| Basic Information | |
|---|---|
| Family ID | F016193 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 249 |
| Average Sequence Length | 45 residues |
| Representative Sequence | RLMWIGDEGRVGIRFAVIEPALFEQLQHWTNRKMKEEGWEFPA |
| Number of Associated Samples | 200 |
| Number of Associated Scaffolds | 249 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 1.61 % |
| % of genes near scaffold ends (potentially truncated) | 96.39 % |
| % of genes from short scaffolds (< 2000 bps) | 89.56 % |
| Associated GOLD sequencing projects | 186 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.46 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (73.092 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (10.442 % of family members) |
| Environment Ontology (ENVO) | Unclassified (21.687 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (52.610 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 23.94% β-sheet: 8.45% Coil/Unstructured: 67.61% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.46 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 249 Family Scaffolds |
|---|---|---|
| PF04519 | Bactofilin | 16.87 |
| PF04011 | LemA | 12.45 |
| PF04223 | CitF | 11.65 |
| PF02744 | GalP_UDP_tr_C | 5.22 |
| PF07238 | PilZ | 4.42 |
| PF00578 | AhpC-TSA | 3.61 |
| PF01641 | SelR | 2.81 |
| PF00704 | Glyco_hydro_18 | 2.01 |
| PF13432 | TPR_16 | 1.61 |
| PF00356 | LacI | 1.20 |
| PF03706 | LPG_synthase_TM | 1.20 |
| PF05345 | He_PIG | 0.80 |
| PF13185 | GAF_2 | 0.80 |
| PF13487 | HD_5 | 0.80 |
| PF03328 | HpcH_HpaI | 0.80 |
| PF07715 | Plug | 0.80 |
| PF08331 | QueG_DUF1730 | 0.40 |
| PF02899 | Phage_int_SAM_1 | 0.40 |
| PF02554 | CstA | 0.40 |
| PF02416 | TatA_B_E | 0.40 |
| PF07883 | Cupin_2 | 0.40 |
| PF02687 | FtsX | 0.40 |
| PF13683 | rve_3 | 0.40 |
| PF09286 | Pro-kuma_activ | 0.40 |
| PF07676 | PD40 | 0.40 |
| PF06751 | EutB | 0.40 |
| PF12543 | DUF3738 | 0.40 |
| PF01202 | SKI | 0.40 |
| PF13414 | TPR_11 | 0.40 |
| PF00180 | Iso_dh | 0.40 |
| PF02129 | Peptidase_S15 | 0.40 |
| PF12146 | Hydrolase_4 | 0.40 |
| PF01909 | NTP_transf_2 | 0.40 |
| PF13565 | HTH_32 | 0.40 |
| PF13619 | KTSC | 0.40 |
| PF13561 | adh_short_C2 | 0.40 |
| PF13088 | BNR_2 | 0.40 |
| PF03693 | ParD_antitoxin | 0.40 |
| COG ID | Name | Functional Category | % Frequency in 249 Family Scaffolds |
|---|---|---|---|
| COG1664 | Cytoskeletal protein CcmA, bactofilin family | Cytoskeleton [Z] | 16.87 |
| COG1704 | Magnetosome formation protein MamQ, lipoprotein antigen LemA family | Cell wall/membrane/envelope biogenesis [M] | 12.45 |
| COG3051 | Citrate lyase, alpha subunit | Energy production and conversion [C] | 11.65 |
| COG0229 | Peptide methionine sulfoxide reductase MsrB | Posttranslational modification, protein turnover, chaperones [O] | 2.81 |
| COG0392 | Predicted membrane flippase AglD2/YbhN, UPF0104 family | Cell wall/membrane/envelope biogenesis [M] | 1.20 |
| COG0469 | Pyruvate kinase | Carbohydrate transport and metabolism [G] | 0.80 |
| COG2301 | Citrate lyase beta subunit | Carbohydrate transport and metabolism [G] | 0.80 |
| COG3836 | 2-keto-3-deoxy-L-rhamnonate aldolase RhmA | Carbohydrate transport and metabolism [G] | 0.80 |
| COG1600 | Epoxyqueuosine reductase QueG (queuosine biosynthesis) | Translation, ribosomal structure and biogenesis [J] | 0.40 |
| COG1826 | Twin-arginine protein secretion pathway components TatA and TatB | Intracellular trafficking, secretion, and vesicular transport [U] | 0.40 |
| COG1966 | Carbon starvation protein CstA (peptide/pyruvate transporter) | Energy production and conversion [C] | 0.40 |
| COG3609 | Transcriptional regulator, contains Arc/MetJ-type RHH (ribbon-helix-helix) DNA-binding domain | Transcription [K] | 0.40 |
| COG4303 | Ethanolamine ammonia-lyase, large subunit | Amino acid transport and metabolism [E] | 0.40 |
| COG4934 | Serine protease, subtilase family | Posttranslational modification, protein turnover, chaperones [O] | 0.40 |
| COG4973 | Site-specific recombinase XerC | Replication, recombination and repair [L] | 0.40 |
| COG4974 | Site-specific recombinase XerD | Replication, recombination and repair [L] | 0.40 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 73.09 % |
| Unclassified | root | N/A | 26.91 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000567|JGI12270J11330_10050492 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2230 | Open in IMG/M |
| 3300001180|JGI12695J13573_1010098 | Not Available | 644 | Open in IMG/M |
| 3300001356|JGI12269J14319_10193488 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → Luteitalea pratensis | 808 | Open in IMG/M |
| 3300001593|JGI12635J15846_10119128 | All Organisms → cellular organisms → Bacteria | 1867 | Open in IMG/M |
| 3300001593|JGI12635J15846_10270273 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1080 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100033787 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 4553 | Open in IMG/M |
| 3300004080|Ga0062385_10217270 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1044 | Open in IMG/M |
| 3300004082|Ga0062384_100644987 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 723 | Open in IMG/M |
| 3300004091|Ga0062387_101592607 | Not Available | 527 | Open in IMG/M |
| 3300004092|Ga0062389_100761868 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1145 | Open in IMG/M |
| 3300004475|Ga0068969_1007939 | Not Available | 506 | Open in IMG/M |
| 3300004635|Ga0062388_100382452 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1215 | Open in IMG/M |
| 3300004635|Ga0062388_100447060 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1139 | Open in IMG/M |
| 3300005176|Ga0066679_10634375 | Not Available | 696 | Open in IMG/M |
| 3300005329|Ga0070683_100697711 | Not Available | 972 | Open in IMG/M |
| 3300005436|Ga0070713_100253425 | Not Available | 1606 | Open in IMG/M |
| 3300005436|Ga0070713_100554857 | Not Available | 1088 | Open in IMG/M |
| 3300005518|Ga0070699_100888549 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 816 | Open in IMG/M |
| 3300005534|Ga0070735_10259134 | Not Available | 1053 | Open in IMG/M |
| 3300005554|Ga0066661_10736155 | Not Available | 578 | Open in IMG/M |
| 3300005557|Ga0066704_10660672 | Not Available | 663 | Open in IMG/M |
| 3300005566|Ga0066693_10068367 | Not Available | 1226 | Open in IMG/M |
| 3300005569|Ga0066705_10760733 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
| 3300005598|Ga0066706_11356727 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Alloacidobacterium → Alloacidobacterium dinghuense | 537 | Open in IMG/M |
| 3300005712|Ga0070764_10131708 | All Organisms → cellular organisms → Bacteria | 1361 | Open in IMG/M |
| 3300005712|Ga0070764_10693251 | Not Available | 627 | Open in IMG/M |
| 3300005952|Ga0080026_10022420 | All Organisms → cellular organisms → Bacteria | 1545 | Open in IMG/M |
| 3300006028|Ga0070717_10108076 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2370 | Open in IMG/M |
| 3300006028|Ga0070717_11080501 | Not Available | 731 | Open in IMG/M |
| 3300006028|Ga0070717_11957345 | Not Available | 528 | Open in IMG/M |
| 3300006052|Ga0075029_100000607 | All Organisms → cellular organisms → Bacteria | 20686 | Open in IMG/M |
| 3300006052|Ga0075029_100268471 | Not Available | 1082 | Open in IMG/M |
| 3300006052|Ga0075029_100722677 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 673 | Open in IMG/M |
