP-sugar epimerase, includes UDP-GlcNAc-inverting 4,6-dehydratase FlaA1 and capsular polysaccharide biosynthesis protein EpsC | Cell wall/membrane/envelope biogenesis [M] | 0.81 |
| COG1087 | UDP-glucose 4-epimerase | Cell wall/membrane/envelope biogenesis [M] | 0.40 |
| COG1088 | dTDP-D-glucose 4,6-dehydratase | Cell wall/membrane/envelope biogenesis [M] | 0.40 |
| COG1089 | GDP-D-mannose dehydratase | Cell wall/membrane/envelope biogenesis [M] | 0.40 |
| COG1090 | NAD dependent epimerase/dehydratase family enzyme | General function prediction only [R] | 0.40 |
| COG1091 | dTDP-4-dehydrorhamnose reductase | Cell wall/membrane/envelope biogenesis [M] | 0.40 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 68.55 % |
| Unclassified | root | N/A | 31.45 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2140918025|NODE_408183_length_1158_cov_17.609673 | Not Available | 1208 | Open in IMG/M |
| 2170459017|G14TP7Y02HOBJO | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
| 2170459021|G14TP7Y02GN4JE | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 615 | Open in IMG/M |
| 3300000887|AL16A1W_10169844 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 627 | Open in IMG/M |
| 3300001334|A2165W6_1138039 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 899 | Open in IMG/M |
| 3300001686|C688J18823_10515691 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 766 | Open in IMG/M |
| 3300001686|C688J18823_11095615 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 505 | Open in IMG/M |
| 3300003992|Ga0055470_10242301 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 501 | Open in IMG/M |
| 3300004156|Ga0062589_101029741 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 772 | Open in IMG/M |
| 3300004156|Ga0062589_101302782 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 702 | Open in IMG/M |
| 3300004157|Ga0062590_100340050 | All Organisms → cellular organisms → Bacteria | 1194 | Open in IMG/M |
| 3300004463|Ga0063356_103249921 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 700 | Open in IMG/M |
| 3300004479|Ga0062595_101258660 | Not Available | 662 | Open in IMG/M |
| 3300004480|Ga0062592_100758190 | Not Available | 854 | Open in IMG/M |
| 3300004643|Ga0062591_100774291 | Not Available | 881 | Open in IMG/M |
| 3300005172|Ga0066683_10782277 | Not Available | 557 | Open in IMG/M |
| 3300005329|Ga0070683_100684345 | All Organisms → cellular organisms → Bacteria | 982 | Open in IMG/M |
| 3300005332|Ga0066388_103275363 | All Organisms → cellular organisms → Bacteria | 827 | Open in IMG/M |
| 3300005332|Ga0066388_107586762 | Not Available | 544 | Open in IMG/M |
| 3300005337|Ga0070682_101779116 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → environmental samples → uncultured Thermomicrobiales bacterium | 537 | Open in IMG/M |
| 3300005366|Ga0070659_100402204 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1156 | Open in IMG/M |
| 3300005435|Ga0070714_101305031 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 708 | Open in IMG/M |
| 3300005435|Ga0070714_101543701 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 649 | Open in IMG/M |
| 3300005436|Ga0070713_100944038 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 831 | Open in IMG/M |
| 3300005444|Ga0070694_100277362 | All Organisms → cellular organisms → Bacteria | 1277 | Open in IMG/M |
| 3300005445|Ga0070708_101855192 | Not Available | 559 | Open in IMG/M |
| 3300005447|Ga0066689_10759687 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
| 3300005471|Ga0070698_102149375 | Not Available | 512 | Open in IMG/M |
| 3300005518|Ga0070699_100083353 | All Organisms → cellular organisms → Bacteria | 2789 | Open in IMG/M |
| 3300005530|Ga0070679_101733216 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 573 | Open in IMG/M |
| 3300005536|Ga0070697_101285771 | All Organisms → cellular organisms → Bacteria | 652 | Open in IMG/M |
| 3300005539|Ga0068853_101548044 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 642 | Open in IMG/M |
| 3300005546|Ga0070696_101633265 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
| 3300005549|Ga0070704_100991027 | Not Available | 760 | Open in IMG/M |
| 3300005563|Ga0068855_101970312 | Not Available | 590 | Open in IMG/M |
| 3300005564|Ga0070664_101722218 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
| 3300005764|Ga0066903_101084394 | All Organisms → cellular organisms → Bacteria | 1474 | Open in IMG/M |
| 3300005764|Ga0066903_105795845 | All Organisms → cellular organisms → Bacteria | 649 | Open in IMG/M |
| 3300005981|Ga0081538_10271143 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 635 | Open in IMG/M |
| 3300006028|Ga0070717_11280092 | Not Available | 667 | Open in IMG/M |
| 3300006046|Ga0066652_101626491 | Not Available | 592 | Open in IMG/M |
| 3300006058|Ga0075432_10200089 | Not Available | 790 | Open in IMG/M |
| 3300006173|Ga0070716_100325827 | All Organisms → cellular organisms → Bacteria | 1078 | Open in IMG/M |
| 3300006578|Ga0074059_11879172 | All Organisms → cellular organisms → Bacteria | 723 | Open in IMG/M |
| 3300006755|Ga0079222_12097760 | Not Available | 559 | Open in IMG/M |
| 3300006800|Ga0066660_10165385 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 1654 | Open in IMG/M |
| 3300006804|Ga0079221_10578783 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 751 | Open in IMG/M |
| 3300006844|Ga0075428_102383948 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
| 3300006844|Ga0075428_102677931 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300006845|Ga0075421_101486800 | All Organisms → cellular organisms → Bacteria | 741 | Open in IMG/M |
| 3300006845|Ga0075421_102787576 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 503 | Open in IMG/M |
| 3300006854|Ga0075425_101244733 | Not Available | 845 | Open in IMG/M |
| 3300006881|Ga0068865_100737538 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 845 | Open in IMG/M |
| 3300006894|Ga0079215_10339032 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 853 | Open in IMG/M |
| 3300006894|Ga0079215_10587472 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 722 | Open in IMG/M |
| 3300006918|Ga0079216_10892245 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 669 | Open in IMG/M |
| 3300007004|Ga0079218_12688466 | Not Available | 593 | Open in IMG/M |
| 3300009089|Ga0099828_10047288 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3555 | Open in IMG/M |
| 3300009090|Ga0099827_10178741 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 1754 | Open in IMG/M |
| 3300009094|Ga0111539_10971236 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 988 | Open in IMG/M |
| 3300009094|Ga0111539_12944132 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 551 | Open in IMG/M |
| 3300009098|Ga0105245_12555974 | Not Available | 564 | Open in IMG/M |
| 3300009100|Ga0075418_12022267 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 628 | Open in IMG/M |
| 3300009100|Ga0075418_12834395 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 529 | Open in IMG/M |
| 3300009147|Ga0114129_11791371 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 747 | Open in IMG/M |
| 3300009174|Ga0105241_10644638 | All Organisms → cellular organisms → Bacteria | 961 | Open in IMG/M |
| 3300009817|Ga0105062_1078704 | Not Available | 633 | Open in IMG/M |
| 3300010040|Ga0126308_10111446 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1690 | Open in IMG/M |
| 3300010040|Ga0126308_10484153 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 834 | Open in IMG/M |
| 3300010041|Ga0126312_10010351 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 6241 | Open in IMG/M |
| 3300010041|Ga0126312_10810124 | All Organisms → cellular organisms → Bacteria | 680 | Open in IMG/M |
| 3300010154|Ga0127503_11101279 | Not Available | 551 | Open in IMG/M |
| 3300010301|Ga0134070_10418757 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 531 | Open in IMG/M |
