| Basic Information | |
|---|---|
| Family ID | F016266 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 248 |
| Average Sequence Length | 41 residues |
| Representative Sequence | MELFTSVILGLVAIALGVALIIYAFKGRQSQARRITNWRQRP |
| Number of Associated Samples | 184 |
| Number of Associated Scaffolds | 248 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 6.45 % |
| % of genes near scaffold ends (potentially truncated) | 65.73 % |
| % of genes from short scaffolds (< 2000 bps) | 71.37 % |
| Associated GOLD sequencing projects | 170 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.45 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (53.629 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater (22.177 % of family members) |
| Environment Ontology (ENVO) | Unclassified (58.871 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (56.452 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 54.29% β-sheet: 0.00% Coil/Unstructured: 45.71% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.45 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 248 Family Scaffolds |
|---|---|---|
| PF08768 | THAP4_heme-bd | 40.73 |
| PF08669 | GCV_T_C | 24.60 |
| PF06089 | Asparaginase_II | 16.13 |
| PF01475 | FUR | 3.23 |
| PF13439 | Glyco_transf_4 | 3.23 |
| PF00300 | His_Phos_1 | 1.61 |
| PF00085 | Thioredoxin | 1.61 |
| PF10722 | YbjN | 1.61 |
| PF14340 | DUF4395 | 1.61 |
| PF00486 | Trans_reg_C | 1.21 |
| PF00202 | Aminotran_3 | 0.81 |
| PF02635 | DrsE | 0.81 |
| PF00583 | Acetyltransf_1 | 0.81 |
| PF13098 | Thioredoxin_2 | 0.40 |
| PF02559 | CarD_CdnL_TRCF | 0.40 |
| PF00990 | GGDEF | 0.40 |
| PF16353 | LacZ_4 | 0.40 |
| COG ID | Name | Functional Category | % Frequency in 248 Family Scaffolds |
|---|---|---|---|
| COG4448 | L-asparaginase II | Amino acid transport and metabolism [E] | 16.13 |
| COG0735 | Fe2+ or Zn2+ uptake regulation protein Fur/Zur | Inorganic ion transport and metabolism [P] | 3.23 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 53.63 % |
| All Organisms | root | All Organisms | 46.37 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001282|B570J14230_10158308 | Not Available | 643 | Open in IMG/M |
| 3300002220|MLSBCLC_10220318 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium SCGC AAA044-N04 | 9013 | Open in IMG/M |
| 3300003413|JGI25922J50271_10056154 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 875 | Open in IMG/M |
| 3300003429|JGI25914J50564_10065309 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 948 | Open in IMG/M |
| 3300003490|JGI25926J51410_1034893 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 918 | Open in IMG/M |
| 3300003497|JGI25925J51416_10040369 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae | 1285 | Open in IMG/M |
| 3300004774|Ga0007794_10033779 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1527 | Open in IMG/M |
| 3300004805|Ga0007792_10084569 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 965 | Open in IMG/M |
| 3300005517|Ga0070374_10194365 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1045 | Open in IMG/M |
| 3300005662|Ga0078894_10027011 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4696 | Open in IMG/M |
| 3300005662|Ga0078894_10776644 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 840 | Open in IMG/M |
| 3300005662|Ga0078894_10928258 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 753 | Open in IMG/M |
| 3300005662|Ga0078894_11160657 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 656 | Open in IMG/M |
| 3300005662|Ga0078894_11634623 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 530 | Open in IMG/M |
| 3300005662|Ga0078894_11767989 | Not Available | 505 | Open in IMG/M |
| 3300006030|Ga0075470_10109040 | Not Available | 824 | Open in IMG/M |
| 3300006039|Ga0073915_10073802 | Not Available | 622 | Open in IMG/M |
| 3300006639|Ga0079301_1035704 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1655 | Open in IMG/M |
| 3300006639|Ga0079301_1213215 | Not Available | 550 | Open in IMG/M |
| 3300006805|Ga0075464_10142664 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1402 | Open in IMG/M |
| 3300006805|Ga0075464_10419458 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 814 | Open in IMG/M |
| 3300006805|Ga0075464_10970612 | Not Available | 532 | Open in IMG/M |
| 3300006805|Ga0075464_10988193 | Not Available | 528 | Open in IMG/M |
| 3300006875|Ga0075473_10113226 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1079 | Open in IMG/M |
| 3300007363|Ga0075458_10015590 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2421 | Open in IMG/M |
| 3300007547|Ga0102875_1196830 | Not Available | 625 | Open in IMG/M |
| 3300007548|Ga0102877_1203390 | Not Available | 558 | Open in IMG/M |
| 3300007560|Ga0102913_1293857 | Not Available | 518 | Open in IMG/M |
| 3300007585|Ga0102916_1209105 | Not Available | 531 | Open in IMG/M |
| 3300007593|Ga0102918_1080469 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 958 | Open in IMG/M |
| 3300007597|Ga0102919_1241424 | Not Available | 564 | Open in IMG/M |
| 3300007600|Ga0102920_1229369 | Not Available | 597 | Open in IMG/M |
| 3300007603|Ga0102921_1038916 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1750 | Open in IMG/M |
| 3300007617|Ga0102897_1028855 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales | 1768 | Open in IMG/M |
| 3300007617|Ga0102897_1043122 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae | 1435 | Open in IMG/M |
| 3300007618|Ga0102896_1288124 | Not Available | 500 | Open in IMG/M |
| 3300007620|Ga0102871_1166622 | Not Available | 619 | Open in IMG/M |
| 3300007622|Ga0102863_1166605 | Not Available | 649 | Open in IMG/M |
| 3300007642|Ga0102876_1116637 | Not Available | 720 | Open in IMG/M |
| 3300007653|Ga0102868_1017058 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1516 | Open in IMG/M |
| 3300007661|Ga0102866_1115760 | Not Available | 670 | Open in IMG/M |
| 3300007661|Ga0102866_1191351 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 526 | Open in IMG/M |
| 3300007667|Ga0102910_1160861 | Not Available | 530 | Open in IMG/M |
| 3300007706|Ga0102899_1096705 | Not Available | 718 | Open in IMG/M |
| 3300007861|Ga0105736_1087483 | Not Available | 664 | Open in IMG/M |
| 3300007954|Ga0105739_1167660 | Not Available | 526 | Open in IMG/M |
| 3300007973|Ga0105746_1151445 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 781 | Open in IMG/M |
| 3300008021|Ga0102922_1244504 | Not Available | 563 | Open in IMG/M |
| 3300008052|Ga0102893_1063202 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1114 | Open in IMG/M |
| 3300008072|Ga0110929_1043140 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales | 2087 | Open in IMG/M |
| 3300008108|Ga0114341_10061958 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3109 | Open in IMG/M |
| 3300008108|Ga0114341_10288784 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 860 | Open in IMG/M |
| 3300008111|Ga0114344_1004717 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 6430 | Open in IMG/M |
| 3300008114|Ga0114347_1268431 | Not Available | 510 | Open in IMG/M |
| 3300008119|Ga0114354_1002269 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 10699 | Open in IMG/M |
| 3300008259|Ga0114841_1030493 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales | 2763 | Open in IMG/M |
| 3300008261|Ga0114336_1015579 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 7218 | Open in IMG/M |
| 3300008261|Ga0114336_1041934 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales | 2437 | Open in IMG/M |
| 3300008261|Ga0114336_1181521 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 902 | Open in IMG/M |
| 3300008261|Ga0114336_1225997 | Not Available | 766 | Open in IMG/M |
| 3300008950|Ga0102891_1037649 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1517 | Open in IMG/M |
| 3300008964|Ga0102889_1081926 | Not Available | 964 | Open in IMG/M |
| 3300008995|Ga0102888_1105156 | Not Available | 576 | Open in IMG/M |
| 3300009026|Ga0102829_1137954 | Not Available | 776 | Open in IMG/M |
| 3300009052|Ga0102886_1254242 | Not Available | 515 | Open in IMG/M |
| 3300009056|Ga0102860_1098590 | Not Available | 810 | Open in IMG/M |
| 3300009056|Ga0102860_1113805 | Not Available | 755 | Open in IMG/M |
| 3300009056|Ga0102860_1207790 | Not Available | 562 | Open in IMG/M |
| 3300009068|Ga0114973_10553381 | Not Available | 593 | Open in IMG/M |
| 3300009080|Ga0102815_10504941 | Not Available | 676 | Open in IMG/M |
| 3300009152|Ga0114980_10018906 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 4323 | Open in IMG/M |
| 3300009154|Ga0114963_10503621 | Not Available | 644 | Open in IMG/M |
| 3300009158|Ga0114977_10007111 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 7105 | Open in IMG/M |
| 3300009158|Ga0114977_10035785 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 3105 | Open in IMG/M |