| 3300006052|Ga0075029_101323379 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300006086|Ga0075019_11155661 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 504 | Open in IMG/M |
| 3300006162|Ga0075030_100599626 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 874 | Open in IMG/M |
| 3300006162|Ga0075030_100701498 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 801 | Open in IMG/M |
| 3300006162|Ga0075030_101487166 | Not Available | 530 | Open in IMG/M |
| 3300006173|Ga0070716_100202878 | Not Available | 1319 | Open in IMG/M |
| 3300006174|Ga0075014_100410417 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 740 | Open in IMG/M |
| 3300006174|Ga0075014_100792431 | Not Available | 559 | Open in IMG/M |
| 3300006176|Ga0070765_100265978 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1577 | Open in IMG/M |
| 3300006176|Ga0070765_100300416 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1484 | Open in IMG/M |
| 3300006800|Ga0066660_10406204 | All Organisms → cellular organisms → Bacteria | 1126 | Open in IMG/M |
| 3300006800|Ga0066660_11336735 | Not Available | 561 | Open in IMG/M |
| 3300006806|Ga0079220_11761201 | Not Available | 544 | Open in IMG/M |
| 3300006893|Ga0073928_10763006 | Not Available | 671 | Open in IMG/M |
| 3300007982|Ga0102924_1088518 | Not Available | 1604 | Open in IMG/M |
| 3300009029|Ga0066793_10688920 | Not Available | 581 | Open in IMG/M |
| 3300009520|Ga0116214_1096603 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1086 | Open in IMG/M |
| 3300009524|Ga0116225_1009472 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 5397 | Open in IMG/M |
| 3300009628|Ga0116125_1147489 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 651 | Open in IMG/M |
| 3300009638|Ga0116113_1091988 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 727 | Open in IMG/M |
| 3300009672|Ga0116215_1073023 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1546 | Open in IMG/M |
| 3300009764|Ga0116134_1036055 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1939 | Open in IMG/M |
| 3300010043|Ga0126380_10265323 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1199 | Open in IMG/M |
| 3300010043|Ga0126380_11379628 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 618 | Open in IMG/M |
| 3300010335|Ga0134063_10671350 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300010339|Ga0074046_10238902 | All Organisms → cellular organisms → Bacteria | 1131 | Open in IMG/M |
| 3300010341|Ga0074045_10736524 | Not Available | 625 | Open in IMG/M |
| 3300010361|Ga0126378_11585212 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 743 | Open in IMG/M |
| 3300010376|Ga0126381_100354152 | All Organisms → cellular organisms → Bacteria | 2030 | Open in IMG/M |
| 3300010379|Ga0136449_100607027 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1863 | Open in IMG/M |
| 3300010379|Ga0136449_102329455 | All Organisms → cellular organisms → Bacteria | 775 | Open in IMG/M |
| 3300011270|Ga0137391_10242885 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1562 | Open in IMG/M |
| 3300012176|Ga0153952_1103771 | All Organisms → cellular organisms → Bacteria | 623 | Open in IMG/M |
| 3300012202|Ga0137363_11471660 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
| 3300012203|Ga0137399_10612436 | Not Available | 916 | Open in IMG/M |
| 3300012208|Ga0137376_10365981 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1252 | Open in IMG/M |
| 3300012208|Ga0137376_10613254 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 941 | Open in IMG/M |
| 3300012208|Ga0137376_10815708 | Not Available | 803 | Open in IMG/M |
| 3300012212|Ga0150985_106218673 | Not Available | 829 | Open in IMG/M |
| 3300012350|Ga0137372_10117651 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2207 | Open in IMG/M |
| 3300012359|Ga0137385_11499395 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 538 | Open in IMG/M |
| 3300012361|Ga0137360_11417186 | Not Available | 598 | Open in IMG/M |
| 3300012363|Ga0137390_10162668 | All Organisms → cellular organisms → Bacteria | 2219 | Open in IMG/M |
| 3300012469|Ga0150984_116446463 | Not Available | 1205 | Open in IMG/M |
| 3300012582|Ga0137358_10611049 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 731 | Open in IMG/M |
| 3300012927|Ga0137416_10612539 | Not Available | 949 | Open in IMG/M |
| 3300012930|Ga0137407_11349061 | All Organisms → cellular organisms → Bacteria | 678 | Open in IMG/M |
| 3300012944|Ga0137410_10873002 | Not Available | 759 | Open in IMG/M |
| 3300014164|Ga0181532_10023029 | All Organisms → cellular organisms → Bacteria | 4469 | Open in IMG/M |
| 3300014165|Ga0181523_10553133 | Not Available | 634 | Open in IMG/M |
| 3300014167|Ga0181528_10079808 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1789 | Open in IMG/M |
| 3300014200|Ga0181526_10258511 | All Organisms → cellular organisms → Bacteria | 1110 | Open in IMG/M |
| 3300014491|Ga0182014_10649384 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 503 | Open in IMG/M |
| 3300014495|Ga0182015_10012889 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 7371 | Open in IMG/M |
| 3300014657|Ga0181522_10832258 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| 3300015193|Ga0167668_1014836 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1752 | Open in IMG/M |
| 3300015241|Ga0137418_10181112 | All Organisms → cellular organisms → Bacteria | 1835 | Open in IMG/M |
| 3300015358|Ga0134089_10299212 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 668 | Open in IMG/M |
| 3300015371|Ga0132258_12719070 | Not Available | 1234 | Open in IMG/M |
| 3300015374|Ga0132255_100288363 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2359 | Open in IMG/M |
| 3300015374|Ga0132255_103896875 | Not Available | 634 | Open in IMG/M |
| 3300016341|Ga0182035_11682324 | Not Available | 573 | Open in IMG/M |
| 3300017822|Ga0187802_10467520 | Not Available | 500 | Open in IMG/M |
| 3300017939|Ga0187775_10542337 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 500 | Open in IMG/M |
| 3300017955|Ga0187817_11061402 | Not Available | 519 | Open in IMG/M |
| 3300017959|Ga0187779_11164030 | Not Available | 541 | Open in IMG/M |
| 3300017972|Ga0187781_10074750 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2338 | Open in IMG/M |
| 3300017972|Ga0187781_10909656 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 641 | Open in IMG/M |
| 3300017972|Ga0187781_11171492 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 565 | Open in IMG/M |
| 3300017972|Ga0187781_11253914 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 546 | Open in IMG/M |
| 3300017975|Ga0187782_10066139 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2636 | Open in IMG/M |
| 3300017995|Ga0187816_10084530 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1353 | Open in IMG/M |
| 3300017998|Ga0187870_1319816 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 518 | Open in IMG/M |
| 3300018006|Ga0187804_10327518 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 671 | Open in IMG/M |
| 3300018007|Ga0187805_10149932 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1061 | Open in IMG/M |
| 3300018007|Ga0187805_10613664 | Not Available | 514 | Open in IMG/M |
| 3300018009|Ga0187884_10213018 | Not Available | 794 | Open in IMG/M |
| 3300018012|Ga0187810_10209542 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 793 | Open in IMG/M |