| 3300010321|Ga0134067_10164172 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 799 | Open in IMG/M |
| 3300010322|Ga0134084_10442722 | Not Available | 516 | Open in IMG/M |
| 3300010323|Ga0134086_10195387 | Not Available | 754 | Open in IMG/M |
| 3300010362|Ga0126377_10042227 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3932 | Open in IMG/M |
| 3300010373|Ga0134128_10318801 | All Organisms → cellular organisms → Bacteria | 1739 | Open in IMG/M |
| 3300010397|Ga0134124_13196947 | Not Available | 502 | Open in IMG/M |
| 3300010937|Ga0137776_1109733 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1098 | Open in IMG/M |
| 3300012008|Ga0120174_1064201 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 975 | Open in IMG/M |
| 3300012043|Ga0136631_10318811 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 621 | Open in IMG/M |
| 3300012093|Ga0136632_10049743 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 1929 | Open in IMG/M |
| 3300012189|Ga0137388_10554405 | Not Available | 1068 | Open in IMG/M |
| 3300012189|Ga0137388_10642480 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 986 | Open in IMG/M |
| 3300012199|Ga0137383_10676282 | Not Available | 754 | Open in IMG/M |
| 3300012199|Ga0137383_11070299 | Not Available | 585 | Open in IMG/M |
| 3300012199|Ga0137383_11284505 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 523 | Open in IMG/M |
| 3300012200|Ga0137382_10447019 | Not Available | 914 | Open in IMG/M |
| 3300012357|Ga0137384_11175786 | Not Available | 611 | Open in IMG/M |
| 3300012359|Ga0137385_10353518 | Not Available | 1258 | Open in IMG/M |
| 3300012530|Ga0136635_10036797 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1465 | Open in IMG/M |
| 3300012531|Ga0136640_10147334 | All Organisms → cellular organisms → Bacteria | 1034 | Open in IMG/M |
| 3300012680|Ga0136612_10302381 | Not Available | 812 | Open in IMG/M |
| 3300012682|Ga0136611_10173167 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1484 | Open in IMG/M |
| 3300012891|Ga0157305_10209028 | Not Available | 565 | Open in IMG/M |
| 3300012893|Ga0157284_10159090 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 648 | Open in IMG/M |
| 3300012912|Ga0157306_10277329 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 604 | Open in IMG/M |
| 3300012922|Ga0137394_10251594 | Not Available | 1511 | Open in IMG/M |
| 3300012927|Ga0137416_10436703 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1116 | Open in IMG/M |
| 3300012948|Ga0126375_11906331 | Not Available | 522 | Open in IMG/M |
| 3300012951|Ga0164300_11184182 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 505 | Open in IMG/M |
| 3300012957|Ga0164303_10620003 | All Organisms → cellular organisms → Bacteria | 716 | Open in IMG/M |
| 3300012958|Ga0164299_11227453 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 569 | Open in IMG/M |
| 3300012960|Ga0164301_11618339 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 538 | Open in IMG/M |
| 3300012961|Ga0164302_11403007 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 570 | Open in IMG/M |
| 3300012972|Ga0134077_10256052 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 726 | Open in IMG/M |
| 3300012977|Ga0134087_10276664 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 778 | Open in IMG/M |
| 3300012985|Ga0164308_11483456 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 622 | Open in IMG/M |
| 3300012986|Ga0164304_10457061 | Not Available | 922 | Open in IMG/M |
| 3300012986|Ga0164304_11019738 | Not Available | 657 | Open in IMG/M |
| 3300012987|Ga0164307_11228303 | All Organisms → cellular organisms → Bacteria | 623 | Open in IMG/M |
| 3300012989|Ga0164305_12176309 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 510 | Open in IMG/M |
| 3300013105|Ga0157369_12490874 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 524 | Open in IMG/M |
| 3300013297|Ga0157378_12135457 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 611 | Open in IMG/M |
| 3300013307|Ga0157372_11348445 | Not Available | 823 | Open in IMG/M |
| 3300013307|Ga0157372_12239079 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 628 | Open in IMG/M |
| 3300014166|Ga0134079_10349952 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 672 | Open in IMG/M |
| 3300014488|Ga0182001_10290503 | Not Available | 655 | Open in IMG/M |
| 3300015077|Ga0173483_10532184 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 633 | Open in IMG/M |
| 3300015077|Ga0173483_10559705 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 621 | Open in IMG/M |
| 3300015165|Ga0167628_1064346 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 718 | Open in IMG/M |
| 3300015262|Ga0182007_10145913 | Not Available | 802 | Open in IMG/M |
| 3300015371|Ga0132258_11508008 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1698 | Open in IMG/M |
| 3300015372|Ga0132256_100179626 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2150 | Open in IMG/M |
| 3300015372|Ga0132256_100613884 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1202 | Open in IMG/M |
| 3300015372|Ga0132256_101238067 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 860 | Open in IMG/M |
| 3300015373|Ga0132257_101240004 | All Organisms → cellular organisms → Bacteria | 945 | Open in IMG/M |
| 3300015373|Ga0132257_102596609 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 659 | Open in IMG/M |
| 3300015373|Ga0132257_104066135 | Not Available | 532 | Open in IMG/M |
| 3300015374|Ga0132255_103357216 | Not Available | 682 | Open in IMG/M |
| 3300015374|Ga0132255_105632945 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 530 | Open in IMG/M |
| 3300017695|Ga0180121_10018747 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2453 | Open in IMG/M |
| 3300017787|Ga0183260_10250535 | All Organisms → cellular organisms → Bacteria | 1222 | Open in IMG/M |
| 3300017947|Ga0187785_10685020 | Not Available | 537 | Open in IMG/M |
| 3300017997|Ga0184610_1153940 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 756 | Open in IMG/M |
| 3300018028|Ga0184608_10352231 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 646 | Open in IMG/M |
| 3300018071|Ga0184618_10226335 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 787 | Open in IMG/M |
| 3300018429|Ga0190272_11433569 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 697 | Open in IMG/M |
| 3300018465|Ga0190269_11519019 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 553 | Open in IMG/M |
| 3300018482|Ga0066669_11891501 | Not Available | 555 | Open in IMG/M |
| 3300018920|Ga0190273_11813078 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 556 | Open in IMG/M |
| 3300019867|Ga0193704_1057180 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 754 | Open in IMG/M |
| 3300019875|Ga0193701_1057689 | Not Available | 778 | Open in IMG/M |
| 3300020004|Ga0193755_1058747 | Not Available | 1251 | Open in IMG/M |
| 3300020020|Ga0193738_1009055 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3290 | Open in IMG/M |
| 3300020069|Ga0197907_10894800 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 541 | Open in IMG/M |
| 3300021510|Ga0222621_1110085 | Not Available | 585 | Open in IMG/M |
| 3300022898|Ga0247745_1081557 | Not Available | 543 | Open in IMG/M |
| 3300022915|Ga0247790_10155499 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 590 | Open in IMG/M |
| 3300024288|Ga0179589_10514880 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
| 3300025898|Ga0207692_10524367 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 754 | Open in IMG/M |
| 3300025906|Ga0207699_11420822 | Not Available | 513 | Open in IMG/M |
| 3300025907|Ga0207645_11070518 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 544 | Open in IMG/M |
| 3300025911|Ga0207654_11432393 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 504 | Open in IMG/M |