| 3300009160|Ga0114981_10011308 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 5297 | Open in IMG/M |
| 3300009163|Ga0114970_10078383 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2075 | Open in IMG/M |
| 3300009164|Ga0114975_10034788 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 3009 | Open in IMG/M |
| 3300009164|Ga0114975_10470357 | Not Available | 680 | Open in IMG/M |
| 3300009180|Ga0114979_10411540 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 790 | Open in IMG/M |
| 3300009183|Ga0114974_10130415 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1589 | Open in IMG/M |
| 3300009684|Ga0114958_10320203 | Not Available | 757 | Open in IMG/M |
| 3300010158|Ga0114960_10560239 | Not Available | 544 | Open in IMG/M |
| 3300010160|Ga0114967_10049544 | Not Available | 2661 | Open in IMG/M |
| 3300010160|Ga0114967_10221429 | Not Available | 1006 | Open in IMG/M |
| 3300010334|Ga0136644_10042705 | Not Available | 2955 | Open in IMG/M |
| 3300010368|Ga0129324_10010805 | Not Available | 4803 | Open in IMG/M |
| 3300010885|Ga0133913_10074951 | Not Available | 9076 | Open in IMG/M |
| 3300010885|Ga0133913_10165901 | Not Available | 5902 | Open in IMG/M |
| 3300010885|Ga0133913_13541407 | Not Available | 1016 | Open in IMG/M |
| 3300010965|Ga0138308_107781 | Not Available | 7145 | Open in IMG/M |
| 3300011184|Ga0136709_1022360 | Not Available | 876 | Open in IMG/M |
| 3300012710|Ga0157550_1179324 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 823 | Open in IMG/M |
| 3300012714|Ga0157601_1094803 | Not Available | 546 | Open in IMG/M |
| 3300012720|Ga0157613_1240647 | Not Available | 726 | Open in IMG/M |
| 3300012724|Ga0157611_1194938 | Not Available | 572 | Open in IMG/M |
| 3300012724|Ga0157611_1205649 | Not Available | 703 | Open in IMG/M |
| 3300012730|Ga0157602_1250092 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 823 | Open in IMG/M |
| 3300012761|Ga0138288_1072054 | Not Available | 505 | Open in IMG/M |
| 3300012761|Ga0138288_1184281 | Not Available | 626 | Open in IMG/M |
| 3300012774|Ga0138283_1282542 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 2775 | Open in IMG/M |
| 3300013004|Ga0164293_10121139 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1980 | Open in IMG/M |
| 3300013004|Ga0164293_10233245 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1309 | Open in IMG/M |
| 3300013004|Ga0164293_10401260 | Not Available | 923 | Open in IMG/M |
| 3300013004|Ga0164293_10963384 | Not Available | 534 | Open in IMG/M |
| 3300013005|Ga0164292_10166086 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1601 | Open in IMG/M |
| 3300013005|Ga0164292_10335135 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1025 | Open in IMG/M |
| 3300013005|Ga0164292_11031792 | Not Available | 512 | Open in IMG/M |
| 3300013092|Ga0163199_1022578 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 3132 | Open in IMG/M |
| 3300013286|Ga0136641_1001151 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 11096 | Open in IMG/M |
| 3300014050|Ga0119952_1034954 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1492 | Open in IMG/M |
| 3300018682|Ga0188851_1001232 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4488 | Open in IMG/M |
| 3300018790|Ga0187842_1058849 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1201 | Open in IMG/M |
| 3300018790|Ga0187842_1103773 | Not Available | 861 | Open in IMG/M |
| 3300018815|Ga0187845_1289042 | Not Available | 516 | Open in IMG/M |
| 3300018868|Ga0187844_10395978 | Not Available | 566 | Open in IMG/M |
| 3300020157|Ga0194049_1009214 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 2593 | Open in IMG/M |
| 3300020159|Ga0211734_10288620 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1207 | Open in IMG/M |
| 3300020161|Ga0211726_10823596 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 3161 | Open in IMG/M |
| 3300020167|Ga0194035_1001254 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 13572 | Open in IMG/M |
| 3300020167|Ga0194035_1007746 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 4640 | Open in IMG/M |
| 3300020482|Ga0208464_112412 | Not Available | 621 | Open in IMG/M |
| 3300020500|Ga0208463_1009260 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 1247 | Open in IMG/M |
| 3300020500|Ga0208463_1011731 | Not Available | 1076 | Open in IMG/M |
| 3300020503|Ga0208363_1002582 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 3336 | Open in IMG/M |
| 3300020508|Ga0208225_1044537 | Not Available | 516 | Open in IMG/M |
| 3300020525|Ga0207938_1001672 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 4408 | Open in IMG/M |
| 3300020525|Ga0207938_1006468 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2246 | Open in IMG/M |
| 3300020531|Ga0208487_1018428 | Not Available | 859 | Open in IMG/M |
| 3300020535|Ga0208228_1013428 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 1446 | Open in IMG/M |
| 3300020536|Ga0207939_1003733 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3007 | Open in IMG/M |
| 3300020549|Ga0207942_1002772 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2843 | Open in IMG/M |
| 3300020556|Ga0208486_1037452 | Not Available | 723 | Open in IMG/M |
| 3300020569|Ga0208229_1054364 | Not Available | 564 | Open in IMG/M |
| 3300020575|Ga0208053_1002127 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 4617 | Open in IMG/M |
| 3300021070|Ga0194056_10191252 | Not Available | 713 | Open in IMG/M |
| 3300021072|Ga0194057_10336738 | Not Available | 517 | Open in IMG/M |
| 3300021075|Ga0194063_10084610 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 1434 | Open in IMG/M |
| 3300021470|Ga0194051_1029163 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2143 | Open in IMG/M |
| 3300021962|Ga0222713_10819293 | Not Available | 518 | Open in IMG/M |
| 3300021963|Ga0222712_10010905 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 8233 | Open in IMG/M |
| 3300021963|Ga0222712_10070028 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2539 | Open in IMG/M |
| 3300022553|Ga0212124_10001496 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 19867 | Open in IMG/M |
| 3300022752|Ga0214917_10022976 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 5011 | Open in IMG/M |
| 3300022752|Ga0214917_10049498 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2860 | Open in IMG/M |
| 3300022752|Ga0214917_10055053 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales | 2645 | Open in IMG/M |
| 3300023174|Ga0214921_10028056 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales | 5637 | Open in IMG/M |
| 3300023179|Ga0214923_10041875 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3625 | Open in IMG/M |
| 3300023184|Ga0214919_10076999 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2969 | Open in IMG/M |
| 3300023184|Ga0214919_10233409 | Not Available | 1338 | Open in IMG/M |
| 3300024348|Ga0244776_10105435 | Not Available | 2102 | Open in IMG/M |
| 3300024348|Ga0244776_10183975 | Not Available | 1498 | Open in IMG/M |
| 3300024348|Ga0244776_10240220 | Not Available | 1265 | Open in IMG/M |
| 3300024348|Ga0244776_10573169 | Not Available | 716 | Open in IMG/M |
| 3300024348|Ga0244776_10644377 | Not Available | 662 | Open in IMG/M |
| 3300024848|Ga0255229_1058420 | Not Available | 667 | Open in IMG/M |
| 3300024862|Ga0256317_1124416 | Not Available | 564 | Open in IMG/M |
| 3300025532|Ga0208249_1052648 | Not Available | 1014 | Open in IMG/M |
| 3300025532|Ga0208249_1068913 | Not Available | 844 | Open in IMG/M |
| 3300025635|Ga0208147_1118151 | Not Available | 634 | Open in IMG/M |
| 3300027084|Ga0208443_1105462 | Not Available | 528 | Open in IMG/M |
| 3300027114|Ga0208009_1002982 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Candidatus Nanopelagicales → Candidatus Nanopelagicaceae → Candidatus Planktophila | 4655 | Open in IMG/M |
| 3300027129|Ga0255067_1038170 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 687 | Open in IMG/M |
| 3300027150|Ga0255112_1065262 | Not Available | 708 | Open in IMG/M |
| 3300027222|Ga0208024_1005279 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2725 | Open in IMG/M |
| 3300027281|Ga0208440_1097200 | Not Available | 594 | Open in IMG/M |
| 3300027320|Ga0208923_1055972 | Not Available | 700 | Open in IMG/M |
| 3300027366|Ga0208556_1058950 | Not Available | 741 | Open in IMG/M |
| 3300027380|Ga0208432_1004603 | Not Available | 2682 | Open in IMG/M |
| 3300027499|Ga0208788_1005159 | Not Available | 5452 | Open in IMG/M |
| 3300027563|Ga0209552_1078353 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 905 | Open in IMG/M |
| 3300027642|Ga0209135_1238953 | Not Available | 543 | Open in IMG/M |
| 3300027679|Ga0209769_1004897 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Candidatus Nanopelagicales → Candidatus Nanopelagicaceae → Candidatus Planktophila | 5057 | Open in IMG/M |