| 3300018012|Ga0187810_10257222 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 717 | Open in IMG/M |
| 3300018012|Ga0187810_10354029 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 612 | Open in IMG/M |
| 3300018018|Ga0187886_1292500 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
| 3300018021|Ga0187882_1400695 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 521 | Open in IMG/M |
| 3300018033|Ga0187867_10432856 | Not Available | 727 | Open in IMG/M |
| 3300018033|Ga0187867_10804854 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 509 | Open in IMG/M |
| 3300018034|Ga0187863_10058391 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2194 | Open in IMG/M |
| 3300018042|Ga0187871_10357967 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 806 | Open in IMG/M |
| 3300018042|Ga0187871_10620285 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 600 | Open in IMG/M |
| 3300018062|Ga0187784_11015431 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 659 | Open in IMG/M |
| 3300018085|Ga0187772_10040011 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2836 | Open in IMG/M |
| 3300018090|Ga0187770_10630087 | Not Available | 853 | Open in IMG/M |
| 3300018090|Ga0187770_10783929 | All Organisms → cellular organisms → Bacteria | 763 | Open in IMG/M |
| 3300018090|Ga0187770_11498281 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 549 | Open in IMG/M |
| 3300018468|Ga0066662_10285379 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1375 | Open in IMG/M |
| 3300018468|Ga0066662_11700616 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 660 | Open in IMG/M |
| 3300019082|Ga0187852_1212293 | Not Available | 795 | Open in IMG/M |
| 3300019260|Ga0181506_1402718 | All Organisms → cellular organisms → Bacteria | 700 | Open in IMG/M |
| 3300019789|Ga0137408_1167478 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira | 730 | Open in IMG/M |
| 3300020579|Ga0210407_10654960 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 816 | Open in IMG/M |
| 3300020581|Ga0210399_10393740 | All Organisms → cellular organisms → Bacteria | 1155 | Open in IMG/M |
| 3300021170|Ga0210400_11330869 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 575 | Open in IMG/M |
| 3300021180|Ga0210396_11472302 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 561 | Open in IMG/M |
| 3300021181|Ga0210388_11476830 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 568 | Open in IMG/M |
| 3300021401|Ga0210393_10470011 | Not Available | 1027 | Open in IMG/M |
| 3300021402|Ga0210385_10168407 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1577 | Open in IMG/M |
| 3300021402|Ga0210385_10294899 | Not Available | 1201 | Open in IMG/M |
| 3300021402|Ga0210385_11159995 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 593 | Open in IMG/M |
| 3300021405|Ga0210387_10298495 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1417 | Open in IMG/M |
| 3300021405|Ga0210387_10447477 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1146 | Open in IMG/M |
| 3300021406|Ga0210386_11600204 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 541 | Open in IMG/M |
| 3300021407|Ga0210383_10861983 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 773 | Open in IMG/M |
| 3300021407|Ga0210383_11175585 | Not Available | 645 | Open in IMG/M |
| 3300021433|Ga0210391_10059832 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3023 | Open in IMG/M |
| 3300021433|Ga0210391_11293778 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii | 563 | Open in IMG/M |
| 3300021474|Ga0210390_10488306 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii | 1038 | Open in IMG/M |
| 3300021478|Ga0210402_10758112 | All Organisms → cellular organisms → Bacteria | 895 | Open in IMG/M |
| 3300022522|Ga0242659_1011467 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1245 | Open in IMG/M |
| 3300022557|Ga0212123_10225829 | Not Available | 1364 | Open in IMG/M |
| 3300022721|Ga0242666_1178248 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300022726|Ga0242654_10091196 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 942 | Open in IMG/M |
| 3300024225|Ga0224572_1022956 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1198 | Open in IMG/M |
| 3300024233|Ga0224521_1057663 | Not Available | 860 | Open in IMG/M |
| 3300025414|Ga0208935_1008345 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1439 | Open in IMG/M |
| 3300025414|Ga0208935_1052542 | Not Available | 545 | Open in IMG/M |
| 3300025444|Ga0208189_1033810 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1021 | Open in IMG/M |
| 3300025501|Ga0208563_1067062 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 732 | Open in IMG/M |
| 3300025507|Ga0208188_1133917 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 535 | Open in IMG/M |
| 3300025918|Ga0207662_10619502 | Not Available | 754 | Open in IMG/M |
| 3300025922|Ga0207646_10060331 | All Organisms → cellular organisms → Bacteria | 3387 | Open in IMG/M |
| 3300026294|Ga0209839_10202454 | Not Available | 637 | Open in IMG/M |
| 3300026481|Ga0257155_1050503 | Not Available | 649 | Open in IMG/M |
| 3300026482|Ga0257172_1010169 | All Organisms → cellular organisms → Bacteria | 1538 | Open in IMG/M |
| 3300026515|Ga0257158_1054389 | All Organisms → cellular organisms → Bacteria | 744 | Open in IMG/M |
| 3300026551|Ga0209648_10111352 | All Organisms → cellular organisms → Bacteria | 2225 | Open in IMG/M |
| 3300026984|Ga0208732_1025482 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
| 3300027080|Ga0208237_1009292 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1439 | Open in IMG/M |
| 3300027158|Ga0208725_1052335 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 613 | Open in IMG/M |
| 3300027537|Ga0209419_1078702 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 651 | Open in IMG/M |
| 3300027575|Ga0209525_1051793 | All Organisms → cellular organisms → Bacteria | 1000 | Open in IMG/M |
| 3300027587|Ga0209220_1139181 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 630 | Open in IMG/M |
| 3300027590|Ga0209116_1030369 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1140 | Open in IMG/M |
| 3300027645|Ga0209117_1079200 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 922 | Open in IMG/M |
| 3300027662|Ga0208565_1070365 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1086 | Open in IMG/M |
| 3300027698|Ga0209446_1114458 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 694 | Open in IMG/M |
| 3300027701|Ga0209447_10075176 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 926 | Open in IMG/M |
| 3300027767|Ga0209655_10282292 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
| 3300027768|Ga0209772_10296274 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 513 | Open in IMG/M |
| 3300027826|Ga0209060_10147700 | Not Available | 1091 | Open in IMG/M |
| 3300027853|Ga0209274_10172818 | All Organisms → cellular organisms → Bacteria | 1094 | Open in IMG/M |
| 3300027855|Ga0209693_10361889 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 703 | Open in IMG/M |
| 3300027867|Ga0209167_10550320 | Not Available | 632 | Open in IMG/M |
| 3300027869|Ga0209579_10284825 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 890 | Open in IMG/M |
| 3300027884|Ga0209275_10122605 | All Organisms → cellular organisms → Bacteria | 1353 | Open in IMG/M |