| 3300025912|Ga0207707_11064836 | Not Available | 661 | Open in IMG/M |
| 3300025919|Ga0207657_11469602 | Not Available | 510 | Open in IMG/M |
| 3300025924|Ga0207694_11221322 | All Organisms → cellular organisms → Bacteria | 636 | Open in IMG/M |
| 3300025927|Ga0207687_11550681 | Not Available | 569 | Open in IMG/M |
| 3300025928|Ga0207700_10735102 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 882 | Open in IMG/M |
| 3300025931|Ga0207644_11539103 | Not Available | 558 | Open in IMG/M |
| 3300025932|Ga0207690_11326585 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 601 | Open in IMG/M |
| 3300025935|Ga0207709_11387278 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
| 3300025935|Ga0207709_11488175 | Not Available | 562 | Open in IMG/M |
| 3300025960|Ga0207651_11361999 | All Organisms → cellular organisms → Bacteria | 638 | Open in IMG/M |
| 3300025972|Ga0207668_11668871 | Not Available | 575 | Open in IMG/M |
| 3300026023|Ga0207677_10011077 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5125 | Open in IMG/M |
| 3300026067|Ga0207678_10971534 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 751 | Open in IMG/M |
| 3300026078|Ga0207702_11045925 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 810 | Open in IMG/M |
| 3300026078|Ga0207702_12006346 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 569 | Open in IMG/M |
| 3300026109|Ga0208774_1032769 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 804 | Open in IMG/M |
| 3300026121|Ga0207683_11769847 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| 3300026312|Ga0209153_1029423 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 1866 | Open in IMG/M |
| 3300026312|Ga0209153_1268771 | Not Available | 546 | Open in IMG/M |
| 3300026378|Ga0247712_1019724 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 662 | Open in IMG/M |
| 3300026494|Ga0257159_1065614 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 623 | Open in IMG/M |
| 3300027050|Ga0209325_1026898 | Not Available | 682 | Open in IMG/M |
| 3300027821|Ga0209811_10046470 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1476 | Open in IMG/M |
| 3300027882|Ga0209590_10112300 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 1645 | Open in IMG/M |
| 3300027907|Ga0207428_10431780 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 962 | Open in IMG/M |
| 3300028146|Ga0247682_1014379 | All Organisms → cellular organisms → Bacteria | 1373 | Open in IMG/M |
| 3300028563|Ga0265319_1128060 | Not Available | 790 | Open in IMG/M |
| 3300028596|Ga0247821_11040444 | Not Available | 550 | Open in IMG/M |
| 3300028704|Ga0307321_1114669 | Not Available | 555 | Open in IMG/M |
| 3300028714|Ga0307309_10134664 | Not Available | 615 | Open in IMG/M |
| 3300028716|Ga0307311_10049557 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1114 | Open in IMG/M |
| 3300028721|Ga0307315_10062417 | Not Available | 1054 | Open in IMG/M |
| 3300028744|Ga0307318_10157229 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 781 | Open in IMG/M |
| 3300028771|Ga0307320_10264702 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 679 | Open in IMG/M |
| 3300028778|Ga0307288_10311443 | All Organisms → cellular organisms → Bacteria | 628 | Open in IMG/M |
| 3300028784|Ga0307282_10127927 | Not Available | 1193 | Open in IMG/M |
| 3300028784|Ga0307282_10291530 | All Organisms → cellular organisms → Bacteria | 786 | Open in IMG/M |
| 3300028791|Ga0307290_10001417 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 7713 | Open in IMG/M |
| 3300028791|Ga0307290_10100806 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1052 | Open in IMG/M |
| 3300028796|Ga0307287_10128919 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 959 | Open in IMG/M |
| 3300028802|Ga0307503_10371411 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 739 | Open in IMG/M |
| 3300028807|Ga0307305_10185337 | Not Available | 958 | Open in IMG/M |
| 3300028810|Ga0307294_10157937 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 760 | Open in IMG/M |
| 3300028811|Ga0307292_10086208 | Not Available | 1220 | Open in IMG/M |
| 3300028811|Ga0307292_10114458 | Not Available | 1070 | Open in IMG/M |
| 3300028812|Ga0247825_10657048 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 753 | Open in IMG/M |
| 3300028824|Ga0307310_10332699 | Not Available | 744 | Open in IMG/M |
| 3300028824|Ga0307310_10499909 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 612 | Open in IMG/M |
| 3300028824|Ga0307310_10601925 | Not Available | 560 | Open in IMG/M |
| 3300028872|Ga0307314_10158791 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 658 | Open in IMG/M |
| 3300028875|Ga0307289_10107118 | Not Available | 1142 | Open in IMG/M |
| 3300028875|Ga0307289_10252423 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 726 | Open in IMG/M |
| 3300028875|Ga0307289_10274158 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 694 | Open in IMG/M |
| 3300028878|Ga0307278_10190111 | Not Available | 916 | Open in IMG/M |
| 3300028878|Ga0307278_10372754 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 628 | Open in IMG/M |
| 3300028880|Ga0307300_10216684 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 625 | Open in IMG/M |
| 3300028881|Ga0307277_10004727 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5227 | Open in IMG/M |
| 3300028881|Ga0307277_10008420 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 3965 | Open in IMG/M |
| 3300028885|Ga0307304_10094462 | Not Available | 1185 | Open in IMG/M |
| 3300028885|Ga0307304_10151821 | Not Available | 966 | Open in IMG/M |
| 3300028889|Ga0247827_10156085 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1218 | Open in IMG/M |
| 3300031200|Ga0307496_10084189 | Not Available | 596 | Open in IMG/M |
| 3300031562|Ga0310886_10869108 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 572 | Open in IMG/M |
| 3300031682|Ga0318560_10806494 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 507 | Open in IMG/M |
| 3300031716|Ga0310813_11382466 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 653 | Open in IMG/M |
| 3300031723|Ga0318493_10589425 | Not Available | 619 | Open in IMG/M |
| 3300031731|Ga0307405_11685088 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 561 | Open in IMG/M |
| 3300031740|Ga0307468_100890847 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 770 | Open in IMG/M |
| 3300031765|Ga0318554_10865791 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 504 | Open in IMG/M |
| 3300031770|Ga0318521_10801637 | Not Available | 574 | Open in IMG/M |
| 3300031852|Ga0307410_10677346 | Not Available | 867 | Open in IMG/M |
| 3300031896|Ga0318551_10351349 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 834 | Open in IMG/M |
| 3300031938|Ga0308175_101276751 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 817 | Open in IMG/M |
| 3300031939|Ga0308174_11224858 | Not Available | 641 | Open in IMG/M |
| 3300031995|Ga0307409_100801894 | All Organisms → cellular organisms → Bacteria | 949 | Open in IMG/M |
| 3300031996|Ga0308176_12185394 | Not Available | 591 | Open in IMG/M |
| 3300031996|Ga0308176_12798116 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300032013|Ga0310906_10263855 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1082 | Open in IMG/M |
| 3300032039|Ga0318559_10552884 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 537 | Open in IMG/M |
| 3300032089|Ga0318525_10409201 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 695 | Open in IMG/M |
| 3300032090|Ga0318518_10503451 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 620 | Open in IMG/M |
| 3300032126|Ga0307415_100206242 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 1564 | Open in IMG/M |
| 3300032174|Ga0307470_11012070 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 662 | Open in IMG/M |
| 3300032180|Ga0307471_101636170 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 799 | Open in IMG/M |