| 3300027688|Ga0209553_1072742 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Candidatus Nanopelagicales → Candidatus Nanopelagicaceae → Candidatus Planktophila | 1291 | Open in IMG/M |
| (restricted) 3300027728|Ga0247836_1005025 | Not Available | 15871 | Open in IMG/M |
| (restricted) 3300027728|Ga0247836_1035541 | Not Available | 3172 | Open in IMG/M |
| 3300027733|Ga0209297_1001536 | Not Available | 13423 | Open in IMG/M |
| 3300027733|Ga0209297_1025806 | Not Available | 2764 | Open in IMG/M |
| 3300027734|Ga0209087_1344484 | Not Available | 517 | Open in IMG/M |
| 3300027751|Ga0208304_10199492 | Not Available | 722 | Open in IMG/M |
| 3300027754|Ga0209596_1099259 | Not Available | 1377 | Open in IMG/M |
| 3300027756|Ga0209444_10311455 | Not Available | 523 | Open in IMG/M |
| 3300027759|Ga0209296_1033108 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2831 | Open in IMG/M |
| 3300027764|Ga0209134_10000029 | Not Available | 48366 | Open in IMG/M |
| 3300027764|Ga0209134_10146354 | Not Available | 814 | Open in IMG/M |
| 3300027764|Ga0209134_10228050 | Not Available | 640 | Open in IMG/M |
| 3300027769|Ga0209770_10068825 | Not Available | 1483 | Open in IMG/M |
| 3300027770|Ga0209086_10021524 | Not Available | 4030 | Open in IMG/M |
| 3300027770|Ga0209086_10209207 | Not Available | 892 | Open in IMG/M |
| 3300027772|Ga0209768_10210231 | Not Available | 868 | Open in IMG/M |
| 3300027798|Ga0209353_10021474 | Not Available | 3040 | Open in IMG/M |
| 3300027798|Ga0209353_10424799 | Not Available | 541 | Open in IMG/M |
| 3300027798|Ga0209353_10426788 | Not Available | 539 | Open in IMG/M |
| 3300027804|Ga0209358_10233961 | Not Available | 933 | Open in IMG/M |
| 3300027805|Ga0209229_10155871 | Not Available | 1028 | Open in IMG/M |
| 3300027805|Ga0209229_10180108 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Candidatus Nanopelagicales → Candidatus Nanopelagicaceae → Candidatus Planktophila | 948 | Open in IMG/M |
| 3300027805|Ga0209229_10525668 | Not Available | 503 | Open in IMG/M |
| 3300027836|Ga0209230_10002026 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 8223 | Open in IMG/M |
| 3300027969|Ga0209191_1158434 | Not Available | 919 | Open in IMG/M |
| 3300027976|Ga0209702_10002420 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 32563 | Open in IMG/M |
| (restricted) 3300028044|Ga0247838_1129151 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1000 | Open in IMG/M |
| 3300028105|Ga0255254_1011523 | Not Available | 1658 | Open in IMG/M |
| 3300028108|Ga0256305_1134248 | Not Available | 591 | Open in IMG/M |
| 3300028178|Ga0265593_1068395 | Not Available | 985 | Open in IMG/M |
| 3300028394|Ga0304730_1012969 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium IMCC19121 | 4786 | Open in IMG/M |
| 3300028394|Ga0304730_1138768 | Not Available | 993 | Open in IMG/M |
| 3300031758|Ga0315907_10243606 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1493 | Open in IMG/M |
| 3300031784|Ga0315899_10031206 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5619 | Open in IMG/M |
| 3300031786|Ga0315908_10002599 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Candidatus Nanopelagicales → Candidatus Nanopelagicaceae → Candidatus Planktophila | 13150 | Open in IMG/M |
| 3300031786|Ga0315908_10037454 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Candidatus Nanopelagicales → Candidatus Nanopelagicaceae → Candidatus Planktophila | 3666 | Open in IMG/M |
| 3300031786|Ga0315908_10128402 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2063 | Open in IMG/M |
| 3300031786|Ga0315908_10210066 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Candidatus Nanopelagicales → Candidatus Nanopelagicaceae → Candidatus Planktophila | 1616 | Open in IMG/M |
| 3300031787|Ga0315900_10944827 | Not Available | 574 | Open in IMG/M |
| 3300031951|Ga0315904_10095951 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Candidatus Nanopelagicales → Candidatus Nanopelagicaceae → Candidatus Planktophila | 3130 | Open in IMG/M |
| 3300031951|Ga0315904_10269299 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1617 | Open in IMG/M |
| 3300031951|Ga0315904_10706857 | Not Available | 846 | Open in IMG/M |
| 3300032050|Ga0315906_10293405 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Candidatus Nanopelagicales → Candidatus Nanopelagicaceae → Candidatus Planktophila | 1469 | Open in IMG/M |
| 3300032092|Ga0315905_10685566 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 911 | Open in IMG/M |
| 3300032116|Ga0315903_10011822 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Candidatus Nanopelagicales → Candidatus Nanopelagicaceae → Candidatus Planktophila → Candidatus Planktophila vernalis | 10236 | Open in IMG/M |
| 3300033979|Ga0334978_0074507 | Not Available | 1738 | Open in IMG/M |
| 3300033979|Ga0334978_0291740 | Not Available | 782 | Open in IMG/M |
| 3300033984|Ga0334989_0609164 | Not Available | 523 | Open in IMG/M |
| 3300033992|Ga0334992_0102222 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1531 | Open in IMG/M |
| 3300033994|Ga0334996_0129999 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Candidatus Nanopelagicales | 1427 | Open in IMG/M |
| 3300033995|Ga0335003_0223355 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 888 | Open in IMG/M |
| 3300033996|Ga0334979_0120477 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1614 | Open in IMG/M |
| 3300034012|Ga0334986_0544178 | Not Available | 562 | Open in IMG/M |
| 3300034018|Ga0334985_0479735 | Not Available | 722 | Open in IMG/M |
| 3300034021|Ga0335004_0074431 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2325 | Open in IMG/M |
| 3300034062|Ga0334995_0711762 | Not Available | 563 | Open in IMG/M |
| 3300034066|Ga0335019_0024647 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Candidatus Nanopelagicales → Candidatus Nanopelagicaceae → Candidatus Planktophila → Candidatus Planktophila vernalis | 4156 | Open in IMG/M |
| 3300034066|Ga0335019_0543589 | Not Available | 688 | Open in IMG/M |
| 3300034092|Ga0335010_0135496 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Candidatus Nanopelagicales | 1582 | Open in IMG/M |
| 3300034092|Ga0335010_0546595 | Not Available | 598 | Open in IMG/M |
| 3300034095|Ga0335022_0450280 | Not Available | 683 | Open in IMG/M |
| 3300034095|Ga0335022_0566056 | Not Available | 580 | Open in IMG/M |
| 3300034102|Ga0335029_0709127 | Not Available | 544 | Open in IMG/M |
| 3300034104|Ga0335031_0259480 | Not Available | 1148 | Open in IMG/M |
| 3300034108|Ga0335050_0242160 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 901 | Open in IMG/M |
| 3300034109|Ga0335051_0135194 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1265 | Open in IMG/M |
| 3300034118|Ga0335053_0688450 | Not Available | 577 | Open in IMG/M |
| 3300034121|Ga0335058_0281504 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Candidatus Nanopelagicales | 966 | Open in IMG/M |
| 3300034121|Ga0335058_0690066 | Not Available | 564 | Open in IMG/M |
| 3300034166|Ga0335016_0584729 | Not Available | 612 | Open in IMG/M |
| 3300034284|Ga0335013_0726455 | Not Available | 563 | Open in IMG/M |
| 3300034356|Ga0335048_0196419 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Candidatus Nanopelagicales | 1115 | Open in IMG/M |
| 3300034356|Ga0335048_0450097 | Not Available | 627 | Open in IMG/M |
| 3300034357|Ga0335064_0118284 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Candidatus Nanopelagicales | 1612 | Open in IMG/M |
| 3300034357|Ga0335064_0776672 | Not Available | 587 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 22.18% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 16.53% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 12.90% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 10.48% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 5.24% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 5.24% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 4.03% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 3.23% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 3.23% |
| Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 2.82% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 2.42% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 2.42% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 2.02% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 1.61% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 1.21% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 1.21% |
| Lake Chemocline | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake Chemocline | 0.40% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 0.40% |
| Water Bodies | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Water Bodies | 0.40% |
| Freshwater | Environmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater | 0.40% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.40% |