| 3300027889|Ga0209380_10015880 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 4289 | Open in IMG/M |
| 3300027889|Ga0209380_10440228 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 762 | Open in IMG/M |
| 3300027894|Ga0209068_10075816 | Not Available | 1743 | Open in IMG/M |
| 3300027898|Ga0209067_10224485 | Not Available | 1016 | Open in IMG/M |
| 3300027908|Ga0209006_10141094 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2118 | Open in IMG/M |
| 3300027908|Ga0209006_11020260 | All Organisms → cellular organisms → Bacteria | 657 | Open in IMG/M |
| 3300027908|Ga0209006_11049010 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 646 | Open in IMG/M |
| 3300027911|Ga0209698_10000529 | All Organisms → cellular organisms → Bacteria | 43572 | Open in IMG/M |
| 3300027911|Ga0209698_10063886 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3170 | Open in IMG/M |
| 3300027911|Ga0209698_10568011 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 874 | Open in IMG/M |
| 3300027986|Ga0209168_10183087 | Not Available | 1053 | Open in IMG/M |
| 3300028047|Ga0209526_10256250 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1195 | Open in IMG/M |
| 3300028047|Ga0209526_10276037 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1143 | Open in IMG/M |
| 3300028047|Ga0209526_10729915 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 621 | Open in IMG/M |
| 3300028572|Ga0302152_10323002 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 509 | Open in IMG/M |
| 3300028574|Ga0302153_10090132 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1040 | Open in IMG/M |
| 3300028789|Ga0302232_10481974 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 610 | Open in IMG/M |
| 3300028806|Ga0302221_10399083 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
| 3300028877|Ga0302235_10098130 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1335 | Open in IMG/M |
| 3300028906|Ga0308309_10269131 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1432 | Open in IMG/M |
| 3300029817|Ga0247275_1172871 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 534 | Open in IMG/M |
| 3300029919|Ga0302141_1063946 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 995 | Open in IMG/M |
| 3300029922|Ga0311363_11461881 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 551 | Open in IMG/M |
| 3300029939|Ga0311328_10738620 | All Organisms → cellular organisms → Bacteria | 662 | Open in IMG/M |
| 3300029943|Ga0311340_10600362 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 962 | Open in IMG/M |
| 3300029951|Ga0311371_11814796 | All Organisms → cellular organisms → Bacteria | 658 | Open in IMG/M |
| 3300029951|Ga0311371_12243183 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| 3300030518|Ga0302275_10411490 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 703 | Open in IMG/M |
| 3300030578|Ga0210275_10136905 | All Organisms → cellular organisms → Bacteria | 718 | Open in IMG/M |
| 3300030659|Ga0316363_10050388 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1993 | Open in IMG/M |
| 3300030693|Ga0302313_10096434 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1233 | Open in IMG/M |
| 3300030760|Ga0265762_1084431 | Not Available | 685 | Open in IMG/M |
| 3300030760|Ga0265762_1127513 | Not Available | 587 | Open in IMG/M |
| 3300031057|Ga0170834_111072404 | Not Available | 528 | Open in IMG/M |
| 3300031231|Ga0170824_122007387 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1102 | Open in IMG/M |
| 3300031249|Ga0265339_10140117 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1231 | Open in IMG/M |
| 3300031525|Ga0302326_11002054 | All Organisms → cellular organisms → Bacteria | 1174 | Open in IMG/M |
| 3300031525|Ga0302326_13259992 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 546 | Open in IMG/M |
| 3300031708|Ga0310686_100443608 | All Organisms → cellular organisms → Bacteria | 620 | Open in IMG/M |
| 3300031718|Ga0307474_10017802 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 5154 | Open in IMG/M |
| 3300031718|Ga0307474_10455122 | All Organisms → cellular organisms → Bacteria | 1001 | Open in IMG/M |
| 3300031718|Ga0307474_10816270 | Not Available | 738 | Open in IMG/M |
| 3300031720|Ga0307469_10965610 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 793 | Open in IMG/M |
| 3300031754|Ga0307475_10794660 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 751 | Open in IMG/M |
| 3300031798|Ga0318523_10531461 | Not Available | 581 | Open in IMG/M |
| 3300031890|Ga0306925_12179020 | Not Available | 516 | Open in IMG/M |
| 3300031910|Ga0306923_10186646 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2369 | Open in IMG/M |
| 3300032076|Ga0306924_11363857 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 758 | Open in IMG/M |
| 3300032160|Ga0311301_11280135 | All Organisms → cellular organisms → Bacteria | 929 | Open in IMG/M |
| 3300032180|Ga0307471_100515859 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1345 | Open in IMG/M |
| 3300032515|Ga0348332_14773194 | All Organisms → cellular organisms → Bacteria | 1307 | Open in IMG/M |
| 3300032782|Ga0335082_11054512 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 678 | Open in IMG/M |
| 3300032782|Ga0335082_11645123 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 515 | Open in IMG/M |
| 3300032783|Ga0335079_11263507 | Not Available | 739 | Open in IMG/M |
| 3300032805|Ga0335078_11645281 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 708 | Open in IMG/M |
| 3300032828|Ga0335080_12187566 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 532 | Open in IMG/M |
| 3300032893|Ga0335069_11878732 | Not Available | 634 | Open in IMG/M |
| 3300032898|Ga0335072_10146010 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2911 | Open in IMG/M |
| 3300033179|Ga0307507_10611976 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 560 | Open in IMG/M |
| 3300033755|Ga0371489_0493758 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 543 | Open in IMG/M |
| 3300034070|Ga0334822_070454 | Not Available | 746 | Open in IMG/M |
| 3300034195|Ga0370501_0251102 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 631 | Open in IMG/M |
| 3300034199|Ga0370514_178026 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 552 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 10.44% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 7.63% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.43% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 6.02% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 4.82% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 4.42% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 4.42% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 4.02% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 4.02% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.61% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 3.61% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 3.21% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.21% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.21% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.81% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.41% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 2.01% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.01% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 2.01% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.61% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.61% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 1.20% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.20% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.20% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.20% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.80% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.80% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.80% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.80% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.80% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.40% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.40% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.40% |
| Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 0.40% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.40% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.40% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.40% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.40% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.40% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.40% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.40% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.40% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.40% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.40% |
| Ectomycorrhiza | Host-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza | 0.40% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.40% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.40% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.40% |
| Attine Ant Fungus Gardens | Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens | 0.40% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000567 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 | Environmental | Open in IMG/M |
| 3300001180 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M3 | Environmental | Open in IMG/M |
| 3300001356 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
| 3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004475 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 62 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
| 3300005952 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-045 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300007982 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPM 11 metaG | Environmental | Open in IMG/M |
| 3300009029 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 1 DNA2013-189 | Environmental | Open in IMG/M |
| 3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
| 3300009524 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG | Environmental | Open in IMG/M |
| 3300009628 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_10 | Environmental | Open in IMG/M |
| 3300009638 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_10 | Environmental | Open in IMG/M |
| 3300009672 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG | Environmental | Open in IMG/M |
| 3300009764 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_40 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
| 3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012176 | Attine ant fungus gardens microbial communities from New Jersey, USA - TSNJ036 MetaG | Host-Associated | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014164 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaG | Environmental | Open in IMG/M |
| 3300014165 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaG | Environmental | Open in IMG/M |
| 3300014167 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_10_metaG | Environmental | Open in IMG/M |
| 3300014200 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaG | Environmental | Open in IMG/M |
| 3300014491 | Permafrost microbial communities from Stordalen Mire, Sweden - 612S2D metaG | Environmental | Open in IMG/M |
| 3300014495 | Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaG | Environmental | Open in IMG/M |
| 3300014657 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaG | Environmental | Open in IMG/M |
| 3300015193 | Arctic soil microbial communities from a glacier forefield, Rabots glacier, Tarfala, Sweden (Sample Rb6, proglacial stream) | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
| 3300017939 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_10_MG | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
| 3300017998 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_150 | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
| 3300018009 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_40 | Environmental | Open in IMG/M |
| 3300018012 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5 | Environmental | Open in IMG/M |
| 3300018018 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_150 | Environmental | Open in IMG/M |
| 3300018021 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_150 | Environmental | Open in IMG/M |
| 3300018033 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_10 | Environmental | Open in IMG/M |
| 3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
| 3300018042 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10 | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300019082 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_40 | Environmental | Open in IMG/M |
| 3300019260 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300022522 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-11-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300022721 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022726 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZU5 | Host-Associated | Open in IMG/M |
| 3300024233 | Peat soil microbial communities from Stordalen Mire, Sweden - C.F.S.T0 | Environmental | Open in IMG/M |
| 3300025414 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025444 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025501 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300025507 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026294 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 (SPAdes) | Environmental | Open in IMG/M |
| 3300026481 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-19-A | Environmental | Open in IMG/M |
| 3300026482 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-16-B | Environmental | Open in IMG/M |
| 3300026515 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-03-A | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026984 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF048 (SPAdes) | Environmental | Open in IMG/M |
| 3300027080 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF009 (SPAdes) | Environmental | Open in IMG/M |
| 3300027158 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF011 (SPAdes) | Environmental | Open in IMG/M |
| 3300027537 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027575 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027587 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027590 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027645 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027662 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027698 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027701 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027767 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027768 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027826 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027898 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027986 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028572 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N2_1 | Environmental | Open in IMG/M |