| 3300032205|Ga0307472_100308006 | All Organisms → cellular organisms → Bacteria | 1277 | Open in IMG/M |
| 3300032782|Ga0335082_11680888 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 509 | Open in IMG/M |
| 3300032829|Ga0335070_10427249 | All Organisms → cellular organisms → Bacteria | 1264 | Open in IMG/M |
| 3300032955|Ga0335076_11569298 | Not Available | 546 | Open in IMG/M |
| 3300033550|Ga0247829_10276405 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1358 | Open in IMG/M |
| 3300033550|Ga0247829_10460404 | Not Available | 1051 | Open in IMG/M |
| 3300033551|Ga0247830_11526116 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 534 | Open in IMG/M |
| 3300034176|Ga0364931_0320560 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 516 | Open in IMG/M |
| 3300034257|Ga0370495_0324101 | Not Available | 514 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 22.58% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.65% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.24% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 4.84% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 4.84% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.03% |
| Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 3.23% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.82% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.42% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.42% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.42% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.42% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 2.02% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 1.61% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.61% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.61% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.61% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.61% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.61% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.61% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.21% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 1.21% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.21% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.21% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.21% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.21% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 1.21% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.81% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.81% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.81% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.81% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.81% |
| Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 0.81% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.40% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.40% |
| Sediment | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Sediment | 0.40% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.40% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.40% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.40% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.40% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil | 0.40% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.40% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.40% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.40% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.40% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.40% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.40% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.40% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.40% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.40% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.40% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.40% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.40% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.40% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.40% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2140918025 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Bog Site B3 | Environmental | Open in IMG/M |
| 2170459017 | Litter degradation ZMR4 | Engineered | Open in IMG/M |
| 2170459021 | Litter degradation NP4 | Engineered | Open in IMG/M |
| 3300000887 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A3-65cm-16A)- 1 week illumina | Environmental | Open in IMG/M |
| 3300001334 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A21-65cm)- 6 month illumina | Environmental | Open in IMG/M |
| 3300001686 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
| 3300003992 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleB_D1 | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
| 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Host-Associated | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006058 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Host-Associated | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006578 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300006894 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control | Environmental | Open in IMG/M |
| 3300006918 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 | Environmental | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009817 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_10_20 | Environmental | Open in IMG/M |
| 3300010040 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55 | Environmental | Open in IMG/M |
| 3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
| 3300010154 | Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010321 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015 | Environmental | Open in IMG/M |
| 3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010937 | Fumarole sediment microbial communities, Furnas, Sao Miguel, Azores. Combined Assembly of Gp0156138, Gp0156139 | Environmental | Open in IMG/M |
| 3300012008 | Permafrost microbial communities from Nunavut, Canada - A39_80cm_12M | Environmental | Open in IMG/M |
| 3300012043 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ601 (22.06) | Environmental | Open in IMG/M |
| 3300012093 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ611 (21.06) | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012530 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ85 (21.06) | Environmental | Open in IMG/M |
| 3300012531 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ864 (21.06) | Environmental | Open in IMG/M |
| 3300012680 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ224A (23.06) | Environmental | Open in IMG/M |
| 3300012682 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ223 (23.06) | Environmental | Open in IMG/M |
| 3300012891 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S148-409B-2 | Environmental | Open in IMG/M |
| 3300012893 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S059-202B-1 | Environmental | Open in IMG/M |
| 3300012912 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S163-409C-2 | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
| 3300014488 | Bulk soil microbial communities from Mexico - San Felipe (SF) metaG | Environmental | Open in IMG/M |
| 3300015077 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2) | Environmental | Open in IMG/M |
| 3300015165 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G3A, Proglacial river margin, by glacier terminus) | Environmental | Open in IMG/M |
| 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Host-Associated | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300017695 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ540 (21.06) (version 2) | Environmental | Open in IMG/M |
| 3300017787 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ497 (22.06) (version 2) | Environmental | Open in IMG/M |