| Saline Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water | 0.40% |
| Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Sand | 0.40% |
| Hydrocarbon Resource Environments | Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Hydrocarbon Resource Environments | 0.40% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001282 | Freshwater microbial communities from Lake Mendota, WI - Practice 20APR2010 epilimnion | Environmental | Open in IMG/M |
| 3300002220 | Wastewater microbial communities from Syncrude, Ft. McMurray, Alberta - West In Pit SyncrudeMLSB2011 | Engineered | Open in IMG/M |
| 3300003413 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD | Environmental | Open in IMG/M |
| 3300003429 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN | Environmental | Open in IMG/M |
| 3300003490 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SN | Environmental | Open in IMG/M |
| 3300003497 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.DN | Environmental | Open in IMG/M |
| 3300004774 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA5M | Environmental | Open in IMG/M |
| 3300004805 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA6M | Environmental | Open in IMG/M |
| 3300005517 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 4) | Environmental | Open in IMG/M |
| 3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
| 3300006030 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006039 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T2_30-Apr-14 | Environmental | Open in IMG/M |
| 3300006639 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_11 | Environmental | Open in IMG/M |
| 3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006875 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA | Environmental | Open in IMG/M |
| 3300007363 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007547 | Estuarine microbial communities from the Columbia River estuary - metaG 1547B-02 | Environmental | Open in IMG/M |
| 3300007548 | Estuarine microbial communities from the Columbia River estuary - metaG 1548B-3 | Environmental | Open in IMG/M |
| 3300007560 | Estuarine microbial communities from the Columbia River estuary - metaG 1560A-02 | Environmental | Open in IMG/M |
| 3300007585 | Estuarine microbial communities from the Columbia River estuary - metaG 1562A-3 | Environmental | Open in IMG/M |
| 3300007593 | Estuarine microbial communities from the Columbia River estuary - metaG 1563A-3 | Environmental | Open in IMG/M |
| 3300007597 | Estuarine microbial communities from the Columbia River estuary - metaG 1563A-02 | Environmental | Open in IMG/M |
| 3300007600 | Estuarine microbial communities from the Columbia River estuary - metaG 1568A-3 | Environmental | Open in IMG/M |
| 3300007603 | Estuarine microbial communities from the Columbia River estuary - metaG 1568-02 | Environmental | Open in IMG/M |
| 3300007617 | Estuarine microbial communities from the Columbia River estuary - metaG 1554B-02 | Environmental | Open in IMG/M |
| 3300007618 | Estuarine microbial communities from the Columbia River estuary - metaG 1554A-02 | Environmental | Open in IMG/M |
| 3300007620 | Estuarine microbial communities from the Columbia River estuary - metaG 1546C-02 | Environmental | Open in IMG/M |
| 3300007622 | Estuarine microbial communities from the Columbia River estuary - metaG 1449A-02 | Environmental | Open in IMG/M |
| 3300007642 | Estuarine microbial communities from the Columbia River estuary - metaG 1548A-3 | Environmental | Open in IMG/M |
| 3300007653 | Estuarine microbial communities from the Columbia River estuary - metaG 1546C-3 | Environmental | Open in IMG/M |
| 3300007661 | Estuarine microbial communities from the Columbia River estuary - metaG 1546A-3 | Environmental | Open in IMG/M |
| 3300007667 | Estuarine microbial communities from the Columbia River estuary - metaG 1558A-3 | Environmental | Open in IMG/M |
| 3300007706 | Estuarine microbial communities from the Columbia River estuary - metaG 1555B-3 | Environmental | Open in IMG/M |
| 3300007861 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1372B_3um | Environmental | Open in IMG/M |
| 3300007954 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1373B_0.2um | Environmental | Open in IMG/M |
| 3300007973 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460A_0.2um | Environmental | Open in IMG/M |
| 3300008021 | Estuarine microbial communities from the Columbia River estuary - metaG 1569A-3 | Environmental | Open in IMG/M |
| 3300008052 | Estuarine microbial communities from the Columbia River estuary - metaG 1553A-02 | Environmental | Open in IMG/M |
| 3300008072 | Microbial Communities in Water bodies, Singapore - Site MA | Environmental | Open in IMG/M |
| 3300008108 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-C-NA | Environmental | Open in IMG/M |
| 3300008111 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-C-NA | Environmental | Open in IMG/M |
| 3300008114 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-C-NA | Environmental | Open in IMG/M |
| 3300008119 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0110-C-NA | Environmental | Open in IMG/M |
| 3300008259 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0132-C-NA | Environmental | Open in IMG/M |
| 3300008261 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-C-NA | Environmental | Open in IMG/M |
| 3300008950 | Estuarine microbial communities from the Columbia River estuary - metaG 1552A-02 | Environmental | Open in IMG/M |
| 3300008964 | Estuarine microbial communities from the Columbia River estuary - metaG 1551A-02 | Environmental | Open in IMG/M |
| 3300008995 | Estuarine microbial communities from the Columbia River estuary - metaG 1551A-3 | Environmental | Open in IMG/M |
| 3300009026 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575 | Environmental | Open in IMG/M |
| 3300009052 | Estuarine microbial communities from the Columbia River estuary - metaG 1550A-02 | Environmental | Open in IMG/M |
| 3300009056 | Estuarine microbial communities from the Columbia River estuary - metaG 1449A-3 | Environmental | Open in IMG/M |
| 3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009080 | Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.759 | Environmental | Open in IMG/M |
| 3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
| 3300009154 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG | Environmental | Open in IMG/M |
| 3300009158 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG | Environmental | Open in IMG/M |
| 3300009160 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG | Environmental | Open in IMG/M |
| 3300009163 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG | Environmental | Open in IMG/M |
| 3300009164 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG | Environmental | Open in IMG/M |
| 3300009180 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG | Environmental | Open in IMG/M |
| 3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
| 3300009684 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130208_EF_MetaG | Environmental | Open in IMG/M |
| 3300010158 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_MF_MetaG | Environmental | Open in IMG/M |
| 3300010160 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG | Environmental | Open in IMG/M |
| 3300010334 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_EF_MetaG (v2) | Environmental | Open in IMG/M |
| 3300010368 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNA | Environmental | Open in IMG/M |
| 3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
| 3300010965 | Microbial communities from Lake Cadagno chemocline, Switzerland. Combined Assembly of Gp0156211, Gp0156621 | Environmental | Open in IMG/M |
| 3300011184 | Freshwater bacterial and archeal communities from Indian Creek, Illinois, USA - Floc-Cal metaG | Environmental | Open in IMG/M |
| 3300012710 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES041 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012714 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES125 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012720 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES141 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012724 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES138 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012730 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES126 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012761 | Freshwater microbial communities from Lake Simoncouche, Canada - S_130826_M_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012774 | Freshwater microbial communities from Lake Simoncouche, Canada - S_130109_E_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