| 3300028574 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N2_2 | Environmental | Open in IMG/M |
| 3300028789 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_3 | Environmental | Open in IMG/M |
| 3300028806 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_1 | Environmental | Open in IMG/M |
| 3300028877 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_3 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029817 | Soil microbial communities from Marcell Experimental Forest, Minnesota, USA - Bog25 | Environmental | Open in IMG/M |
| 3300029919 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E1_2 | Environmental | Open in IMG/M |
| 3300029922 | III_Fen_E1 coassembly | Environmental | Open in IMG/M |
| 3300029939 | I_Bog_E3 coassembly | Environmental | Open in IMG/M |
| 3300029943 | I_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300029951 | III_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300030518 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N2_2 | Environmental | Open in IMG/M |
| 3300030578 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO105-VCO054SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030659 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG (v2) | Environmental | Open in IMG/M |
| 3300030693 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N2_2 | Environmental | Open in IMG/M |
| 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Host-Associated | Open in IMG/M |
| 3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
| 3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
| 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Host-Associated | Open in IMG/M |
| 3300033755 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB26FY SIP fraction | Environmental | Open in IMG/M |
| 3300034070 | Peat soil microbial communities from Stordalen Mire, Sweden - 713 E-3-M | Environmental | Open in IMG/M |
| 3300034195 | Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_fen_01D_17 | Environmental | Open in IMG/M |
| 3300034199 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_01D_14 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12270J11330_100504924 | 3300000567 | Peatlands Soil | VVFRAKARLVWIGDEGRVGLRFAVIEPALFEHLQHWTSQKMQAEGWDFPG* |
| JGI12695J13573_10100982 | 3300001180 | Forest Soil | AAGRAGFRFVVVEPALFAQLQHWTNRVMKDEGWETPAQERTI* |
| JGI12269J14319_101934882 | 3300001356 | Peatlands Soil | DEGRVGVRFVVIEPALFEQLQQWTNRKMREEGWEFPA* |
| JGI12635J15846_101191281 | 3300001593 | Forest Soil | ETIFRAKARIVWFGGEGRVGLRFAVIDPVLFEQLQHWTNNKMKNEGWELPSAPQ* |
| JGI12635J15846_102702733 | 3300001593 | Forest Soil | EGRVGLRFAVIDPLLFEQLQQWTNKRMKDEGWDLPA* |
| JGIcombinedJ26739_1000337875 | 3300002245 | Forest Soil | LFQAKARLMWIGDEGRVGIRFAVIEPALFEELQHWTNRKMKEEGWEFPT* |
| JGIcombinedJ51221_101400831 | 3300003505 | Forest Soil | LPESEFVIQAKGRLVWADAGGRAGLRFVVIEPALFEQLQHWTNLKMKDEGWEIPS* |
| Ga0062385_102172701 | 3300004080 | Bog Forest Soil | RLMWIGDEKRVGIRFAVIEPAVFERLQHWSNKKMREEGWDFPA* |
| Ga0062384_1006449871 | 3300004082 | Bog Forest Soil | AKARLMWIGDEKRVGIRFAVIEPAVFERLQHWSNKKMREEGWDFPA* |
| Ga0062387_1015926072 | 3300004091 | Bog Forest Soil | AIQAKGRLVWADAGGRAGLRFVVVEPALFGQLQRWTNRKMKDEGWEIPS* |
| Ga0062389_1007618681 | 3300004092 | Bog Forest Soil | VVQAKGRLVWAEAGGRAGLRFVVIEPAIFVQLQHWTNRKMKDEGWEIPS* |
| Ga0068969_10079391 | 3300004475 | Peatlands Soil | LVWADAGGRAGLRFVVVEPALFEQLQHWTNRKMKDEGWEIPS* |
| Ga0062388_1003824523 | 3300004635 | Bog Forest Soil | WADAGGRAGFRFVVIEPALFEKLQHWTNRKMKDEGWEIPS* |
| Ga0062388_1004470601 | 3300004635 | Bog Forest Soil | QAKGRLVWAEAGGRAGLRFVVIEPAIFVQLQHWTNRKMKDEGWEIPS* |
| Ga0066679_106343751 | 3300005176 | Soil | IQAKGRLVWTEAGGRAGLRFVVIEPALFEELQHWTNRKMKDEGWEIPS* |
| Ga0070683_1006977111 | 3300005329 | Corn Rhizosphere | MWVGDEGRVGVRFAVIEPALFEHLQRWTNRKMKDEGWDFSG* |
| Ga0070713_1002534252 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | KARLMWIGDEGRVGIRFAVIEPALFEQLQHWTNHKMKEEGWEFPS* |
| Ga0070713_1005548572 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | IGDEGRVGIRFAVIEPALFEQLQHWTNRKIKEEGWDFPA* |
| Ga0070699_1008885491 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | SETVMQAKGRLVWADVGGRAGLRFVVIEPTLFQQLQHWTNRKMKDEGWEFPG* |
| Ga0070735_102591342 | 3300005534 | Surface Soil | RFHAKARLMWVGDEGRVGIRFAVIEPALFEQLQHWTNRKMKEDGWDFPS* |
| Ga0066661_107361552 | 3300005554 | Soil | MWVGDEGRVGVRFAVIEPALFEQLQRWTNRKMKDEGWDFSG* |
| Ga0066704_106606722 | 3300005557 | Soil | VWTEAGGRAGLRFVVIEPALFEELQHWTNRKMKDEGWEIPS* |
| Ga0066693_100683671 | 3300005566 | Soil | PESDVHFEAKARLMWVGDEGRVGVRFAVIEPALFEQLQRWTNRKMKDEGWDFSG* |
| Ga0066705_107607331 | 3300005569 | Soil | DVHFEAKARLMWVGDEGRVGVRFAVIEPALFEQLQRWTNRKMKDEGWDFSG* |
| Ga0066706_113567271 | 3300005598 | Soil | DEGRVGIRFAVIEPALFEQLQHWTNRKMKEEGWEFPV* |
| Ga0070764_101317081 | 3300005712 | Soil | GRLVWAEAGGRAGLRFVVVEPALFEKLQHWTNHKMKDEGWEIPS* |
| Ga0070764_106932511 | 3300005712 | Soil | LPGGDKRFQAKGRLMWVGDEGRVGIRFAVIEPALFEELQHWSNRKMKEEGWEFPA* |
| Ga0080026_100224202 | 3300005952 | Permafrost Soil | MWIGDEGRVGVRFAVIEPAIFEHLQHWSNKKMKEEGWEFPA* |
| Ga0070717_101080763 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | LVWIGEEGRVGIRFAVIEPALFEQLQHWTNRKMKEEGWEFPA* |
| Ga0070717_110805012 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | FHAKARLMWVGDEGRVGIRFAVIEPALFEELQHWTNRKMKEDGWDFPS* |
| Ga0070717_119573452 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | DEGRVGVRFAVIEPALFEQLQRWTNRKMKDEGWDFSG* |
| Ga0075029_10000060718 | 3300006052 | Watersheds | MWIGEGGRVGIRFAVIEPALFEELQHWTNRRMKEEGWDFPV* |
| Ga0075029_1002684712 | 3300006052 | Watersheds | FQAKARLMWVGDEGRVGIRFAVIEPALFEQLQHWTNRKMKDEGWEFPS* |
| Ga0075029_1007226772 | 3300006052 | Watersheds | PFEAKARLMWVGDEGRIGIRFAVIEPALFEQLQHWTNKKMREEGWEFPA* |
| Ga0075029_1013233792 | 3300006052 | Watersheds | LMWIGNEGRVGIRFAVIEPVLFEQLQHWTNRKMKEEGWEFPT* |
| Ga0075019_111556611 | 3300006086 | Watersheds | EGRVGIRFAVIEPALFEQLQHWTNRKMKEEGWEFPT* |
| Ga0075030_1005996262 | 3300006162 | Watersheds | ETVIHAKGRLVWTEAGGRAGLRFIVIEPALFEQLQHWTNRKMKDEGWEIPS* |
| Ga0075030_1007014982 | 3300006162 | Watersheds | MHVKGRLVWADVGGRAGLRFVVVEPCLFEQLQHWTNQKLKDEGWDLPS* |
| Ga0075030_1014871661 | 3300006162 | Watersheds | AYPGGRAGIRFAVIEPALFTHLQAWADRKMQEEGWALPV* |
| Ga0070716_1002028782 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | LMWVGDEGRVGVRFAVIEPALFEQLQRWTNRKMKDEGWDFSG* |
| Ga0075014_1004104171 | 3300006174 | Watersheds | GRAGLRFIVIEPALFQQLQHWTNQKMKDEGWEILS* |
| Ga0075014_1007924312 | 3300006174 | Watersheds | ETEIRAKGRLVWAEAGGRAGLRFIVIDPPLFEQLQHWTNRKMTDEGWETPSE* |
| Ga0070765_1002659783 | 3300006176 | Soil | FRAKARIVWFGGEGRVGLRFAVIDPALFEQLQHWTNNKMKNEGWELPTGPQ* |
| Ga0070765_1003004163 | 3300006176 | Soil | RIVWFGGEGRVGLRFAVIDPALFEQLQHWTNNKMKNEGWELPTGPQ* |
| Ga0066660_104062043 | 3300006800 | Soil | WTEAGGRAGLRFVVIEPALFEELQHWTNRKMKDEGWEIPS* |
| Ga0066660_113367352 | 3300006800 | Soil | WVGDEGRVGVRFAVIEPALFEQLQRWTNRKMKDEGWDFSG* |
| Ga0079220_117612011 | 3300006806 | Agricultural Soil | HAKARLMWVGDEGRVGIRFAVIEPALFGQLQHWTNRKMKDDGWDFAS* |