| 3300017947 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG | Environmental | Open in IMG/M |
| 3300017997 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coex | Environmental | Open in IMG/M |
| 3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
| 3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
| 3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
| 3300018465 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 IS | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300018920 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 IS | Environmental | Open in IMG/M |
| 3300019867 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3m1 | Environmental | Open in IMG/M |
| 3300019875 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3s2 | Environmental | Open in IMG/M |
| 3300020004 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2 | Environmental | Open in IMG/M |
| 3300020020 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2a1 | Environmental | Open in IMG/M |
| 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300021510 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_coex | Environmental | Open in IMG/M |
| 3300022898 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S109-311C-5 | Environmental | Open in IMG/M |
| 3300022915 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S171-409R-4 | Environmental | Open in IMG/M |
| 3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026109 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_80N_405 (SPAdes) | Environmental | Open in IMG/M |
| 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026312 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 (SPAdes) | Environmental | Open in IMG/M |
| 3300026378 | Soil microbial communities from hillslope of Landscape Evolution Observatory, University of Arizona, Oracle, AZ, United States - 4-4-E_D | Environmental | Open in IMG/M |
| 3300026494 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-07-A | Environmental | Open in IMG/M |
| 3300027050 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027821 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028146 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK23 | Environmental | Open in IMG/M |
| 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Host-Associated | Open in IMG/M |
| 3300028596 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glycerol_Day14 | Environmental | Open in IMG/M |
| 3300028704 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_379 | Environmental | Open in IMG/M |
| 3300028714 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_196 | Environmental | Open in IMG/M |
| 3300028716 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_198 | Environmental | Open in IMG/M |
| 3300028721 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_355 | Environmental | Open in IMG/M |
| 3300028744 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_367 | Environmental | Open in IMG/M |
| 3300028771 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_369 | Environmental | Open in IMG/M |
| 3300028778 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_142 | Environmental | Open in IMG/M |
| 3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
| 3300028791 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_144 | Environmental | Open in IMG/M |
| 3300028796 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_141 | Environmental | Open in IMG/M |
| 3300028802 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_S | Environmental | Open in IMG/M |
| 3300028807 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186 | Environmental | Open in IMG/M |
| 3300028810 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_151 | Environmental | Open in IMG/M |
| 3300028811 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149 | Environmental | Open in IMG/M |
| 3300028812 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Vanillin_Day48 | Environmental | Open in IMG/M |
| 3300028824 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197 | Environmental | Open in IMG/M |
| 3300028872 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_204 | Environmental | Open in IMG/M |
| 3300028875 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143 | Environmental | Open in IMG/M |
| 3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
| 3300028880 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_181 | Environmental | Open in IMG/M |
| 3300028881 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116 | Environmental | Open in IMG/M |
| 3300028885 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185 | Environmental | Open in IMG/M |
| 3300028889 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day2 | Environmental | Open in IMG/M |
| 3300031200 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 9_S | Environmental | Open in IMG/M |
| 3300031562 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
| 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Host-Associated | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Host-Associated | Open in IMG/M |
| 3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| 3300031939 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2 | Environmental | Open in IMG/M |
| 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Host-Associated | Open in IMG/M |
| 3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
| 3300032013 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3 | Environmental | Open in IMG/M |
| 3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
| 3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
| 3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
| 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Host-Associated | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300033550 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4 | Environmental | Open in IMG/M |
| 3300033551 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5 | Environmental | Open in IMG/M |
| 3300034176 | Sediment microbial communities from East River floodplain, Colorado, United States - 21_j17 | Environmental | Open in IMG/M |
| 3300034257 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_02D_17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| b3_nosca_v_01923180 | 2140918025 | Soil | MPERLRVWLERGESGYWLRDAATGEALRWNDGPLRVVKLAGS |
| 4ZMR_00938590 | 2170459017 | Switchgrass, Maize And Mischanthus Litter | VSERLRVLLERGRAGFYLRDAATGESIRWEDPRVRVVAVAGVSFRPEALDDPS |
| 4NP_02679740 | 2170459021 | Switchgrass, Maize And Mischanthus Litter | MSERLRLWLERGGSGFACARGNGEPVRWRDPRVRVVHAAGVS |
| AL16A1W_101698442 | 3300000887 | Permafrost | VAGERLRLLLERAQSGYRLRDAATGEPVRWEDPRVRVVPVAGVSYRA |
| A2165W6_11380392 | 3300001334 | Permafrost | VAGERLRLLLERAQSGYRLRDAATGEPVRWEDPRVRVVPVAGVSYRAEA |
| C688J18823_105156912 | 3300001686 | Soil | MSTRLRLWLERGESGYYLRDAESGEPVRWSDPRVRVV |
| C688J18823_110956152 | 3300001686 | Soil | LSERFRLWLERTRDGXRLRDAATEEFVRHEDPRIRVIKLAGVSYRL |
| Ga0055470_102423011 | 3300003992 | Natural And Restored Wetlands | VSERLRLWLERDRRGAGYHLRDAATGERVGWEDPRLRVIAVAGVSFRPEA |
| Ga0062589_1010297412 | 3300004156 | Soil | VTERLRLWLERGANGFRLRDAATGEPVRWEDPRIRVVAAAGVT |
| Ga0062589_1013027822 | 3300004156 | Soil | VSGERLRLWLERAERGYRLRDAATGEPVRWEDPRIRVVPAAGVSYRLE |
| Ga0062590_1003400503 | 3300004157 | Soil | MAERLRLWLERGAGGFYLRDAATGEPVRWEDPRVLVVPVAGVSFRPG |
| Ga0063356_1032499211 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MSERLRLWLERGAGGFYLRDAATGEPVRWEDPRIRVVPVAGVSYR |
| Ga0062595_1012586601 | 3300004479 | Soil | MAERLRLWLERGAGGYHLRDAATGERVRWEDPRLRVVAVAGVTFRPGK |
| Ga0062592_1007581901 | 3300004480 | Soil | VSERLRLLLERAGAGYRLRDAASGEVVRWEDSRVTVVPVAGVSFRIESLADPSFEP |
| Ga0062591_1007742912 | 3300004643 | Soil | VSERLRLLLERAGAGYRLRDAASGEVVRWEDSRVTVVPVAGVSFRIESLADPSFEPGRALALVPE |
| Ga0066683_107822772 | 3300005172 | Soil | MSSDRLRLWLERGGAGYQLRDAATGKPVRWEDPRLRVVPVGGVTFRPGNVDDPSFD |