| 3300013005 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG | Environmental | Open in IMG/M |
| 3300013092 | Freshwater microbial communities from Powell Lake, British Columbia, Canada to study Microbial Dark Matter (Phase II) - PL_2010_150m | Environmental | Open in IMG/M |
| 3300013286 | Freshwater microbial communities from Elizabeth Lake, Yosemite National Park, California, USA - 13020-23Y | Environmental | Open in IMG/M |
| 3300014050 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007B | Environmental | Open in IMG/M |
| 3300018682 | Metatranscriptome of marine microbial communities from Baltic Sea - GS680_0p1 | Environmental | Open in IMG/M |
| 3300018790 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - SP09_SKY_41 | Environmental | Open in IMG/M |
| 3300018815 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - SP09_SKY_68 | Environmental | Open in IMG/M |
| 3300018868 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - SP09_SKY_50 | Environmental | Open in IMG/M |
| 3300020157 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L224-25m | Environmental | Open in IMG/M |
| 3300020159 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1 | Environmental | Open in IMG/M |
| 3300020161 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1 | Environmental | Open in IMG/M |
| 3300020167 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L239-20m | Environmental | Open in IMG/M |
| 3300020482 | Freshwater microbial communities from Lake Mendota, WI - 13SEPL2008 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020500 | Freshwater microbial communities from Lake Mendota, WI - 9JUL2008 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020503 | Freshwater microbial communities from Lake Mendota, WI - 03MAY2011 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020508 | Freshwater microbial communities from Lake Mendota, WI - 15JUN2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020525 | Freshwater microbial communities from Lake Mendota, WI - 05MAR2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020531 | Freshwater microbial communities from Lake Mendota, WI - 21SEP2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020535 | Freshwater microbial communities from Lake Mendota, WI - 25JUL2011 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020536 | Freshwater microbial communities from Lake Mendota, WI - 02JUN2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020549 | Freshwater microbial communities from Lake Mendota, WI - 12OCT2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020556 | Freshwater microbial communities from Lake Mendota, WI - 03AUG2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020569 | Freshwater microbial communities from Lake Mendota, WI - 22AUG2011 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020575 | Freshwater microbial communities from Lake Mendota, WI - 20MAY2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300021070 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Sep2016-L442-13m | Environmental | Open in IMG/M |
| 3300021072 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Sep2016-L442-15m | Environmental | Open in IMG/M |
| 3300021075 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Sep2016-L373-20m | Environmental | Open in IMG/M |
| 3300021470 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Sep2016-L239-20m | Environmental | Open in IMG/M |
| 3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
| 3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
| 3300022553 | Powell_combined assembly | Environmental | Open in IMG/M |
| 3300022752 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BB | Environmental | Open in IMG/M |
| 3300023174 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505 | Environmental | Open in IMG/M |
| 3300023179 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1510 | Environmental | Open in IMG/M |
| 3300023184 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503 | Environmental | Open in IMG/M |
| 3300024348 | 0.2um to 3um size fraction coassembly | Environmental | Open in IMG/M |
| 3300024848 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepB_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024862 | Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Atlam_RepB_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025532 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA1M (SPAdes) | Environmental | Open in IMG/M |
| 3300025635 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027084 | Estuarine microbial communities from the Columbia River estuary - metaG 1554A-02 (SPAdes) | Environmental | Open in IMG/M |
| 3300027114 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_16 (SPAdes) | Environmental | Open in IMG/M |
| 3300027129 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepB_8h | Environmental | Open in IMG/M |
| 3300027150 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Yuk_RepB_8h | Environmental | Open in IMG/M |
| 3300027222 | Estuarine microbial communities from the Columbia River estuary - metaG 1546B-02 (SPAdes) | Environmental | Open in IMG/M |
| 3300027281 | Estuarine microbial communities from the Columbia River estuary - metaG 1547B-02 (SPAdes) | Environmental | Open in IMG/M |
| 3300027320 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575 (SPAdes) | Environmental | Open in IMG/M |
| 3300027366 | Estuarine microbial communities from the Columbia River estuary - metaG 1547B-3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027380 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series LW 2014_7_11 (SPAdes) | Environmental | Open in IMG/M |
| 3300027499 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_11 (SPAdes) | Environmental | Open in IMG/M |
| 3300027563 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027642 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027679 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.DN (SPAdes) | Environmental | Open in IMG/M |
| 3300027688 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.DN (SPAdes) | Environmental | Open in IMG/M |
| 3300027728 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_14m | Environmental | Open in IMG/M |
| 3300027733 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027734 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027751 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.713 (SPAdes) | Environmental | Open in IMG/M |
| 3300027754 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027756 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.DN (SPAdes) | Environmental | Open in IMG/M |
| 3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027764 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MLB.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027769 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300027770 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027772 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027798 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027804 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027805 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes) | Environmental | Open in IMG/M |
| 3300027836 | Freshwater and sediment microbial communities from Lake Ontario - Sta 18 epilimnion Metagenome (SPAdes) | Environmental | Open in IMG/M |
| 3300027969 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027976 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-01 (SPAdes) | Environmental | Open in IMG/M |
| 3300028044 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_15m | Environmental | Open in IMG/M |
| 3300028105 | Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Atlam_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300028108 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepB_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300028178 | Saline water microbial communities from Sakinaw Lake, British Columbia, Canada - sak_2011_5_24_36m | Environmental | Open in IMG/M |
| 3300028394 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG (v2) | Environmental | Open in IMG/M |
| 3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
| 3300031784 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112 | Environmental | Open in IMG/M |
| 3300031786 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA124 | Environmental | Open in IMG/M |
| 3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
| 3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
| 3300032050 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122 | Environmental | Open in IMG/M |
| 3300032092 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121 | Environmental | Open in IMG/M |
| 3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
| 3300033979 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME30Aug2017-rr0003 | Environmental | Open in IMG/M |