| Ga0073928_107630061 | 3300006893 | Iron-Sulfur Acid Spring | GGRAGLRFVVIEPALFEQLQHWTNRKMKDEGWEIPS* |
| Ga0102924_10885181 | 3300007982 | Iron-Sulfur Acid Spring | PESDIRFHAKARLMWVGDEGRVGIRFAVIEPALFEQLQHWTNRKMKEDGWDFPS* |
| Ga0066793_106889201 | 3300009029 | Prmafrost Soil | TVIHAKGRLAWADAAGRAGFRFVVVEPALFAQLQHWTNRVMKDEGWETPAPERAI* |
| Ga0116214_10966031 | 3300009520 | Peatlands Soil | RACLRFVVVEPALFEQLQHWTNRKMKDEGWEIPS* |
| Ga0116225_10094727 | 3300009524 | Peatlands Soil | GGRAGLRFVVVEPALFEQLQHWTNRKMKDEGWEIPS* |
| Ga0116125_11474891 | 3300009628 | Peatland | ARIVWFGGEGRVGLRFAVIDPALFEQLQHWSNNKMKNEGWELPAGPQ* |
| Ga0116113_10919882 | 3300009638 | Peatland | RAKARIVWMGDEGRVGLRFAVIDPALFEQLQSWTNKKMKDEGWDLPA* |
| Ga0116215_10730231 | 3300009672 | Peatlands Soil | SDVVFRAKARLVWIGDEGRVGLRFAVIEPALFEHLQHWTSQKMQAEGWDFPG* |
| Ga0116134_10360551 | 3300009764 | Peatland | LVWSDAGGRAGLRFVVVEPALFEQLQHWTNRKMKEEGWEIPS* |
| Ga0126380_102653231 | 3300010043 | Tropical Forest Soil | ARLMWIGDEGRVGIRFAVIEPALFEQLQQWTNRKMKDEGWDFPI* |
| Ga0126380_113796282 | 3300010043 | Tropical Forest Soil | WADVGGKAGLRFVVIEPKLFEELQHWTNRKMKDEGWEFPA* |
| Ga0134063_106713501 | 3300010335 | Grasslands Soil | SDIAFRAKARLMWVGDEGRVGIRFVVIEPALFEQLQHWTNNKMKDEGWEFHS* |
| Ga0074046_102389023 | 3300010339 | Bog Forest Soil | LVWAEAGGRAGLRFVVIEPALFEQLQHWTNQKMKDEGWETPA* |
| Ga0074045_107365242 | 3300010341 | Bog Forest Soil | LVWAEAGGRAGLLFVVIEPAVFVQLQHWTNRKMKDEGWEIPS* |
| Ga0126378_115852121 | 3300010361 | Tropical Forest Soil | EGRVGIRFAVIEPALFEQLQQWTNRKMKDEGWEFPI* |
| Ga0126381_1003541521 | 3300010376 | Tropical Forest Soil | IGDEGRVGIRFAVIEPALFEQLQQWTNRKMKDEGWEFPI* |
| Ga0136449_1006070272 | 3300010379 | Peatlands Soil | VIQAKGRLVWSDAGGRAGLRFVVVEPALFEQLQHWTNRKMKDEGWEIPS* |
| Ga0136449_1023294551 | 3300010379 | Peatlands Soil | ETVFRAKARIVWFGGEGRVGLRFAVIDPALFEQLQHWTNNKMKNEGWELPAGPQ* |
| Ga0137391_102428852 | 3300011270 | Vadose Zone Soil | GRLVWAGEGGRVGLRFAVIEPVLFEDLQHWTNQKMREEGWEFPN* |
| Ga0153952_11037712 | 3300012176 | Attine Ant Fungus Gardens | IVWMGDEGRVGLRFAVIDPALFEQLQHWTNRKMKDEGWDLHA* |
| Ga0137363_114716602 | 3300012202 | Vadose Zone Soil | QAKARLMWVGDEGRVGIRFAVIEPALFEQLQYWTNRKMKDEGWDFSS* |
| Ga0137399_106124362 | 3300012203 | Vadose Zone Soil | GRLVWTEAGGRAGLRFVVIEPALFEQLQHWTNRKMKDEGWEIPS* |
| Ga0137376_103659812 | 3300012208 | Vadose Zone Soil | DGGRVGLRFAVIEPLLFEDLQHWTNKKMREEGWEFPN* |
| Ga0137376_106132541 | 3300012208 | Vadose Zone Soil | KGRLVWTEAGGRAGLRFVVIEPALFEELQHWTNRKMKDEGWEIPS* |
| Ga0137376_108157082 | 3300012208 | Vadose Zone Soil | KARLMWVGDEGRVGIRFAVIEPALFEQLQHWTNRKMKDEGWDFSS* |
| Ga0150985_1062186732 | 3300012212 | Avena Fatua Rhizosphere | MWVGDEGRVGVRFVVIEPALFEQLQRWTSRKMKDDGWDLHG* |
| Ga0137372_101176511 | 3300012350 | Vadose Zone Soil | IGDEGRVGIRFAVIEPALFEQLQHWSNRKIKEEGWEFPA* |
| Ga0137385_114993951 | 3300012359 | Vadose Zone Soil | KGRLVWAGDGGRVGLRFAVIEPLLFEDLQHWTNKKMREEGWEFPN* |
| Ga0137360_114171861 | 3300012361 | Vadose Zone Soil | EAGGRAGLRFVVIEPALFEELQHWTNRKMKDEGWEIPS* |
| Ga0137390_101626685 | 3300012363 | Vadose Zone Soil | WADVGGKAGLRFVVIEPTLFQQLQHWTNRKMKDEGWEFPA* |
| Ga0150984_1164464631 | 3300012469 | Avena Fatua Rhizosphere | GDEGRVGIRFVVIEPALFEQLQRWTSRKMKDDGWDLQG* |
| Ga0137358_106110491 | 3300012582 | Vadose Zone Soil | KGRLVWADVGGRAGLRFVVIEPALFEKLQHWTNRKMKNEGWEFPA* |
| Ga0137416_106125391 | 3300012927 | Vadose Zone Soil | TEAGGRAGLRFVVIEPALFEELQHWTNRKMKDEGWEIPS* |
| Ga0137407_113490611 | 3300012930 | Vadose Zone Soil | KARLMWIGDEGRVGIRFAVIEPALFEHLQHWSNKKMKEEGWEFPA* |
| Ga0137410_108730021 | 3300012944 | Vadose Zone Soil | PDSEVQFQAKARLMWIGDEGRVGIRFAVIEPALFEQLQHWTNRKMKDEGWDFTA* |
| Ga0181532_100230295 | 3300014164 | Bog | LVWADAGGRAGLRFVVIEPVLFEELQHWTNRKMKDEGWETLA* |
| Ga0181523_105531332 | 3300014165 | Bog | VGIRFAVIEPALFEQLQHWTNRKMKEEGWEFPAE* |
| Ga0181528_100798081 | 3300014167 | Bog | IFRAKARIVWLGEEGRVGLRFAVIDPALFEQLQHWTNKKMKDEGWEIPSASV* |
| Ga0181526_102585111 | 3300014200 | Bog | KGRLVWAEAGGRAGLRFVVIEPAVFVQLQHWTNRKMKDEGWEIPS* |
| Ga0182014_106493842 | 3300014491 | Bog | IQAKGRLVWTDAGGRAGLRFVVIEPTLFEQLQHWTNRKMKDEGWEIPS* |
| Ga0182015_1001288910 | 3300014495 | Palsa | DEGRVGLRFAVIDPALFEQLQSWTNKKMKDEGWDLPA* |
| Ga0181522_108322581 | 3300014657 | Bog | FRAKARIVWMGDEGRVGLRFAVIDPALFEQLQHWTNKRMKDEGWDLPA* |
| Ga0167668_10148364 | 3300015193 | Glacier Forefield Soil | EIVIHAKGRLVWADAAGRAGFRFVVVEPALFAELQHWTNRMMKDEGWETPPEARTV* |
| Ga0137418_101811121 | 3300015241 | Vadose Zone Soil | RVGLRFAVIEPVLFEDLQHWTNKKMREEGWEFPN* |
| Ga0134089_102992121 | 3300015358 | Grasslands Soil | ADVGGKAGLRFVVIEPTLFQQLQHWTNRKMKDEGWEFPA* |
| Ga0132258_127190701 | 3300015371 | Arabidopsis Rhizosphere | DEGRVGIRFAVIEPALFEQLQYWTNKKMKEEGWEFPI* |
| Ga0132255_1002883633 | 3300015374 | Arabidopsis Rhizosphere | PDSDVQFQAKARLMWVGDEGRVGIRFAGIEPALFEQLQHWTNRKMKDEGWDFTS* |
| Ga0132255_1038968751 | 3300015374 | Arabidopsis Rhizosphere | ESEVLFQAKARLMWIGDEGRVGIRFAVIEPALFEQLQHWTNKKMKEEGWEFPI* |
| Ga0182035_116823241 | 3300016341 | Soil | RLMWIGDEGRVGIRFAVIEPALFEQLQHWTNRKMKEEGWDFPS |
| Ga0187802_104675202 | 3300017822 | Freshwater Sediment | LPESEILFQAKARLMWIGDEGRVGIRFAVIEPALFEQLQHWTNRKMKEEGWEFPA |
| Ga0187775_105423372 | 3300017939 | Tropical Peatland | PDTETVIQGKGRLVWADAGGRAGLRFVVIEPSLFEQLQHWTNTKMKDEGWEFPV |
| Ga0187817_110614021 | 3300017955 | Freshwater Sediment | ESDVEFQAKARLMWVGDEGRVGVRFAVIEPALFEQLQHWTNRKMKEEGWDFPI |
| Ga0187779_111640301 | 3300017959 | Tropical Peatland | KARLMWIGDEGRVGIRFVVIEPALFEQLQHWTNRKMKEEGWDFPA |
| Ga0187781_100747503 | 3300017972 | Tropical Peatland | SETKMQAKGRLMWADVGGRAGLRFVVIEPAAFAMLQRWSNQKMKDEGWELPS |
| Ga0187781_109096561 | 3300017972 | Tropical Peatland | RLMWIGDEGRVGIRFAVIEPALFEQLQQWTNRKMKDEGWDFPF |
| Ga0187781_111714922 | 3300017972 | Tropical Peatland | AKARLMWIGDEGRVGIRFAVIEPALFEQLQQWTNRKMKDEGWDFPF |
| Ga0187781_112539141 | 3300017972 | Tropical Peatland | RLMWIGDEGRVGIRFAVIEPALFEQLQQWTNKKMREEGWDFPS |
| Ga0187782_100661394 | 3300017975 | Tropical Peatland | QAKARIMWVGDEGRVGIRFAVIEPALFEQLQQWTNRKMRDEGWEFPA |
| Ga0187816_100845301 | 3300017995 | Freshwater Sediment | SDVLFQAKARLMWVGDEGRVGIRFAVIEPALFEQLQHWTNRRMKEEGWDFPA |
| Ga0187870_13198161 | 3300017998 | Peatland | DNVFRAKARIVWMGDEGRVGLRFAVIDPALFEQLQSWTNKKMKDEGWDLPA |
| Ga0187804_103275182 | 3300018006 | Freshwater Sediment | QAKARLMWVGDEGRVGIRFAVIEPALFEQLQHWTNRKMKEEGWDFPV |
| Ga0187805_101499321 | 3300018007 | Freshwater Sediment | GRVGIRFVVIEPVLFEQLQHWTNKKMKEEGWEFST |
| Ga0187805_106136642 | 3300018007 | Freshwater Sediment | RLMWVGDEGRVGIRFAVIEPALFEQLQHWTNRKMKEEGWEFPA |
| Ga0187884_102130181 | 3300018009 | Peatland | AKGRLVWADAGGRAGLRFVVIEPALFEELQHWTNRKMKDEGWETLA |
| Ga0187810_102095423 | 3300018012 | Freshwater Sediment | WADVGGRAGLRFVVIEPRLFEQLQHWTNKKMKDEGWELRP |
| Ga0187810_102572221 | 3300018012 | Freshwater Sediment | LMWIGEGGRVGIRFAVIEPALFEQLQHWTNRKMKEEGWDFPA |
| Ga0187810_103540291 | 3300018012 | Freshwater Sediment | SETEMQAKGRLVWADVGGRAGLRFVVIEPALFQQLQHWTNQKMKDEGWEIPS |
| Ga0187886_12925002 | 3300018018 | Peatland | KARIVWMGDEGRVGLRFAVIDPALFEQLQQWTNKRMKDEGWDLPA |
| Ga0187882_14006952 | 3300018021 | Peatland | QAKGRLVWADAGGRAGLRFVVIEPALFRQLQHWTNRKMKDEGWETLA |
| Ga0187867_104328562 | 3300018033 | Peatland | ESETVIQAKGRLVWADAGGRAGLRFVVIEPSLFEQLQHWTNRKMKDEGWEIPS |
| Ga0187867_108048541 | 3300018033 | Peatland | TVVQAKGRLVWADAGGRAGLRFVVIEPALFQKLQHWTNQKMKEEGWEIPS |
| Ga0187863_100583911 | 3300018034 | Peatland | ARLMWIGDEKRVGIRFAVIEPAIFEQLQHWSNKKMREEGWDFPS |