| Ga0070683_1006843451 | 3300005329 | Corn Rhizosphere | VALSERLRLWLERDRRGAGYHLRDAATGERVGADDPRIRIVPVAGVSFRAE |
| Ga0066388_1032753631 | 3300005332 | Tropical Forest Soil | MTSERLRLWLERAGAGYRLRDAATGEPVRWEDPRLRVVPV |
| Ga0066388_1075867621 | 3300005332 | Tropical Forest Soil | LSSERLRLWLERAGDGYRLRDAATEELVRDDDPRVHVTKVAGVSYRLGA |
| Ga0070682_1017791161 | 3300005337 | Corn Rhizosphere | MTGERLRLWLERAGAGYRMRDAATGEPVPWEDERVLVAPVAGVSFRPD |
| Ga0070659_1004022041 | 3300005366 | Corn Rhizosphere | MSERLRLWLERDRRGAGYHLRDAASGERVGWEDSRLRVIAVA |
| Ga0070714_1013050311 | 3300005435 | Agricultural Soil | VSERLRLWLERAGAGYRMRDAATGEPVPWEDPRVRVVAVAGVSFRPGA |
| Ga0070714_1015437011 | 3300005435 | Agricultural Soil | MMAARLRLWLEPGESGYFLRDAENGEAVRWSDPRLHVVPVAGVSYRAEALP |
| Ga0070713_1009440381 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | LSSERLRLWLERGASGYHLRDAATGEPVRWEDPRLRVVGVAGVTF |
| Ga0070694_1002773623 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | MPGSSGRLRLWLERDRKGAGYHLRDAATGERVSWDDPRIRVLPVAGVSFRPDAVA |
| Ga0070708_1018551922 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MSERLRLWLERDRRGAGYHLRDASSGERVEWEDPRVRVIAVAGVSFR |
| Ga0066689_107596872 | 3300005447 | Soil | LSERLRLWLERDRRGAGYHLRDAASGEPVAWEDPRVLVVPVAGVSFRPDEAADASFDP |
| Ga0070698_1021493752 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | LPSERRLRLWLERGNSGFYLRDAESGEAVRWSDPRLRVVP |
| Ga0070699_1000833531 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MTGERLRLWLERGGAGYYLRDASTGEPVRWEDPRVRVVGVAGVTFR |
| Ga0070679_1017332162 | 3300005530 | Corn Rhizosphere | LSARLRLWLEQTRDGYRLRDAATEELVRWEDPRIRVINVAGVSYRLD |
| Ga0070697_1012857711 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | LSERLRLWLERAERGYRLRDAATGELVRWEDDRIRVVPVAGISYREEAAADASFEPGRR |
| Ga0068853_1015480441 | 3300005539 | Corn Rhizosphere | MSERLRLWLERDRRGAGYHLRDAASGERVGWEDPRLRVIAVAGVS |
| Ga0070696_1016332651 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | VSERLRVLLERGRSGFHLRDAATGEPIRWEDPRIRVVAVA |
| Ga0070704_1009910271 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | LSSERLRIWLERGGSGFFLRDAESGEPVRWSDPRVRVVPVAG |
| Ga0068855_1019703122 | 3300005563 | Corn Rhizosphere | LRSARRLSSERLRLWLERGGAGYYLRDAATGEPVRWEDP |
| Ga0070664_1017222181 | 3300005564 | Corn Rhizosphere | VSERLRLWLERGRDGYYLRDAATGQPVRWEDPRIRVVAAAGVTFRPE |
| Ga0066903_1010843941 | 3300005764 | Tropical Forest Soil | VSERLRLWLERAGSGYRMRDAATGEPVPWEDSRVLV |
| Ga0066903_1057958451 | 3300005764 | Tropical Forest Soil | MMATRLRLWLERGEAGYYLRDAESGEAVRWSDPRLRVVPVAGVSYRAEALPDSSFDPG |
| Ga0081538_102711432 | 3300005981 | Tabebuia Heterophylla Rhizosphere | VTERLRLWLERGASGYYLRDAATGDPVRWEDERIRVVPAAGVSF |
| Ga0070717_112800922 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | LSSERLRLWLERGAAGYHLRDAATGEPVRWNDPRVRVIPVAGVSYRAEALPDSSFDPGQK |
| Ga0066652_1016264911 | 3300006046 | Soil | LNDRVRLWLERTRDGYRLRDAATEEVVRYEDPRVRVIKLAGVSYRL |
| Ga0075432_102000892 | 3300006058 | Populus Rhizosphere | MTGERLRLWLERGASGYYLRDAASGEPVRWEDPRLRVVGVAGVTFRPG |
| Ga0070716_1003258272 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MTGERLRLWLERAGAGYRMRDAATGEPVPWEDERVFVAPVAGVSFRPDAVDDASFDPG |
| Ga0074059_118791721 | 3300006578 | Soil | VLERAGSGYRLRDAATDEVVRWEDPRILVVPVAGVSFR |
| Ga0079222_120977601 | 3300006755 | Agricultural Soil | MPSVGSSPERLRLWLERSRDGAGYHLRDAATGEPVRADDPRLAVVAVAGVSFREEAV |
| Ga0066660_101653851 | 3300006800 | Soil | MPSGSSSRSERVRLWLERARHGYRLRDAATEEPVRDDDPR |
| Ga0079221_105787832 | 3300006804 | Agricultural Soil | MTGERLRLWLERGASGYHLRDAASGEPVRWEDPRLRVVGVAGVTFRPGNVDD |
| Ga0075428_1023839481 | 3300006844 | Populus Rhizosphere | VTERLRLWFERGPSGYYLRDAATGNPVRWEDERIRVVPAAGVTYR |
| Ga0075428_1026779311 | 3300006844 | Populus Rhizosphere | LSERLRLWFERGPSGYYLRDAATGNPVRWEDERIRVVPAAGVTYR |
| Ga0075421_1014868001 | 3300006845 | Populus Rhizosphere | LSERLRLWFERGPSGYYLRDAATGNPVRWEDERIRVVPA |
| Ga0075421_1027875761 | 3300006845 | Populus Rhizosphere | LSERLRLLLERAQFGYRLRDAATGEVVRWEDARVLVIPVAGVSFRPES |
| Ga0075425_1012447331 | 3300006854 | Populus Rhizosphere | VSERIRLWLERAPSGFYLRDAATNERVRWEDERIRVVHV |
| Ga0068865_1007375382 | 3300006881 | Miscanthus Rhizosphere | VNERLRLWLERGRDGFHLRDAATDEPVRWEDPRIRVVAAAGVSYRAEAL |
| Ga0079215_103390322 | 3300006894 | Agricultural Soil | VSERLRLILERAPSGYRLRDAATGEAVRWEDPRIRVVAVA |
| Ga0079215_105874721 | 3300006894 | Agricultural Soil | VRLRLLLERAQSGYRIRDAATGEVVRWEDPRIRVVP |
| Ga0079216_108922452 | 3300006918 | Agricultural Soil | VAAERLRLWFERGGNGYFLRDAATGERVRWEDPRIRVVPVAGVSYRAE |
| Ga0079218_126884662 | 3300007004 | Agricultural Soil | VSERLRLWLERGTAGYRLRDAATGELVRWEDPRIRVVPAAGVTYRPE |
| Ga0099828_100472885 | 3300009089 | Vadose Zone Soil | VGERLRLWLERGESGYYLRDAATGDTVRWSDPRIRVVPVAGVSFRADAL |
| Ga0099827_101787411 | 3300009090 | Vadose Zone Soil | LSPVGERLRLWLERASGGYRLRDAATGEPVRWEDERIRVVHVAGVSYRPDALADPS |
| Ga0111539_109712361 | 3300009094 | Populus Rhizosphere | VTERLRLWFERGPSGYYLRDAATGNPVRWEDERIRVVPAAGVTYRA |
| Ga0111539_129441321 | 3300009094 | Populus Rhizosphere | VSERLRLWLEHGERGYRLRDAASGEPVRWEDPRLR |
| Ga0105245_125559741 | 3300009098 | Miscanthus Rhizosphere | VSERLRLWLERDRRGAGYHLRDAATGERVSREDERIRVVPVAGVSFRAEAV |
| Ga0075418_120222672 | 3300009100 | Populus Rhizosphere | VSERLRLILERGQGGYYMRDAATGEPVRWEDPRVSVLPVAGVS |
| Ga0075418_128343951 | 3300009100 | Populus Rhizosphere | VVVSERLRLWLERGESGFYLRDAASGEQVRWSDPRVRVVDVAGVTF |
| Ga0114129_117913712 | 3300009147 | Populus Rhizosphere | LTERLRLLLERARSGFRLRDAATGELVRWEDPRILVIPVAGVSFRPESLED |
| Ga0105241_106446382 | 3300009174 | Corn Rhizosphere | VSDRLRLWLERDRRGAGYHLRDAANGEAVSWDDPRIRVIAVAGVS |
| Ga0105062_10787041 | 3300009817 | Groundwater Sand | MSERATGERLRIWFERSGDGFRLRDAATGQPIRYED |
| Ga0126308_101114461 | 3300010040 | Serpentine Soil | VSERLRLILERAQSGYRLRDAATGELVRWEDPRNRVAAV |
| Ga0126308_104841531 | 3300010040 | Serpentine Soil | MTERLRLILERAQSGYRLRDAATGELVRWEDPRIRVVAVA |
| Ga0126312_100103518 | 3300010041 | Serpentine Soil | MVVSERLRLWLERAPSGFYLRDAATGEPVRWEDERIRVVHVAGVSFRPEALDN |
| Ga0126312_108101241 | 3300010041 | Serpentine Soil | MERGNAGYHLRDAETGERVAWEDTRIRVVPVAGVS |
| Ga0127503_111012791 | 3300010154 | Soil | MSERRTNERVRLWLERSGPGFRLRDAATGELVRREDPR |
| Ga0134070_104187572 | 3300010301 | Grasslands Soil | VTERLRLWLERGDGGYFLRDAATEEPVRWEDPRLRVIRVAGTTYRADALQDDG |
| Ga0134067_101641721 | 3300010321 | Grasslands Soil | MPPAGERLRLWLERTGSGYRLRDAATDEVLRWEDP |
| Ga0134084_104427222 | 3300010322 | Grasslands Soil | MPPGDSSPSERLRLWLERGASGFYLRDAATGEPVRRSDPRVRVVPVAGVSYR |
| Ga0134086_101953872 | 3300010323 | Grasslands Soil | MAERQTNERVRLWFERSGSGFRLRDAATGELVRGE |
| Ga0126377_100422271 | 3300010362 | Tropical Forest Soil | VSERLRLILERAHSGYRLRDAATGEVVAWEDPRILVLP |
| Ga0134128_103188013 | 3300010373 | Terrestrial Soil | LSERLRLLLERAQSGYRLRDAATGEVVRWEDERVRVLPVAGVSFRPEAVEDPSFEPGLPLAL |
| Ga0134124_131969471 | 3300010397 | Terrestrial Soil | VSERLRLWLERGDSGYWLRDAATSAAVRWDDDRLLVVPVAGA |
| Ga0137776_11097331 | 3300010937 | Sediment | RLWLEKARGGGYRLRDAATGEEVRWEDPRIRVVPVAASRSR* |
| Ga0120174_10642011 | 3300012008 | Permafrost | MPGNSERVRIWLERDRDGAGYHLRDAATGDRVSWEDPRIRVV |
| Ga0136631_103188111 | 3300012043 | Polar Desert Sand | VTDERLRLWLERADAGFRLRDAASGDRVAWEDPRIRVVPVAGVSYRAEAAADPSFD |
| Ga0136632_100497433 | 3300012093 | Polar Desert Sand | MAERLRLWLEQGERGYHLRDAATGDPVRWEDPRIRVIPVAGVSYRPEVLD |
| Ga0137388_105544051 | 3300012189 | Vadose Zone Soil | LWLERGESGYWLRDAASGEAVRWDDERLRVVKLAGA |
| Ga0137388_106424802 | 3300012189 | Vadose Zone Soil | MSERRTDERLRLWLEPSGAGFRLRDAATGELVRGEDPRIRVIKVAGVS* |
| Ga0137383_106762821 | 3300012199 | Vadose Zone Soil | VPPEEARRLRIWLERGESGYWLRDAASGAALKWDDERLRVVKVAG |
| Ga0137383_110702992 | 3300012199 | Vadose Zone Soil | MSSDRLRLWLERGGAGYYLRDAATGEPVRWDDPRLRVVPIAGVTFRPGNV |
| Ga0137383_112845051 | 3300012199 | Vadose Zone Soil | MSERRTSERLRLWLERSGAGFRLRDAATGQLVRGEDPRLRVIKVAGVSYRI |
| Ga0137382_104470192 | 3300012200 | Vadose Zone Soil | LRLWLERSGAGFRLRDAATGELVRGEDPRIRVIKVA |