| 3300033984 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Mar2001-rr0030 | Environmental | Open in IMG/M |
| 3300033992 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Jun2014-rr0035 | Environmental | Open in IMG/M |
| 3300033994 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME25Jul2006D11-rr0046 | Environmental | Open in IMG/M |
| 3300033995 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23May2014-rr0056 | Environmental | Open in IMG/M |
| 3300033996 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004 | Environmental | Open in IMG/M |
| 3300034012 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Aug2017-rr0027 | Environmental | Open in IMG/M |
| 3300034018 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME04Jul2014-rr0021 | Environmental | Open in IMG/M |
| 3300034021 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME01Oct2014-rr0057 | Environmental | Open in IMG/M |
| 3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
| 3300034066 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Jul2017-rr0087 | Environmental | Open in IMG/M |
| 3300034092 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2012-rr0069 | Environmental | Open in IMG/M |
| 3300034095 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Feb2014D0-rr0091 | Environmental | Open in IMG/M |
| 3300034102 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112 | Environmental | Open in IMG/M |
| 3300034104 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120 | Environmental | Open in IMG/M |
| 3300034108 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Jun2014-rr0157 | Environmental | Open in IMG/M |
| 3300034109 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME26Aug2009-rr0158 | Environmental | Open in IMG/M |
| 3300034118 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Aug2017-rr0165 | Environmental | Open in IMG/M |
| 3300034121 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19May2015-rr0174 | Environmental | Open in IMG/M |
| 3300034166 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Sep2012-rr0079 | Environmental | Open in IMG/M |
| 3300034284 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jul2016-rr0075 | Environmental | Open in IMG/M |
| 3300034356 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jun2014-rr0152 | Environmental | Open in IMG/M |
| 3300034357 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME12May2017-rr0187 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| B570J14230_101583081 | 3300001282 | Freshwater | AATYCLTATIWSMELLTSVILGLVAIAFGIALIFYAFRGRQSQARRSPKFRGRP* |
| MLSBCLC_1022031811 | 3300002220 | Hydrocarbon Resource Environments | MELITSVILGLVAIALGVVLIVYAFKGRQSQARRITNWRQRP* |
| JGI25922J50271_100561543 | 3300003413 | Freshwater Lake | LFNRYSYAMELFTSVILGLVAIALGVALVLYAFKGRQSQARRITNWRQRP* |
| JGI25914J50564_100653094 | 3300003429 | Freshwater Lake | MELFTSVILGLVAIALGVVLVLYAFKGRQSQARRITNWRQRP* |
| JGI25926J51410_10348933 | 3300003490 | Freshwater Lake | ELLTSVILGLVAIALGIALIFYAFRGRQSQARRSPKFRGRP* |
| JGI25925J51416_100403693 | 3300003497 | Freshwater Lake | GMELFTSVILGLVAIALGVVLVLYAFKGRQSQARRITNWRQRP* |
| Ga0007794_100337793 | 3300004774 | Freshwater | MELFTSVILGLVAIALGLALILYAFRGRQSQARRSTKFRGRP* |
| Ga0007792_100845692 | 3300004805 | Freshwater | MELFTSVILGLVAIALGLALIFYAFRGRQSQVRRSTKFRGRP* |
| Ga0070374_101943651 | 3300005517 | Freshwater Lake | IFLGLVAIVLGVALIIYAFKGRQSQARRTTNWRQRP* |
| Ga0078894_100270111 | 3300005662 | Freshwater Lake | MELFTSVILGLVAIAIGVALVIYAFKGRQSQARRITNWRQRR* |
| Ga0078894_107766443 | 3300005662 | Freshwater Lake | SVVLALTAIALGVALIVFALTGRQSKARRRSNWRQNP* |
| Ga0078894_109282583 | 3300005662 | Freshwater Lake | ELFTSVILGLVAIAFGVALIVYAFKGRQSQARRITNWRQRR* |
| Ga0078894_111606572 | 3300005662 | Freshwater Lake | MELFTSVILGLVAIALGVALIVYAFKGRQSQARRITNWRQRR* |
| Ga0078894_116346232 | 3300005662 | Freshwater Lake | MELFTSVILGLVAIAFGVALIVYAFKGRQSQARRITNWRQRR* |
| Ga0078894_117679891 | 3300005662 | Freshwater Lake | LGLVAIALGVALIIYAFKGRQSQARRITNWRQRP* |
| Ga0075470_101090402 | 3300006030 | Aqueous | MELLTSVILGLVAIALGIALIFYAFRGRQSQARRSPKF |
| Ga0073915_100738022 | 3300006039 | Sand | TIWRMELLTSVILGLVAIALGIALIFYAFRGRQSQARRSPKFRGRP* |
| Ga0079301_10357042 | 3300006639 | Deep Subsurface | MELFTSVILGLVAIALGVALIVYAFKGRQSQARRITNWRQRP* |
| Ga0079301_12132151 | 3300006639 | Deep Subsurface | FTSVILGLVAIALGVALIVYAFKGRQSQARRITNWRQRP* |
| Ga0075464_101426643 | 3300006805 | Aqueous | MELFTSIILGLVAIALGVALIIYAFKGRQSQARRITNWRKRR* |
| Ga0075464_104194582 | 3300006805 | Aqueous | MELLTSIILGLVAIALGVALIIYAFKGRQSQARRITNWRQRR* |
| Ga0075464_109706122 | 3300006805 | Aqueous | MELFTSIILGLVAIALGVALIIYAFKGRQSQARRITNWRQRR* |
| Ga0075464_109881931 | 3300006805 | Aqueous | MELLTSVILGLVAIALGVALIIYAFKARQSQARRITNWRQRR* |
| Ga0075473_101132262 | 3300006875 | Aqueous | MELFTSVILGLVAIALGIALIVYAFKGRQSQARRITNWRQRR* |
| Ga0075458_100155902 | 3300007363 | Aqueous | MELFTSVILGLVAIALGVVLVIYAFKGRQSQARRTTNWRQRP* |
| Ga0102875_11968302 | 3300007547 | Estuarine | FTSIILGLVAIALGVVLVLYAFKGRQSQARRITNWRQRP* |
| Ga0102877_12033902 | 3300007548 | Estuarine | MELFTSIFLGLVAIVMGMALIIYAFKGRQSQARRTTNW |
| Ga0102913_12938572 | 3300007560 | Estuarine | LGLVAIALGVALVLYAFKGRQSQARRITNWRQRP* |
| Ga0102916_12091052 | 3300007585 | Estuarine | IILGLVAIALGVALIIYAFKGRQSQARRITNWRQRR* |
| Ga0102918_10804693 | 3300007593 | Estuarine | AMELFTSVILGLVAIALGVALIIYAFKGRQSQARRITNWRQRP* |
| Ga0102919_12414241 | 3300007597 | Estuarine | ILGLVAIALGVALVVYAFKGRQSQARRITNWRQRP* |
| Ga0102920_12293691 | 3300007600 | Estuarine | VILGLVAIALGVALIIYAFKGRQSQARRITNWRQRS* |
| Ga0102921_10389162 | 3300007603 | Estuarine | MELFTSAILGLVAIALGVALLVYAFKGRQSQARRITNWRQRR* |
| Ga0102897_10288553 | 3300007617 | Estuarine | MELFTSVILGLVAIALGVALLVYAFKGRQSQARRITNWRQRR* |
| Ga0102897_10431221 | 3300007617 | Estuarine | SVILGLVAIALGVALIIYAFKGRQSQARRITNWRQRP* |
| Ga0102896_12881242 | 3300007618 | Estuarine | LFTSVILGLVAIALGVALIIYAFKGRQSQARRITNWRQRP* |
| Ga0102871_11666222 | 3300007620 | Estuarine | FTSVILGLVAIALGVVLVIYAFKGRQSQARRITNWRQRP* |
| Ga0102863_11666051 | 3300007622 | Estuarine | MELFTSVILGLVAIALGVALVIYAFKGRQSQARRITNWRQRP* |
| Ga0102876_11166371 | 3300007642 | Estuarine | MELFTSIILGRVAIALGVVLVLYAFKGRQSQARRITN |
| Ga0102868_10170581 | 3300007653 | Estuarine | MELFTSVILGLVAIALGVALIIYAFKGRQSQARRITNWRQRP* |
| Ga0102866_11157601 | 3300007661 | Estuarine | IVLGLVAIVLGVVLIIYAFKGRQSQARRTTNWRQRP* |
| Ga0102866_11913511 | 3300007661 | Estuarine | MELFTSVILGLVAIALGVVLVIYAFKGRQSQARRIT |
| Ga0102910_11608611 | 3300007667 | Estuarine | TSVILGLVAIALGVVLVLYAFKGRQSQARRITNWRQRP* |
| Ga0102899_10967051 | 3300007706 | Estuarine | ELFTSVILGLVAIALGVALVLYAFKGRQSQARRITNWRQRP* |
| Ga0105736_10874832 | 3300007861 | Estuary Water | AMELFTSIFLGLVAIVLGAALIIYAFKGRQSQARRTTNWRQRP* |
| Ga0105739_11676602 | 3300007954 | Estuary Water | MELFTSVILGLVAIALGVALVIYAFKGRQSQARRIT |
| Ga0105746_11514451 | 3300007973 | Estuary Water | AMELFTSVILGLVAIALGVVLVLYAFKGRQSQARRITNWRQRP* |
| Ga0102922_12445042 | 3300008021 | Estuarine | MELFTSIFLGLVAIVMGVALIIYAFKGRQSQARRTT |
| Ga0102893_10632023 | 3300008052 | Estuarine | RYSYAMELFTSVILGLVAIALGVALVLYAFKGRQSPARRITNWRQRP* |
| Ga0110929_10431404 | 3300008072 | Water Bodies | MELLTSVILGLVAIALGVVLIFYAFKGRQSQARRITNWRQRR* |
| Ga0114341_100619583 | 3300008108 | Freshwater, Plankton | MELFTSVILGLVAIALGVALIIYAFKGRQSQARRITNWRQRR* |
| Ga0114341_102887843 | 3300008108 | Freshwater, Plankton | SYAMELFTSVILGLVAIALGVALVLYAFKGRQSQARRITNWRQRP* |
| Ga0114344_10047173 | 3300008111 | Freshwater, Plankton | MELITSIILGLVAIALGVVLIIFAFKGRQSQARRTSNWRQRS* |
| Ga0114347_12684312 | 3300008114 | Freshwater, Plankton | MELFTSVILGLVAIALGIALVVYAFKGRQSQARRITRRGH* |
| Ga0114354_100226914 | 3300008119 | Freshwater, Plankton | MELLTSIILGLVAIALGVVLLIYAFKGRQSQARRTTNWRQRP* |
| Ga0114841_10304934 | 3300008259 | Freshwater, Plankton | MELFTSVILGLVAIALGVALVLYAFKGRQSQARRITNWRQRP* |
| Ga0114336_10155797 | 3300008261 | Freshwater, Plankton | MELFTSIVLGLVAIALGVVLVLYAFKGRQSQARRI* |
| Ga0114336_10419344 | 3300008261 | Freshwater, Plankton | AMELFTSVILGLVAIALGVALVLYAFKGRQSQARRITNWRQRP* |
| Ga0114336_11815211 | 3300008261 | Freshwater, Plankton | FTSVILGLVAIALGVALVLYAFKGRQSQARRITNWRQRP* |
| Ga0114336_12259971 | 3300008261 | Freshwater, Plankton | MELFTSIVLGLVAIVLGVALIIYAFKGRQSQARRTTNWR |
| Ga0102891_10376491 | 3300008950 | Estuarine | MELFTSVILGLVAIALGVALVVYAFKGRQSQARRI |
| Ga0102889_10819262 | 3300008964 | Estuarine | MELFTSIILGLVAIALGVVLVIYAFKGRQSQARRI |
| Ga0102888_11051562 | 3300008995 | Estuarine | AMELFTSIFLGLVAITLGVVLVLYAFKGRQSQARRITNWRQRP* |
| Ga0102829_11379542 | 3300009026 | Estuarine | MELFTSIVLGLVAIVLGVVLVLYAFKGRQSQARRITN |
| Ga0102886_12542422 | 3300009052 | Estuarine | MELFTSIILGLVAIALGVVLIVYAFKGRQSQARRITNWRQRP* |
| Ga0102860_10985903 | 3300009056 | Estuarine | ILGLVAIALGVVLVIYAFKGRQSQARRITNWRQRP* |