| Ga0137384_111757861 | 3300012357 | Vadose Zone Soil | MSERLRLWLERGAAGYHLRDAATGAPVAWEDARLRVVAVAGVTFRPGNVDDASFD |
| Ga0137385_103535183 | 3300012359 | Vadose Zone Soil | MSSDRLRLWLERAGAGYRLRDAATGAPVRWEDPRLRVVPV |
| Ga0136635_100367973 | 3300012530 | Polar Desert Sand | MSERLRLWLEPGERGFHPRDASTGEPVRWQDPRIRVVPVAGVSYRAR* |
| Ga0136640_101473343 | 3300012531 | Polar Desert Sand | VTGERLRLWLERADAGFRLRDAATDERVAWEDLRIRVVPVAGVSYRAEAAADLSF |
| Ga0136612_103023812 | 3300012680 | Polar Desert Sand | MSERLRLWLEPGERGFHLRDASTGEPVRWQDPRIRVVPVAGVSYRAR* |
| Ga0136611_101731673 | 3300012682 | Polar Desert Sand | VSERLRLWLERGERGYRLRDASTGELVRWEDPRIRVVPAAGVS |
| Ga0157305_102090281 | 3300012891 | Soil | LSSERLRLWLERGGAGYYLRDAATGEPVRWEDPRLWVVPVAGVTFRPGNVDDAS |
| Ga0157284_101590902 | 3300012893 | Soil | LSERLRLLLERAQSGYRLRDAATGEVVRWEDERVRVLPVAGV |
| Ga0157306_102773291 | 3300012912 | Soil | VSERLRLILERATNGYRLRDAASGEPVRWEDPRIRVVPAAGVSYRAEVL |
| Ga0137394_102515941 | 3300012922 | Vadose Zone Soil | MSERQTNERLRLWLERAGAGFRLRDAATGELVRGEDPRISVIKV |
| Ga0137416_104367031 | 3300012927 | Vadose Zone Soil | LAVTRLRLWLERDRRGAGYHLRDAATGERVSWDDPRVRVVPVAGVSFRPDAVADGTFDPGERLA |
| Ga0126375_119063312 | 3300012948 | Tropical Forest Soil | VSERLRLWLERAQGGFYLRDAATNERVRWEDERIRVVHVAGISYRP |
| Ga0164300_111841821 | 3300012951 | Soil | LSDRLRLWLERGVGGFHLRDAASGERVAWEDPRILV |
| Ga0164303_106200032 | 3300012957 | Soil | VSDRLRLWLERDRRGAGYHLRDAATGERVSWEDERIRVVPVAGVS |
| Ga0164299_112274531 | 3300012958 | Soil | VALSERLRLWLERDRRGAGYHLRDAATGERVSWEDE |
| Ga0164301_116183391 | 3300012960 | Soil | VSDRLRLWLERDRRGAGFHLRDAATGERVEWEDPRLLVVPVAGVSFRPDAVRDASFDP |
| Ga0164302_114030072 | 3300012961 | Soil | VSERLRLWREPDRRGAGYHLRDAATGERVSREDERIRVVPVAGVSFRA |
| Ga0134077_102560521 | 3300012972 | Grasslands Soil | MSSKGGERLRLWLERGAAGYHLRDAATGEPVRWEDPRLRVVPVAG |
| Ga0134087_102766642 | 3300012977 | Grasslands Soil | VSGERLRLWLEGSRDGRGYRLRDAATGEAVSWEDPRVRVVAVAGVSF |
| Ga0164308_114834561 | 3300012985 | Soil | VTGRLRLWLERDRRGAGYHLRDAATGDPVPWEDERIRVIAVAGVSFRPEAVA |
| Ga0164304_104570612 | 3300012986 | Soil | LWLERTRDGFRVRDAATDELVRWEDERIRVIPVAGVSYRLETLQD |
| Ga0164304_110197382 | 3300012986 | Soil | VTERLRLWLERDRRGAGYHLRDAATGERVTWEDERIRVVPVAGVSFRPDAVADAAFDPGARLALVA |
| Ga0164307_112283031 | 3300012987 | Soil | LLERALSGYRLRDAATGEVVHWEDPRILVVAAAGV |
| Ga0164305_121763092 | 3300012989 | Soil | LSERLRLWLERTRDGYRLRDAATEEYVPYEDPRIRVIKVAGVSYRLD |
| Ga0157369_124908741 | 3300013105 | Corn Rhizosphere | MAERLRLWLERSYDGRGYRLRDAATGEPVAWEDPRIRVLPVAG |
| Ga0157378_121354571 | 3300013297 | Miscanthus Rhizosphere | VSERLRLILERAPSGYRLRDAATGEPVRWEDPRIRVVPA |
| Ga0157372_113484452 | 3300013307 | Corn Rhizosphere | LRLWLERTRDGYRLRDAATDELVRTDDPRIRVIRVAGVSYRLDAL |
| Ga0157372_122390792 | 3300013307 | Corn Rhizosphere | MSERLRLWLERDRRGAGYHLRDAATGERVGWEDPRLRVVAVAGVSFRPEAVGDSSF |
| Ga0134079_103499521 | 3300014166 | Grasslands Soil | VSDRLRLWLERAGAGVRMRDAATGELVAWEDERVRV |
| Ga0182001_102905032 | 3300014488 | Soil | VAERLRLWLERAEGGYRLRDAATGEPVRWEDPRLRVVPVAG |
| Ga0173483_105321841 | 3300015077 | Soil | VSERLRLILERATSGYRLRDAATGEPVRWADPRIR |
| Ga0173483_105597051 | 3300015077 | Soil | LRLWLERAGSGYRLRDAATEQVVREDDPRIHVIPVAGVSYRMDDV |
| Ga0167628_10643461 | 3300015165 | Glacier Forefield Soil | MTERLRVWLERDHRGAGYHLRDAATGERVAWEDPRVRVAPVAGVSFRPE |
| Ga0182007_101459131 | 3300015262 | Rhizosphere | VSERLRLWLERDRRGAGYHLRDAASGERVEWEDTRLRVIAVAGVSL |
| Ga0132258_115080083 | 3300015371 | Arabidopsis Rhizosphere | LSDRLRLWLERGVGGFHLRDAASGERVAWEDPRILVVAAAGVS |
| Ga0132256_1001796263 | 3300015372 | Arabidopsis Rhizosphere | VSERLRLWLERAPSGFYLRDAATNERVRWEDERIRVVHVAGISYRPEALE |
| Ga0132256_1006138841 | 3300015372 | Arabidopsis Rhizosphere | VVVSERLRLWLERGESGFYLRDAASGEPVRWSDPRVRVVSVAGVTFRPGARF |
| Ga0132256_1012380671 | 3300015372 | Arabidopsis Rhizosphere | VSDRLRLGLERDRRGAGYHLRDAANGEAVSWDDPRIRVIAVAGVSFRPEAVAD |
| Ga0132257_1012400041 | 3300015373 | Arabidopsis Rhizosphere | VSERLRLWLERGDRGYHLRDAATGDPVRWEDPRLRVVPAAGVSYRPDA |
| Ga0132257_1025966092 | 3300015373 | Arabidopsis Rhizosphere | VSERLRLWLERGANGYRLRDAATGEPVQWEDPRIRVVAAAGVTYRPE |
| Ga0132257_1040661352 | 3300015373 | Arabidopsis Rhizosphere | LWLERGGSGFHLRDAATDEPVRWSDPRVRVVHVAGVSFREDALPELS |
| Ga0132255_1033572161 | 3300015374 | Arabidopsis Rhizosphere | LSERLRLLLERAQSGYRLRDAATGEVVRWEDERVRVLP |
| Ga0132255_1056329451 | 3300015374 | Arabidopsis Rhizosphere | VSERLRLWLERDRRGAGYHLRDAATGEPGSWEDERIRVVPVAGVSFRADAVADGSFDPGARLALVP |
| Ga0180121_100187472 | 3300017695 | Polar Desert Sand | MSERLRLWLEPGERGFHLRDASTGEPVRWQDPRIRVVPVAGVSYRAR |
| Ga0183260_102505353 | 3300017787 | Polar Desert Sand | VTGERLRLWLERADAGFRLRDAATDERVAWEDLRIRVVPVAGVSYRAEAAADLSFDPGLRVALVAEPDNEHDQ |
| Ga0187785_106850201 | 3300017947 | Tropical Peatland | VSDRLRLWLERDRRGAGYHLRDAATGERVAWEDPRIHVVPVAGVSFRAEAVADSSFDP |
| Ga0184610_11539402 | 3300017997 | Groundwater Sediment | VSERLRLWLERAERGYRLRDAATGEPVRWEDPRIRV |
| Ga0184608_103522312 | 3300018028 | Groundwater Sediment | VSERLRLWFDRGESGYHLRDAATGEPVRWEDERIRVVPAAGVSYRPEALPDP |
| Ga0184618_102263351 | 3300018071 | Groundwater Sediment | MSERQTNERLRLWLERSGAGFRLRDAATGELVRGEDPRIRVIKVAG |
| Ga0190272_114335691 | 3300018429 | Soil | LRLWLERAGSGYRLRDAATEQFVREDDPRIHVVPVAGVSYRMDEVQAEG |
| Ga0190269_115190191 | 3300018465 | Soil | MSERQTNERLRLWLERSGAGFRLRDAATGELVRGEDPRIRVIKV |
| Ga0066669_118915011 | 3300018482 | Grasslands Soil | MQYGASSSSERVRLWLERRGTGYVLRDAATYEEVREDDPRIRIVN |
| Ga0190273_118130782 | 3300018920 | Soil | VSERLRLWLERAERGYRLRDAATGDPVRWEDPRIRVIAAAGVTF |
| Ga0193704_10571801 | 3300019867 | Soil | MSERLRLILERAHSGYRLRDAATGEPVRWEDPRIRVVPAAGVSY |
| Ga0193701_10576891 | 3300019875 | Soil | LRLWLERARDGYRLRDAATDELVRTDDPRIRVIKVAGV |
| Ga0193755_10587471 | 3300020004 | Soil | MAERLRLWLERGRAGYYLRDAATGERVRWEDPRLRVVAIAGVTF |
| Ga0193738_10090551 | 3300020020 | Soil | MTPAEPPRLRLWLERGPSGYYLRDAATGEPVRWGDERIRV |
| Ga0197907_108948001 | 3300020069 | Corn, Switchgrass And Miscanthus Rhizosphere | VSERLRLWLERDRRGAGYHLRDAASGERVGWEDPRVRVIAVAG |
| Ga0222621_11100851 | 3300021510 | Groundwater Sediment | MSERQTNERLRLWLERSGAGFRLRDAATGELVRGEDPR |
| Ga0247745_10815571 | 3300022898 | Soil | VSERLRLWLERGERGFHLRDAATGEPVRWEDPRLRVVPVAGVS |
| Ga0247790_101554992 | 3300022915 | Soil | VSGERLRLWLERAERGYRLRDAATGEPVRWEDPRIRV |
| Ga0179589_105148802 | 3300024288 | Vadose Zone Soil | VTERLRLWLERDRRGAGYHLRDAATGEPVTWEDPRVRVIAVAGVSFRPEAVSDA |
| Ga0207692_105243671 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | VSERLRLWLERAGAGYRMRDAATGEPVPWEDPRVRVVAVAGVSFRPGAVEDA |
| Ga0207699_114208221 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MSDRLRLWLERDRRGAGYHLRDAATDLPVSWEDPRIVVTPVAGVSFRPEAVADRSFD |
| Ga0207645_110705181 | 3300025907 | Miscanthus Rhizosphere | MSERQTNERLRLWLERAGAGFRLRDAATGELVRGEDPRIRVIKV |
| Ga0207654_114323931 | 3300025911 | Corn Rhizosphere | VSERLRLWLERDRRGAGYHLRDAATGERVEWEDPRLRVVAVAGVSFRPGA |
| Ga0207707_110648361 | 3300025912 | Corn Rhizosphere | VSERLRLWLERDRRGAGYHLRDAASGERVGWEDPRLRVIAV |
| Ga0207657_114696021 | 3300025919 | Corn Rhizosphere | LRSARRLSSERLRLWLERGGAGYYLRDAATGEPVRWEDPRLRVVPVAGVTFRPGNVD |
| Ga0207694_112213223 | 3300025924 | Corn Rhizosphere | VSDRLRLWLEKADRGYRLRDAATGEPVRWEDPRLRVVHAAGVSYRPE |
| Ga0207687_115506812 | 3300025927 | Miscanthus Rhizosphere | MSGERLRLWLERGASGYYLRDAASGEPVRWEDPRLRVVGVAGVT |
| Ga0207700_107351022 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MAERLRLWLERGAGGYHLRDAASGERVRWEDPRLRVVAVAG |
| Ga0207644_115391031 | 3300025931 | Switchgrass Rhizosphere | MSERQTNERLRLWLERAGAGFRLRDAATGELVRGEDPRISVVKV |
| Ga0207690_113265852 | 3300025932 | Corn Rhizosphere | LSDRLRLWLERTRDGYRLRDAETEEFVRHEDPRIRVIK |
| Ga0207709_113872782 | 3300025935 | Miscanthus Rhizosphere | LERGESGYYMRDAESGEPVRWSDPRVRVVAVAGVSYRAEALRALKTLVQ |
| Ga0207709_114881752 | 3300025935 | Miscanthus Rhizosphere | LRSARRLSSERLRLWLERGGAGYYLRDAATGEPVRWEDPR |
| Ga0207651_113619991 | 3300025960 | Switchgrass Rhizosphere | VTAERLRLWLERADAGYRLRDAGTGEPVRWEDPRFRVVPVAGVSFRGDALDDPS |
| Ga0207668_116688711 | 3300025972 | Switchgrass Rhizosphere | LRSARRLSSERLRLWLERGGAGYYLRDAATGEPVRWE |
| Ga0207677_100110777 | 3300026023 | Miscanthus Rhizosphere | VSEERLRLILERANSGFFLRDAATGERVRWEDPRVRVVPVAGVS |
| Ga0207678_109715341 | 3300026067 | Corn Rhizosphere | VSERLRLWLERDRRGAGYHLRDAASGERVGWEDPRVRVIAVAGVSF |
| Ga0207702_110459252 | 3300026078 | Corn Rhizosphere | VSEERLRLVLERADSGFYLRDAATGERVRWEDPRVRVVPVAGVSYRPEAL |
| Ga0207702_120063461 | 3300026078 | Corn Rhizosphere | VSGRLRLWLERDRRGAGYHLRDAASGERVDWDDPRVRVIAVAGVSFRPEALVDSSFD |
| Ga0208774_10327691 | 3300026109 | Rice Paddy Soil | VADRLRLWLERGASGFWLRDAAGGEAVRWDDPRLRVVRLAGAS |
| Ga0207683_117698472 | 3300026121 | Miscanthus Rhizosphere | VSERLRVLLERGRSGFHLRDAATGEAIRWEDPRVRVVAV |
| Ga0209153_10294231 | 3300026312 | Soil | MQSESSSSSERLRLWLERSGHGYRLRDAATEEFVRLDDPRIRVVAVAG |
| Ga0209153_12687712 | 3300026312 | Soil | LPSERLRLWLERGASGFYLRDAATGEPVRRSDPRVRVVPVAGVSYRAEALAD |
| Ga0247712_10197241 | 3300026378 | Soil | VSRRVWLWLERGGGGYFLRDAATGEPVRWEDPRIRVVPAAGVSYRPE |
| Ga0257159_10656142 | 3300026494 | Soil | MNERLRLWLERDRRGAGYNLRDAATGERVSWEDPRIRVIPVAGVSFRPEAV |
| Ga0209325_10268982 | 3300027050 | Forest Soil | VSERLRLWLERAGAGYRMRDAATGEPVPWEDPRVRVVAVAGVSFRPGAVEEGSVGGGTGM |
| Ga0209811_100464703 | 3300027821 | Surface Soil | LSERLRLWLERDRRGAGYHLADAATGERVRWEDERIRVVPVAGVSFR |
| Ga0209590_101123003 | 3300027882 | Vadose Zone Soil | VGERLRLWLERASGGYRLRDAATGEPVRWEDERIRVVHVAGVSYRPDALADPS |
| Ga0207428_104317802 | 3300027907 | Populus Rhizosphere | VTERLRLWFERGPSGYYLRDAATGNPVRWEDERIRVVPAAGVTYRAE |
| Ga0247682_10143793 | 3300028146 | Soil | VSERLRLWLERAGAGYRMRDAATGEPVPWEDPRVRVV |
| Ga0265319_11280601 | 3300028563 | Rhizosphere | VSDRLRLWLERDRRGAGYHLRDAATGARVEWEDLRI |
| Ga0247821_110404442 | 3300028596 | Soil | LSERLRLLLERAQSGYRLRDAATGELVRWEDPRILVIPVAGVSFRPDS |
| Ga0307321_11146691 | 3300028704 | Soil | VAGERLRLLLERAESGYRLREAASGEPVRWEDPRIRVVPVAGV |
| Ga0307309_101346641 | 3300028714 | Soil | MSGRQTNERLRLWFERAGAGFRLRDAATGELVRGEDPRVRVIKV |
| Ga0307311_100495573 | 3300028716 | Soil | VSERLRLILERATDGYRLRDAATGEPVRWEDPRIRVVPAAGVSYRAEA |
| Ga0307315_100624171 | 3300028721 | Soil | MSSERLRLWLERGGAGYYLRDAATGEPVRWEDPRLRVVPVAGVT |
| Ga0307318_101572291 | 3300028744 | Soil | VSERLRLILERAHSGYRLRDAATGEPVRWEDPRIRVVPAAGV |
| Ga0307320_102647022 | 3300028771 | Soil | VSERLRLWLERAERGYHLRDAATGEPVRWEDPRIRVIAAAGVTFRPESL |
| Ga0307288_103114431 | 3300028778 | Soil | VSERLRVLLERGRSGFHLRDAATGEAIRWEDPRVRVVAVAGVSFR |
| Ga0307282_101279271 | 3300028784 | Soil | MSERQTNERLRLWLERAGAGFRLRDAATGELVRGEDPRIRV |
| Ga0307282_102915303 | 3300028784 | Soil | VSERLRLLVERARWGYRLRDAATGEVVRWEDPRILVVPVA |
| Ga0307290_100014171 | 3300028791 | Soil | MSSERLRLWLERGGAGYYLRDAATGEPVRWEDPRLR |
| Ga0307290_101008063 | 3300028791 | Soil | VSERLRLLLERAQSGYRLRDAATGDVVRWEDPRILVIPV |
| Ga0307287_101289191 | 3300028796 | Soil | VSERLRLLLERAGAGYRLRDAATGEVVRWEDPRVTVVPVA |
| Ga0307503_103714112 | 3300028802 | Soil | VSERLRLWLERAERGYHLRDAASGEPVRWEDPRIRVIAAAGVTFRPESLED |
| Ga0307305_101853372 | 3300028807 | Soil | MSERQTNERLRLWLERAGAGFRLRDAATGELVRGEDPRIRTT |
| Ga0307294_101579372 | 3300028810 | Soil | VSRERLRLILERADSGFYLRDAATGERVRWEDPRV |
| Ga0307292_100862081 | 3300028811 | Soil | MSERQTNERLRLWLERAGAGFRLRDAATGELVRGEDPRIRVIKVAGVS |
| Ga0307292_101144581 | 3300028811 | Soil | MSERQTNERLRLWLERSGAGFRLRDAATGELVRGEDPRIRV |
| Ga0247825_106570482 | 3300028812 | Soil | VSERLRLILERAHSGYRLRDAATGEPVRWEDPRIRVVPAAGVSY |
| Ga0307310_103326992 | 3300028824 | Soil | MAEGGTRARLRLWLERAGNGFRLRDAATDEIVRTEDPR |
| Ga0307310_104999091 | 3300028824 | Soil | VSERLRLLLERAGAGYRLRDAATGEVVRWEDPRVTVVPVAGVSFRIESLADPSFE |
| Ga0307310_106019251 | 3300028824 | Soil | MSERQTNERLRLWLERAGAGFRLCDAATGELVRGEDPRIRVIKVA |
| Ga0307314_101587912 | 3300028872 | Soil | VSERLRLILERAHSGYRLRDAATGEPVRWEDPRIRVVPA |
| Ga0307289_101071181 | 3300028875 | Soil | VAGERLRLLLERAQSGYYLRDAASGEHVRWEDPRIRVVPVAGVS |
| Ga0307289_102524232 | 3300028875 | Soil | VSERLRLLLERAGAGYRLRDAATGEVVRWEDPRVTVVPVAGVSFRIESL |
| Ga0307289_102741581 | 3300028875 | Soil | VSERLRLWLERAERGYHLRDAATGEPVRWEDPRIRVIAAAGVTFRPESLED |
| Ga0307278_101901111 | 3300028878 | Soil | LRLWLERARDGYRLRDAATDELVRANDPRIRVIKVAGVSY |
| Ga0307278_103727542 | 3300028878 | Soil | MSDRQTNERLRLWLERSGAGFRLRDAATGELVRGEDP |
| Ga0307300_102166842 | 3300028880 | Soil | VAGERLRLLLERAQSGYRLRDAASGEPVRWEDPRIRV |
| Ga0307277_100047277 | 3300028881 | Soil | VSGRLRLLLERAAQSGYRLRDAATGEVVRWEDPRIL |
| Ga0307277_100084201 | 3300028881 | Soil | MSERQTNERLRLWLERSGAGFRLRDAATGELVRGEDPRIRVIKVA |
| Ga0307304_100944622 | 3300028885 | Soil | MSERQTNERLRLWLERAGAGFRLRDAATGELVRGEDPRIRVIKVAGVSYR |
| Ga0307304_101518211 | 3300028885 | Soil | MSERQTNERLRLWLERSGAGFRLRDAATGELVRGEDPRIRVIKVAGVSY |
| Ga0247827_101560851 | 3300028889 | Soil | MAERLRLWLERGRDGYHLRDAATGEPVRWEDPRIRVVAAAG |
| Ga0307496_100841892 | 3300031200 | Soil | LRLWLERVRDGYRLRDAATDELVRTDDPRIRVIKVAGVSYR |
| Ga0310886_108691081 | 3300031562 | Soil | VNERLRLWLERGRDGFHLRDAATDEPVRWEDPRIR |
| Ga0318560_108064941 | 3300031682 | Soil | VSERLRLWLERARSGAGYYLRDAATGEPVREDDPRILVVPVAGVSFREEAVLD |
| Ga0310813_113824662 | 3300031716 | Soil | VTEERLRLILERAGPGFHLRDAATGEHVRWEDPRLRVVPVA |
| Ga0318493_105894252 | 3300031723 | Soil | VSGERLRLWLERAGAGVRMRDAATGEVVRWEDERIRVIPVAGVSFRPEAVGD |
| Ga0307405_116850881 | 3300031731 | Rhizosphere | VSERVRLWLERGRDGFHLRDAATGERVRWEDPRLRVV |
| Ga0307468_1008908472 | 3300031740 | Hardwood Forest Soil | MTERVRLWLERGERGYFLRDAATGEPVRWEDPRILVVPVAG |
| Ga0318554_108657911 | 3300031765 | Soil | MMAARLRLWLERGDSGYYLRDAESGEAIRWSDPRLHVVPVAGVSY |
| Ga0318521_108016372 | 3300031770 | Soil | LRLWLERGEAGYYLRDASTDEPVRWSDPRLRVIPVAGVSYRADAL |
| Ga0307410_106773462 | 3300031852 | Rhizosphere | LAPERLRLWLERGESGYYLRDAATGEAVRWSDPRIRVVAAAGVSFRP |
| Ga0318551_103513492 | 3300031896 | Soil | MMAARLRLWLERGDSGYYLRDAESGEAIRWSDPRLHVV |
| Ga0308175_1012767511 | 3300031938 | Soil | VSDRLRLILERAGSGYRLRDAATGEPVRWEDPRIRVIPAAGV |
| Ga0308174_112248582 | 3300031939 | Soil | VSERLRLWLERDRRGAGYHLRDAATGERVAWEDERIRVVAVAGVSFRP |
| Ga0307409_1008018943 | 3300031995 | Rhizosphere | VSERLRLWLERGERGYHLRDAATGEAVRWEDPRLRVVPVAG |
| Ga0308176_121853941 | 3300031996 | Soil | VSERLRLWLERDRRGAGYHLRDAASGERVPWEDERIRVVA |
| Ga0308176_127981161 | 3300031996 | Soil | MSERLRLWLERGASGFYLRDAASGEPVRRSDPRVRVVPVAG |
| Ga0310906_102638551 | 3300032013 | Soil | MTERVRLWLERGERGYFLRDAATGEPVRWEDPRILVVPVAGVSFRPGN |
| Ga0318559_105528842 | 3300032039 | Soil | VSERLRLWLERARSGAGYYLRDAATGEPVREDDPRILVVPVAGV |
| Ga0318525_104092011 | 3300032089 | Soil | VSERLRLWLERARSGAGYYLRDAATGEPVREDDPRILVVPVAGVSFREEAVLDSSFD |
| Ga0318518_105034511 | 3300032090 | Soil | VSERLRLWLERARSGAGYYLRDAATGEPVREDDPRILVVPVAGVSFREEAVLDSSFDPG |
| Ga0307415_1002062423 | 3300032126 | Rhizosphere | LAPERLRLWLERGESGYYLRDAATGEAVRWSDPRIRVVAA |
| Ga0307470_110120702 | 3300032174 | Hardwood Forest Soil | MSERLRLWLERDRRGAGYHLRDAATGEPVSWEDERIRVVPVAGVSFRPEAVADAS |
| Ga0307471_1016361701 | 3300032180 | Hardwood Forest Soil | LRLWLERARDGYRLRDAATDELVRADDPRIRVIKVAG |
| Ga0307472_1003080061 | 3300032205 | Hardwood Forest Soil | VSERLRLWLERAGAGFRMRDAATGEPVPWEDPRVRVVAVAGVSFRPGAVED |
| Ga0335082_116808882 | 3300032782 | Soil | VSDRLRLWLERDRRGAGYHLRDAATGERITWEDPRIRV |
| Ga0335070_104272493 | 3300032829 | Soil | VSERLRLWLERDRRGAGYRLRDAATGEEVRWEDPRLRVV |
| Ga0335076_115692981 | 3300032955 | Soil | LERLRIWLERGESGYWLRDAATGQAVSWKDPRLLVIKVAGTSY |
| Ga0247829_102764053 | 3300033550 | Soil | VNERLRLWLERGRDGFHLRDAATDEPVRWEDPRIRVLA |
| Ga0247829_104604041 | 3300033550 | Soil | LSSERLRLWLERGGAGYYLRDAATGEPVRWEDQRLRVV |
| Ga0247830_115261162 | 3300033551 | Soil | VNERLRLWLERGRDGFHLRDAATDEPVRWEDPRIRVLP |
| Ga0364931_0320560_3_137 | 3300034176 | Sediment | MAERLRLLMERAGAGYRLRDAASGEVVRWEDPRVTVIPVAGVSFR |
| Ga0370495_0324101_2_124 | 3300034257 | Untreated Peat Soil | VAERLRLWLERGEHGYWLRDAATHEPVRWSDARVLVLPVAG |
| ⦗Top⦘ |