| Ga0102860_11138052 | 3300009056 | Estuarine | MELFTSIILGLVAIALGVVLVLYAFKGRQSQARRITNWR |
| Ga0102860_12077901 | 3300009056 | Estuarine | VILGLVAIALGIALIFYAFRGRQSQARRSPKFRGRP* |
| Ga0114973_105533811 | 3300009068 | Freshwater Lake | TSVILGLVAIALGVVLVIYAFKGRQSQARRITNWRQRP* |
| Ga0102815_105049411 | 3300009080 | Estuarine | RYSYAMELFTSVILGLIAIALGVALIIYAFKGRQSQARRITNWRQRP* |
| Ga0114980_100189062 | 3300009152 | Freshwater Lake | MELFTSVILGLVAIALGVVLVIYAFKGRQSQARRITNWRQRP* |
| Ga0114963_105036212 | 3300009154 | Freshwater Lake | LGLVAIALGVVLVLYAFKGRQSQARRITNWRQRP* |
| Ga0114977_1000711110 | 3300009158 | Freshwater Lake | MELFTSIILGLGAIALGIALIFYAFRGRQSQVRRPPKFRGRP* |
| Ga0114977_100357852 | 3300009158 | Freshwater Lake | MELFTSVILGLVAIALGIALIIYAFRGRQSQARRSTKFRGRP* |
| Ga0114981_100113082 | 3300009160 | Freshwater Lake | MELFTSVFLGLVAIALGIALIIYAFRGRQSQARRSPKFRGRP* |
| Ga0114970_100783834 | 3300009163 | Freshwater Lake | MELLISVILGLTAIALGVVLIFYAFRGRQSQARRSPRLRG |
| Ga0114975_100347883 | 3300009164 | Freshwater Lake | MELLTSVILGLVAIAFGIALIFYAFRGRQSQARRSPKFRGRP* |
| Ga0114975_104703572 | 3300009164 | Freshwater Lake | CSITTGDCLTATIWSMELLTSVILGLVAIALGIALIFYAFRGRQSQARRSPKFRGRP* |
| Ga0114979_104115401 | 3300009180 | Freshwater Lake | MELFTSIILGLVDIALGVVLVLYAFKGRQSQARRITNWRQRP* |
| Ga0114974_101304151 | 3300009183 | Freshwater Lake | MELFTSIILGLVAIALGVVLVIYAFKGRQSQARRITNWRQ |
| Ga0114958_103202033 | 3300009684 | Freshwater Lake | SIILGLVAIALGVVLVLYAFKGRQSQARRITNWRQRP* |
| Ga0114960_105602391 | 3300010158 | Freshwater Lake | ATIWFVELFTSIILGLVAIALGIALILYAFRGRQSQARRSPKFRGRP* |
| Ga0114967_100495441 | 3300010160 | Freshwater Lake | AMELFTSIVLGLVAIVLGVVLIIYAFKGRQSQARRTTNWRQRP* |
| Ga0114967_102214292 | 3300010160 | Freshwater Lake | MELFTSIVLGLVAIVLGVVLIIYAFKGRQSQARRTTNWRQ |
| Ga0136644_100427052 | 3300010334 | Freshwater Lake | MELFTSIILGLVAIALGVVLVIYAFKGRQSQARRITNWRQRP* |
| Ga0129324_100108053 | 3300010368 | Freshwater To Marine Saline Gradient | MELFTSVILGLVAIALGVALLVYAFKGRQSQARRITNWRQRP* |
| Ga0133913_100749518 | 3300010885 | Freshwater Lake | MELFTSIILGLVAIALGIALIFYAFRGRQSQVRRPPKFRGRP* |
| Ga0133913_101659015 | 3300010885 | Freshwater Lake | MELFTSIILGLVAIALGVVLIVYAFKGRQSQARRSTNWRQRP* |
| Ga0133913_135414071 | 3300010885 | Freshwater Lake | ACDCLTAKIWRVELFTSIILGLVAIVLGIALIFYAFRGRQSQARRSPRYRGRP* |
| Ga0138308_1077815 | 3300010965 | Lake Chemocline | MELLTSVILGLVAIALGIALIIYAFRGRQSQARRSTKFRGRP* |
| Ga0136709_10223603 | 3300011184 | Freshwater | SYVMELFTSVILGLVAIALGVALVVYAFKGRKSQARTITHWRQRQ* |
| Ga0157550_11793243 | 3300012710 | Freshwater | LTSIILGLVAIALGVVLLIYAFKGRQSQARRTTNWRQHP* |
| Ga0157601_10948031 | 3300012714 | Freshwater | MELFTSVILGLVAIALGVALVLYAFKGRQSQARRITNW |
| Ga0157613_12406473 | 3300012720 | Freshwater | VILGLVANALGVALVLYAFKGRQSQARRITNWRQRP* |
| Ga0157611_11949382 | 3300012724 | Freshwater | FTSVILGLVAIALGVVLIIYAFKGRQSQARRITNWRQRR* |
| Ga0157611_12056493 | 3300012724 | Freshwater | ILGLVAIALGVALIIYAFKGRQSQARRITNWRQRP* |
| Ga0157602_12500921 | 3300012730 | Freshwater | VILGLVAIALGVALVLYAFKGRQSQARRITNWRQRP* |
| Ga0138288_10720542 | 3300012761 | Freshwater Lake | MELFTSVILGLLAIALGVVLVIYAFKGRQSQARRITNWRQRP* |
| Ga0138288_11842812 | 3300012761 | Freshwater Lake | LTATIWSMELLTSVILGLVAIALGIALIFYAFRGRQSQARRSPKFRGRP* |
| Ga0138283_12825424 | 3300012774 | Freshwater Lake | MELLTSVILGLVAIALGIALIFYAFRGRQSQARRSPKFRGRP* |
| Ga0164293_101211392 | 3300013004 | Freshwater | MELFTSVVLALAAIAIGIALIVFAFTGRQSKARRENNWRQNP* |
| Ga0164293_102332453 | 3300013004 | Freshwater | YSYAMELFTSVILGLVAIALGVALVLYAFKGRQSQARRITNWRQRP* |
| Ga0164293_104012602 | 3300013004 | Freshwater | MELFTSVILGLVAIALGVALIVYAFKGRQSQARRITNWRQ |
| Ga0164293_109633841 | 3300013004 | Freshwater | TSVILGLVAIALGVALIVYAFKGRQSQARRITNWRQRR* |
| Ga0164292_101660863 | 3300013005 | Freshwater | AMELFTSVILGLVAIALGVALVVYAFKGRQSQARRITNWRQRP* |
| Ga0164292_103351351 | 3300013005 | Freshwater | VILGLVAIALGVALIVYAFKGRQSQARRITNWRQRR* |
| Ga0164292_110317922 | 3300013005 | Freshwater | ELFTSVILGLVAIALGVALVVYAFKGRQSQARRITRRGH* |
| Ga0163199_10225782 | 3300013092 | Freshwater | MELFTSVILGLVAIALGIALIIYAFRGRQSQARRSPKFRGRP* |
| Ga0136641_100115113 | 3300013286 | Freshwater | MELFTSLILGLVAIAFGVVLVIYAFKGRQSQARRITNWRQRP* |
| Ga0119952_10349542 | 3300014050 | Freshwater | MELFTSVILGLVAIALGVVLVVYAFKGRQSQARRITNWRQRP* |
| Ga0188851_10012323 | 3300018682 | Freshwater Lake | MELFTSVILGLVAIALGVALLVYAFKGRQSQARRITNWRQRP |
| Ga0187842_10588491 | 3300018790 | Freshwater | ELLTSVILGLVAIALGIALIFYAFRGRQSQARQSPKFRGRP |
| Ga0187842_11037733 | 3300018790 | Freshwater | MELFTSVILGLVAIALGVVLVIYALKGRQSQARRITNWRQRP |
| Ga0187845_12890421 | 3300018815 | Freshwater | TSVILGLVAIALGVVLVIYAFKGRQSQARRTTNWRQRP |
| Ga0187844_103959781 | 3300018868 | Freshwater | TTGDCLTATIWSMELLTSVILGLVAIALGIALIFYAFRGRQSQARRSPKFRGRP |
| Ga0194049_10092144 | 3300020157 | Anoxic Zone Freshwater | MELFTSVILGLVAIALGLALILYAFRGRQSQARRSTKFRGRP |
| Ga0211734_102886203 | 3300020159 | Freshwater | MELFTSIILGLVAIALGVVLIIFAFKGRQSQARRITNWRQRP |
| Ga0211726_108235964 | 3300020161 | Freshwater | MELFTSVILGLVAIALGVVLVLYAFKGRQSQARRITNWRQRP |
| Ga0194035_100125414 | 3300020167 | Anoxic Zone Freshwater | MELLTSVILGLVAIALGSALIFYAFRGRQSQARRSPKFRGRP |
| Ga0194035_10077464 | 3300020167 | Anoxic Zone Freshwater | MELFTSIILGIAAIALGVALIIYAFRGRQSQARRSPRFRGRP |
| Ga0208464_1124122 | 3300020482 | Freshwater | FTSVILGLVAIALGVALIIYAFKGRQSQARRITNWRQRP |
| Ga0208463_10092603 | 3300020500 | Freshwater | MELFTSVILGLVAIALGVALIIYAFKGRQSQARRITNW |
| Ga0208463_10117312 | 3300020500 | Freshwater | MELFTSVILGLVAIALGVALVLYAFKGRQSQARRITK |
| Ga0208363_10025823 | 3300020503 | Freshwater | MELLTSVILGLVAIALGIALIFYAFRGRQSQARRSPKFRGRP |
| Ga0208225_10445371 | 3300020508 | Freshwater | SVILGLVAIALGVALVLYAFKGRQSQARRITNWRQRP |
| Ga0207938_10016726 | 3300020525 | Freshwater | MELITSIILGLVAIALGVVLIIFAFKGRQSQARRTSNWRQRS |
| Ga0207938_10064684 | 3300020525 | Freshwater | MELFTSVILGLVAIALGVALVLYAFKGRQSQARRITNWRQRP |
| Ga0208487_10184281 | 3300020531 | Freshwater | MELFTSVILGLVAIALGVALIIYAFKGRQSQARRI |
| Ga0208228_10134281 | 3300020535 | Freshwater | NRYSYAMELFTSVILGLVAIALGVALVLYAFKGRQSQARRITNWRQRP |
| Ga0207939_10037335 | 3300020536 | Freshwater | MELFTSVILGLVAIALGVALIIYAFKGRQSQARRITNWRQRP |
| Ga0207942_10027724 | 3300020549 | Freshwater | MELFTSVILGLVAIALGVALVVYAFKGRQSQARRITNWRQRP |
| Ga0208486_10374521 | 3300020556 | Freshwater | TSVILGLVAIALGVALIIYAFKGRQSQARRITNWRQRR |
| Ga0208229_10543642 | 3300020569 | Freshwater | MELFTSVILGLVAIALGVALVVYAFKGRQSQARRITNW |
| Ga0208053_10021274 | 3300020575 | Freshwater | MELLTSLILGLVAIALGIALIFYAFRGRQSQARRSPKFRGRP |
| Ga0194056_101912521 | 3300021070 | Anoxic Zone Freshwater | MELFTSVILGLVAIVFGIALIFYAFRGRQSQARRAPRFRGRP |
| Ga0194057_103367382 | 3300021072 | Anoxic Zone Freshwater | SITTGDCLSATIWSMELLTSVILGLVAIALGIALIFYAFRGRQSQARRSPKFRGRP |
| Ga0194063_100846101 | 3300021075 | Anoxic Zone Freshwater | LHMELFTSVFLGLVAIALGIALIIYAFRGRQSQARRSTKFRGRP |
| Ga0194051_10291631 | 3300021470 | Anoxic Zone Freshwater | RYSLPMELFTSIILGIAAIALGVALIIYAFRGRQSQARRSPRFRGRP |
| Ga0222713_108192931 | 3300021962 | Estuarine Water | IILGIAAIALGVALIIYAFRGRQSQARRSPRFRGRP |
| Ga0222712_100109055 | 3300021963 | Estuarine Water | MELFTSVILGLVAIALGVALIVYAFKGRQSQARRITNWRQRR |
| Ga0222712_100700282 | 3300021963 | Estuarine Water | MELFTSVILGRVAIALGVALIVYAFKGRQSQARRITNWRQRR |
| Ga0212124_1000149617 | 3300022553 | Freshwater | MELFTSVILGLVAIALGIALIIYAFRGRQSQARRSPKFRGRP |
| Ga0214917_100229768 | 3300022752 | Freshwater | MELFTSVILGLVAIALGVVLVVYAFKGRQSQARRITNWRQRP |
| Ga0214917_100494985 | 3300022752 | Freshwater | MELLTSVILGLVAIALGVALIIYAFKGRQSQARRITNWRQRR |
| Ga0214917_100550534 | 3300022752 | Freshwater | MELFTSVILGLVAIALGVVLVIYAFKGRQSQARRTTNWRQRP |
| Ga0214921_100280567 | 3300023174 | Freshwater | MELFTSVILGLVAIALGVVLVIYAFKGRQSQARRTTHWRQRP |
| Ga0214923_100418754 | 3300023179 | Freshwater | MELLTSIILGLFAIALGVALIIYAFKGRQSQARRITNWRQRR |
| Ga0214919_100769995 | 3300023184 | Freshwater | MELFTSVILGLVAIALGVVLIVYAFKGRQSQARRITNWRQRR |
| Ga0214919_102334093 | 3300023184 | Freshwater | MELLTSIILGLVAIALGVVLVLYAFKGRQSQARRITNWR |
| Ga0244776_101054351 | 3300024348 | Estuarine | GDCLTATIWRMELLTSVILGLVAIALGIALIFYAFRGRQSQARRSPKFRGRP |
| Ga0244776_101839751 | 3300024348 | Estuarine | ELFTSVILGLVAIALGVVLVLYAFKGRQSQARRITNWRQRP |
| Ga0244776_102402203 | 3300024348 | Estuarine | MELFTSVILGLVAIALGVALIIYAFKGRQSQARRITNWRQ |
| Ga0244776_105731691 | 3300024348 | Estuarine | GDCLTATIWSMELLTSVILGLVAIALGIALIFYAFRGRQSQARRSPKFRGRP |
| Ga0244776_106443772 | 3300024348 | Estuarine | MELFTSVILGLVAIAFGVALIVYAFKGRQSQARRITNWRQRR |
| Ga0255229_10584202 | 3300024848 | Freshwater | MELLTSVILGLVAIALGSALIFYAFRGRQSQARRSPNF |
| Ga0256317_11244162 | 3300024862 | Freshwater | MELLTSVILGLVAIALGIALIFYAFRGRQSQARRSPKFR |
| Ga0208249_10526483 | 3300025532 | Freshwater | SIILGLVAIALGVALIIYAFKGRQSQARRITNWRQRR |
| Ga0208249_10689132 | 3300025532 | Freshwater | MELLTSIILGLVAIALGVALIIYAFKGRQSQARRITNWRQRR |
| Ga0208147_11181512 | 3300025635 | Aqueous | IILGLVAIALGVALIIYAFKGRQSQARRITNWRQRR |
| Ga0208443_11054622 | 3300027084 | Estuarine | MELFTSVILGLVAIALGVALLVYAFKGRQSQARRITNWRQRR |
| Ga0208009_10029824 | 3300027114 | Deep Subsurface | MEMFTSVILGLVAIALGVALIIYGFKGRQSQARRTTNWRQRP |
| Ga0255067_10381701 | 3300027129 | Freshwater | ILGLVAIAFGIALIFYAFRGRQSQARRSPKFRGRP |
| Ga0255112_10652621 | 3300027150 | Freshwater | MELLTSVILGLVAIALGIALIFYAFRGRQSQARRSPK |
| Ga0208024_10052791 | 3300027222 | Estuarine | DCLTATIWSMELLTSVILGLVAIALGIALIFYAFRGRQSQARRSPKFRGRP |
| Ga0208440_10972001 | 3300027281 | Estuarine | TSIVLGLVAIVMGVALIIYAFKGRQSQARRTTNWRQRP |
| Ga0208923_10559721 | 3300027320 | Estuarine | LTATIWSMELLTSVILGLVAIALGIALIFYAFRGRQSQARRSPKFRGRP |
| Ga0208556_10589501 | 3300027366 | Estuarine | MELFTSIFLGLVAIVLGVALIIYAFKGRQSQARRTTNWR |
| Ga0208432_10046031 | 3300027380 | Deep Subsurface | MFTSVILGLVAIALGVALIIYGFKGRQSQARRTTNW |
| Ga0208788_10051598 | 3300027499 | Deep Subsurface | MELFTSVILGLVAIALGVALIVYAFKGRQSQARRITNWRQRP |
| Ga0209552_10783531 | 3300027563 | Freshwater Lake | AMELFTSIFLGLVAIVLGAALIIYAFKGRQSQARRTTNWRQRP |
| Ga0209135_12389531 | 3300027642 | Freshwater Lake | ILGLVAIALGVVLVLYAFKGRQSQARRITNWRQRP |
| Ga0209769_10048973 | 3300027679 | Freshwater Lake | MELFTSIILGLVAIALGVVLVIYAFKGRQSQARRITNWRQRP |
| Ga0209553_10727423 | 3300027688 | Freshwater Lake | IILGLVAIALGVVLVIYAFKGRQSQARRITNWRQRP |
| (restricted) Ga0247836_100502517 | 3300027728 | Freshwater | MELFTSIILGLVAIALGVALIIFAFKGRQSQARRTTNWRQRP |
| (restricted) Ga0247836_10355415 | 3300027728 | Freshwater | MELFTSVILGLVAIALGVALIIYAFKGRQSQARRITNWRQRR |
| Ga0209297_100153610 | 3300027733 | Freshwater Lake | MELFTSVFLGLVAIALGIALIIYAFRGRQSQARRSTKFRGRP |
| Ga0209297_10258064 | 3300027733 | Freshwater Lake | MELFTSIILGLVAIALGIALIFYAFRGRQSQVRRPPKFRGRP |
| Ga0209087_13444841 | 3300027734 | Freshwater Lake | ILGLVAIALGVVLVIYAFKGRQSQARRTTNWRQRP |
| Ga0208304_101994921 | 3300027751 | Estuarine | MELLTSVILGLVAIALGIALIFYAFRGRQSQARRSPKFRG |
| Ga0209596_10992593 | 3300027754 | Freshwater Lake | SIILGIAAIALGVALIIYAFRGRQSQARRSPRFRGRP |
| Ga0209444_103114552 | 3300027756 | Freshwater Lake | RMELLTSVILGLVAIALGIALIFYAFRGRQSQARRSPKFRGRP |
| Ga0209296_10331083 | 3300027759 | Freshwater Lake | MELLTSVILGLVAIAFGIALIFYAFRGRQSQARRSPKFRGRP |
| Ga0209134_100000296 | 3300027764 | Freshwater Lake | MELITSIILGLVAIALGVILIIFAFKGRQSQARRTSNWRQRS |
| Ga0209134_101463542 | 3300027764 | Freshwater Lake | MELFTSVILGLVAIALGVVLVVFAFKGRQSQARRTTNWR |
| Ga0209134_102280501 | 3300027764 | Freshwater Lake | MELFTSIFLGLVAIVLGAALIIYAFKGRQSQARRTT |
| Ga0209770_100688251 | 3300027769 | Freshwater Lake | MELFTSIILGLVSIAFGVALIVYAFKGRQSQARRITNWRQRR |
| Ga0209086_100215246 | 3300027770 | Freshwater Lake | IWHVELLTSVILGLAAIALGIALIFYAFFGRQSQARRSPKFRGRP |
| Ga0209086_102092072 | 3300027770 | Freshwater Lake | MELFTSIILGIAAIALGVALIIYAFRGRQSQARRSPRFRG |
| Ga0209768_102102313 | 3300027772 | Freshwater Lake | MELATSIILGLVAIVLGVGLIFYAFRGRQSQARSS |
| Ga0209353_100214743 | 3300027798 | Freshwater Lake | MELFTSIVLGLVAIVMGVALIIYAFKGRQSQARRTTNWRQRP |
| Ga0209353_104247991 | 3300027798 | Freshwater Lake | SVILGLVAIALGIALIYYAFRGRQSQARRSPKFRGRP |
| Ga0209353_104267881 | 3300027798 | Freshwater Lake | ILGLVAIAIGVVLIVFAFTGRQSQARRNGNWRQRR |
| Ga0209358_102339613 | 3300027804 | Freshwater Lake | LFNRYSYAMELFTSVILGLVAIALGVALVLYAFKGRQSQARRITNWRQRP |
| Ga0209229_101558711 | 3300027805 | Freshwater And Sediment | MELFTSVILGLVAIALGVALVVYAFKGRQSQARRITR |
| Ga0209229_101801083 | 3300027805 | Freshwater And Sediment | RYSLAMELFTSVILGLVAIALGVALVVYAFKGRQSQARRITNWRQRP |
| Ga0209229_105256681 | 3300027805 | Freshwater And Sediment | MELFTSVILGLVAIALGVALIVYAFKGRQSQARRI |
| Ga0209230_100020261 | 3300027836 | Freshwater And Sediment | ELLTSVILGLVAIALGIALIYYAFRGRQSQARRSPKFRGRP |
| Ga0209191_11584341 | 3300027969 | Freshwater Lake | AMELLTSIILGLVAIALGVALIIYAFKGRQSQARRITNWRQRR |
| Ga0209702_100024209 | 3300027976 | Freshwater | MELFTSVTLGLVAIALGIALIIYAFKGRQSQARRNNNWRVRR |
| (restricted) Ga0247838_11291512 | 3300028044 | Freshwater | MELFTSMILGLVAIALGVVLIIFAFKGRQSQARRTTNWRQRP |
| Ga0255254_10115234 | 3300028105 | Freshwater | MELLTSVILGLIAIALGIALIYYAFRGRQSQARRSPKF |
| Ga0256305_11342481 | 3300028108 | Freshwater | MELLTSVILGLVAIALGIALIFYAFRGRQSQARRS |
| Ga0265593_10683952 | 3300028178 | Saline Water | MELLTSVILGLVAIALGIALIFYAFRGRQSQARRSPKFRGR |
| Ga0304730_10129691 | 3300028394 | Freshwater Lake | ELFTSVILGLVAIALGVVLVIYAFKGRQSQARRITNWRQRP |
| Ga0304730_11387681 | 3300028394 | Freshwater Lake | MELFTSIVLGLVAIVLGVVLIIYAFKGRQSQARRTTNWR |
| Ga0315907_102436061 | 3300031758 | Freshwater | TSIILGLVAIALGVVLIIFAFKGRQSQARRTSNWRQRS |
| Ga0315899_100312065 | 3300031784 | Freshwater | MELFTSVILGLVAIALGAALVLYAFKGRQSQARRITNWRQRP |
| Ga0315908_100025996 | 3300031786 | Freshwater | MELFTSVILGLVAIALGVALIIYAFKGRQSHARRTTNWRQRP |
| Ga0315908_100374545 | 3300031786 | Freshwater | MELLTSIILGLVAIALGVVLLIYAFKGRQSQARRTTNWRQRP |
| Ga0315908_101284024 | 3300031786 | Freshwater | ELFTSVILGLVAIALGVALIIYAFKGRQSQARRITNWRQRP |
| Ga0315908_102100662 | 3300031786 | Freshwater | MELFTSVILGLVAMGLGVVLVIYAFKGRQSQARRTTNWRQRP |
| Ga0315900_109448271 | 3300031787 | Freshwater | TSVVLALAAIAIGIALIVFAFTGRQSKARRKNNWRQNP |
| Ga0315904_100959514 | 3300031951 | Freshwater | MELFTSVILGLVAIALGIALVVYAFKGRQSQARRITRRGH |
| Ga0315904_102692994 | 3300031951 | Freshwater | MELFTSVVLALSAIAIGIALIVFAFTGRQSKARRNKNWRQ |
| Ga0315904_107068571 | 3300031951 | Freshwater | MELFTSVILGLVAIALGVALVLYAFKGRQSQARRITN |
| Ga0315906_102934051 | 3300032050 | Freshwater | MELFTSVVLGLVAIALGVVLIIFAFKGRQSQARRTTNWRQR |
| Ga0315905_106855663 | 3300032092 | Freshwater | TTGDCLTATIWRMELLTSVILGLVAIALGIALIFYAFRGRQSQARRSPKFRGRP |
| Ga0315903_100118228 | 3300032116 | Freshwater | MELFTSVVLGLTAIALGVALIIFALTGRQSKARRRSNWRENP |
| Ga0334978_0074507_1588_1737 | 3300033979 | Freshwater | FNRYSYAMELFTSVILGLVAIALGVALVLYAFKGRQSQARRITNWRQRP |
| Ga0334978_0291740_651_782 | 3300033979 | Freshwater | AMELFTSVILGLVAIALGVALIIYAFKGRQSQARRITNWRQRP |
| Ga0334989_0609164_2_118 | 3300033984 | Freshwater | MELFTSVILGLVAIALGVALIIYAFKGRQSQARRITNWR |
| Ga0334992_0102222_1213_1341 | 3300033992 | Freshwater | MELFTSVVLALAAIAIGIALIVFAFTGRQSKARRENNWRQNP |
| Ga0334996_0129999_2_115 | 3300033994 | Freshwater | SVILGLVAIALGVALIIYAFKGRQSQARRITNWRQRR |
| Ga0335003_0223355_304_432 | 3300033995 | Freshwater | MELFTSVVLALAAIAIGIALIVFAFTGRQSKARRNNNWRKNP |
| Ga0334979_0120477_1493_1612 | 3300033996 | Freshwater | MELFTSVILGLVAIALGVALVLYAFKGRQSQARRITNWRQ |
| Ga0334986_0544178_2_115 | 3300034012 | Freshwater | SVILGLVAIALGVALIIYAFKGRQSQARRSTNWRQRP |
| Ga0334985_0479735_611_721 | 3300034018 | Freshwater | MELFTSIILGLVAIALGVVLVLYAFKGRQSQARRITN |
| Ga0335004_0074431_2180_2323 | 3300034021 | Freshwater | RYSYAMELFTSVILGLVAIALGVALVVYAFKGRQSQARRITNWRQRP |
| Ga0334995_0711762_409_561 | 3300034062 | Freshwater | LFNRYSYAMELFTSVILGLVAIALGVALVVYAFKGRQSQARRITNWRQRP |
| Ga0335019_0024647_2_154 | 3300034066 | Freshwater | CLSATIWSMELLTSVILGLVAIALGIALIFYAFRGRQSQARRSPKFRGRP |
| Ga0335019_0543589_186_314 | 3300034066 | Freshwater | MELFTSVVLALSAIAIGIALIVFAFTGRQSKARRNKNWRQNP |
| Ga0335010_0135496_1473_1580 | 3300034092 | Freshwater | ILGLVAIALGVALIIYAFKGRQSQARRITNWRQRP |
| Ga0335010_0546595_427_597 | 3300034092 | Freshwater | SITTGDCLTATIWSMELLTSVILGLVAIALGIALIFYAFRGRQSQARRSPKFRGRP |
| Ga0335022_0450280_1_114 | 3300034095 | Freshwater | MELFTSIILGLVAIALGVVLIVYAFKGRQSQARRSTNW |
| Ga0335022_0566056_2_142 | 3300034095 | Freshwater | YPLAMELFTSVILGLVAIALGVALIVYAFKGRQSQARRITNWRQRR |
| Ga0335029_0709127_437_544 | 3300034102 | Freshwater | ILGLVAIALGVVLVIYSFKGRQSQARRSTNWRQRP |
| Ga0335031_0259480_1044_1148 | 3300034104 | Freshwater | MELFTSVILGLVAIALGVALVLYAFKGRQSQARRI |
| Ga0335050_0242160_790_900 | 3300034108 | Freshwater | VVLALAAIAIGIALIVFAFTGRQSKARRENNWRQNP |
| Ga0335051_0135194_3_110 | 3300034109 | Freshwater | MELLTSVILGLVAIALGIALIFYAFRGRQSQARRSP |
| Ga0335053_0688450_460_576 | 3300034118 | Freshwater | TSVILGLVAIALGVALVLYAFKGRQSQARRITNWRQRP |
| Ga0335058_0281504_2_142 | 3300034121 | Freshwater | YSYAMELFTSVILGLVAIALGVALVLYAFKGRQSQARRITNWRQRP |
| Ga0335058_0690066_3_119 | 3300034121 | Freshwater | MELATSIILGLAAIVLGIALIFYAFRGRQSQARSSRDYK |
| Ga0335016_0584729_488_610 | 3300034166 | Freshwater | LLTSVILGLVAIALGIALIFYAFRGRQSQARRSPKFRGRP |
| Ga0335013_0726455_2_124 | 3300034284 | Freshwater | MELFTSVILGLVAIALGVALIIYAFKGRQSQARRITNWRQR |
| Ga0335048_0196419_979_1113 | 3300034356 | Freshwater | YAMELFTSVILGLVAIALGVALVVYAFKGRQSQARRITNWRQRP |
| Ga0335048_0450097_519_626 | 3300034356 | Freshwater | ILGLVAIALGVALIIYAFKGRQSQARRSTNWRQRP |
| Ga0335064_0118284_1480_1611 | 3300034357 | Freshwater | TMELFTSVILGLVAIALGVALIVYAFKGRQSQARRITNWRQRR |
| Ga0335064_0776672_426_587 | 3300034357 | Freshwater | TGDCLTATIWSMELLTSVILGLIAIALGIALIYYAFRGRQSQARRSPKFRGRP |
| ⦗Top⦘ |