| Ga0187871_103579672 | 3300018042 | Peatland | LVWADVGGRAGLRFIVIDPALFQQLQRWTNQKVKDEGWEIPT |
| Ga0187871_106202852 | 3300018042 | Peatland | VQAKGRLVWAEAGGRAGLRFVVIEPAVFVQLQHWTNRKMKDEGWEIPS |
| Ga0187784_110154312 | 3300018062 | Tropical Peatland | ETPMQAKGRLVWADAGGRAGLRFVVIEPALFVQLQHWTNRKMKDEGWELPS |
| Ga0187772_100400111 | 3300018085 | Tropical Peatland | LMWIGDEGRVGIRFAVIEPALFEQLQQWTNRKMKDEGWDFPF |
| Ga0187770_106300872 | 3300018090 | Tropical Peatland | ETVMQAKGRLVWADAGGRAGLRFVVIEPALFVQLQHWTNRKMKDEGWELPS |
| Ga0187770_107839291 | 3300018090 | Tropical Peatland | QAKARLMWIGDEGRVGIRFAVIEPVLFEQLQHWTNKKMREEGWDFPG |
| Ga0187770_114982812 | 3300018090 | Tropical Peatland | GRAGLRFVVIEPALFAQLQHWTNEKMKEEGWEIPS |
| Ga0066662_102853791 | 3300018468 | Grasslands Soil | RMWVGEAGRVGVRVAVIEPLLFEQLQHWSNRKMKEEGWDLPV |
| Ga0066662_117006161 | 3300018468 | Grasslands Soil | DEGRVGVRFAVIEPLLFEQLQQWTNRKMREEGWDFPS |
| Ga0187852_12122931 | 3300019082 | Peatland | EAGGRAGLRFVVVEPALFEELQHWTNRKMKDEGWEIPS |
| Ga0181506_14027182 | 3300019260 | Peatland | ETVFRAKARIVWFGGEGRVGLRFAVIDPALFEQLQHWSNNKMKDEGWELPTGPQ |
| Ga0137408_11674781 | 3300019789 | Vadose Zone Soil | DVGGKAGLRFVVIEPTLFQQLQHWTNRKMKDEGWEFPA |
| Ga0210407_106549602 | 3300020579 | Soil | MWIGDEGRVGIRFAVIEPALFEQLQHWTNRKMKEEGWEFPT |
| Ga0210399_103937402 | 3300020581 | Soil | SEILFQAKARLMWIGDEGRVGIRFAVIEPALFEQLQHWTNRKMKEEGWEFPA |
| Ga0210400_113308691 | 3300021170 | Soil | GRVGLRFAVIEPLLFEDLQHWTNQKMREEGWEFPN |
| Ga0210396_114723022 | 3300021180 | Soil | WVGDEGRVGVRFAVIEPLLFEQLQHWTNKKMREEGWDFPAQ |
| Ga0210388_114768301 | 3300021181 | Soil | MWIGDEGRVGIRFAVIEPALFEELQHWTNRKMKEEGWEFPI |
| Ga0210393_104700111 | 3300021401 | Soil | RLMWIGDEGRVGIRFAVIEPALFEQLQHWTNRKMKEEGWEFPA |
| Ga0210385_101684071 | 3300021402 | Soil | VWFGGEGRVGLRFAVIDPALFEQLQHWSNNKMKDEGWELPTGPQ |
| Ga0210385_102948991 | 3300021402 | Soil | LPGSDILFKAKARLMWIGDEGRVGVRFAVIEPALFEELQHWTNRKMKEEGWDLPS |
| Ga0210385_111599952 | 3300021402 | Soil | ILFKAKARLMWIGDEGRVGVRFAVIEPALFEHLQQWTNRKMKDEGWEFPT |
| Ga0210387_102984951 | 3300021405 | Soil | EGRVGIRFAVIEPLLFEQLQHWTNKKMREEGWDFPAQ |
| Ga0210387_104474771 | 3300021405 | Soil | LPESEILFKAKARLMWIGDEGRVGVRFAVIEPALFEHLQQWTNRKMKDEGWEFPT |
| Ga0210386_116002041 | 3300021406 | Soil | EGRVGLRFAVIDPALFEQLQHWSNNKMKDEGWELPAGPQ |
| Ga0210383_108619832 | 3300021407 | Soil | ETVIHAKGRLVWAEAGGRAGLRFVVIEPALFEHLQHWTNRKMKDEGWDTLS |
| Ga0210383_111755852 | 3300021407 | Soil | DILFQAKARLMWVGEEGRVGIRFAVIEPALFEQLQHWTNRKMKEEGWDFPG |
| Ga0210391_100598321 | 3300021433 | Soil | KGRLVWAEAGGRAGLRFIVIEPALFEQLQHWTNRKMKDEGWETPSELS |
| Ga0210391_112937782 | 3300021433 | Soil | GRVGIRFVVIEPALFEHLQRWSNKKMKDEGWEFPA |
| Ga0210390_104883061 | 3300021474 | Soil | DVVFQAKARLMWIGDEGRVGIRFVVIEPALFEHLQRWSNKKMKDEGWEFPA |
| Ga0210402_107581122 | 3300021478 | Soil | EGRVGIRFAVIEPALFEHLQHWSNKKMKDEGWEFPS |
| Ga0242659_10114671 | 3300022522 | Soil | IGDEKRVGIRFAVIEPAIFEQLQHWSNKKMREEGWDFPS |
| Ga0212123_102258291 | 3300022557 | Iron-Sulfur Acid Spring | PESDIRFHAKARLMWVGDAGRVGIRFAVIEPALFEQLQHWTNRKMKEDGWDFPS |
| Ga0242666_11782482 | 3300022721 | Soil | FGGEGRVGLRFAVIDPALFEQLQHWTNNKMKNEGWELPTGPQ |
| Ga0242654_100911963 | 3300022726 | Soil | MWIGDEGRVGVRFAVIEPALFEHLQQWTNRKMKDEGWEFPT |
| Ga0224572_10229562 | 3300024225 | Rhizosphere | GRVGIRFAVIEPALFEQLQHWTNRKMKEEGWEFRA |
| Ga0224521_10576632 | 3300024233 | Soil | SDTGGRAGLRFVVIEPVMFEQLQHWTNRKMKDEGWEIPS |
| Ga0208935_10083451 | 3300025414 | Peatland | GRVGLRFAVIDPALFEQLQQWTNKRMKDEGWDLPA |
| Ga0208935_10525422 | 3300025414 | Peatland | VVQAKGRLVWAEAGGRAGLRFVVIEPAVFVQLQHWTNRKMKDEGWEIPS |
| Ga0208189_10338102 | 3300025444 | Peatland | TVIQAKGRLVWADAGGRAGLRFVVIEPVLFEELQHWTNRKMKDEGWETLA |
| Ga0208563_10670622 | 3300025501 | Peatland | GDEGRVGLRFAVIDPALFEQLQSWTNKKMKDEGWDLPA |
| Ga0208188_11339171 | 3300025507 | Peatland | KGRLVWADAGGRAGLRFVVIEPVLFEELQHWTNRKMKDEGWETLA |
| Ga0207662_106195022 | 3300025918 | Switchgrass Rhizosphere | VLEPALFEEIHHWTARKMKEEGWELPQESRNNLSQ |
| Ga0207646_100603311 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | SETVMQAKGRLVWADVGGKAGLRFVVIEPTLFQQLQHWTNRKMKDEGWEFPA |
| Ga0209839_102024542 | 3300026294 | Soil | VIQAKGRLVWADAGGRAGLRFVVVEPALFEQLQHWTNQKMKNEGWEIPS |
| Ga0257155_10505032 | 3300026481 | Soil | AKGRLVWTEAGGRAGLRFVVIEPALFEQLQHWTNRKMKDEGWEIPS |
| Ga0257172_10101691 | 3300026482 | Soil | RLVWTEAGGRAGLRFVVIEPALFEQLQHWTNRKMKDEGWEIPS |
| Ga0257158_10543893 | 3300026515 | Soil | GRLVWADVGGRAGLRFVVIEPALFEKLQHWTNRKMKNEGWEFPV |
| Ga0209648_101113521 | 3300026551 | Grasslands Soil | SEIEIQAKGRLVWTEAGGRAGLRFVVIEPALFEQLQHWTNRKMKDEGWEIPS |
| Ga0208732_10254823 | 3300026984 | Forest Soil | QFQAKARLMWVGDEGRVGIRFAVIEPALFEQLQHWTNRKMKDEGWDFSS |
| Ga0208237_10092921 | 3300027080 | Forest Soil | VWMGDEGRVGLRFAVIDPALFEQLQHWTNRKMKDEGWDLHA |
| Ga0208725_10523352 | 3300027158 | Forest Soil | TVIHAKGRLVWADAGGRAGLRFVVIEPALFEKLQHWTNRKMKDEGWEIPS |
| Ga0209419_10787022 | 3300027537 | Forest Soil | SEILFKAKARLMWIGDEGRVGVRFAVIEPALFEHLQQWTNRKMKDEGWEFPT |
| Ga0209525_10517931 | 3300027575 | Forest Soil | VWMGDEGRVGLRFAVIDPALFEQLQHWTNKKMKDEGWDLPA |
| Ga0209220_11391812 | 3300027587 | Forest Soil | WTEAGGRAGLRFVVIEPALFEQLQHWTNRKMKDEGWEIPS |
| Ga0209116_10303691 | 3300027590 | Forest Soil | MWVGDEGRVGIRFAVIEPALFEQLQHWSNRKMKEEGWDFPA |
| Ga0209117_10792002 | 3300027645 | Forest Soil | LVWSDAGGRAGLRFVVVEPALFEELQHWTNRKMKDEGWEIPS |
| Ga0208565_10703651 | 3300027662 | Peatlands Soil | SDVVFRAKARLVWIGDEGRVGLRFAVIEPALFEHLQHWTSQKMQAEGWDFPG |
| Ga0209446_11144582 | 3300027698 | Bog Forest Soil | KARLMWIGDEGRVGVRFAVIEPALFEQLQHWTNRKMKEEGWEFPS |
| Ga0209447_100751763 | 3300027701 | Bog Forest Soil | DAGGRAGFRFVVIEPALFEKLQHWTNEKMKNEGWEIPT |
| Ga0209655_102822922 | 3300027767 | Bog Forest Soil | VFLAKARIVWLGDEGRVGLRFAVIDPALFEKLQHWTNKKMKDEGWELPV |
| Ga0209772_102962742 | 3300027768 | Bog Forest Soil | VWAEAGGRAGLRFVVVEPALFEQLQHWTNRKMKDEGWEIPS |
| Ga0209060_101477001 | 3300027826 | Surface Soil | RLMWVGDEGRVGVRFAVIEPALFEQLQHWTNRKMKEEGWDFPG |
| Ga0209274_101728181 | 3300027853 | Soil | VGLRFAVIDPALFEKLQHWSNNKMKDEGWELPAGPQ |
| Ga0209693_103618891 | 3300027855 | Soil | GDEGRVGIRFAVIEPLLFEQLQHWTNKKMREEGWDFPAQ |
| Ga0209167_105503202 | 3300027867 | Surface Soil | PESEIEFQAKARLMWVGDEGRVGVRFAVIEPALFEQLQHWTNRKMKEEGWEFPV |
| Ga0209579_102848252 | 3300027869 | Surface Soil | ARIVWFGDEGRVGLRFAVIDPVLFEQLQRWTNKKMKDEGWELPL |
| Ga0209275_101226051 | 3300027884 | Soil | VIHAKGRLVWADAGGRAGLRFVVIEPALFEKLQHWTNRKMKDEGWEIPS |
| Ga0209380_100158806 | 3300027889 | Soil | TEVVFRAKARIVWMGDEGRVGLRFAVIDPALFEQLQHWTNKKMKDEGWDLPV |
| Ga0209380_104402281 | 3300027889 | Soil | IQFEAKARLMWIGDEKRVGIRFAVIEPAIFEQLQHWSNKKMREEGWDFPS |
| Ga0209068_100758162 | 3300027894 | Watersheds | MWTEAGGRAGLRFIVIEPALFEQLQHWTNRKMKDEGWEIPS |
| Ga0209067_102244851 | 3300027898 | Watersheds | ARLMWVGDEGRVGIRFAVIEPALFEQLQHWTNRKMKDEGWEFPF |
| Ga0209006_101410941 | 3300027908 | Forest Soil | EKRVGIRFAVIEPAIFEQLQHWSNKKMREEGWDFPS |
| Ga0209006_110202601 | 3300027908 | Forest Soil | WFGGEGRVGLRFAVIDPALFEQLQHWTNNKMKDEGWELPAQS |
| Ga0209006_110490101 | 3300027908 | Forest Soil | FQAKARLMWIGDEGRVGIRFAVIEPALFEELQHWTNRKMKDEGWEFPT |
| Ga0209698_1000052937 | 3300027911 | Watersheds | MWIGEGGRVGIRFAVIEPALFEELQHWTNRRMKEEGWDFPV |
| Ga0209698_100638863 | 3300027911 | Watersheds | IGEGGRVGIRFAVIEPALFEELQHWTNRKMKEEGWEFPV |
| Ga0209698_105680111 | 3300027911 | Watersheds | IPMHVKGRLVWADVGGRAGLRFVVVEPCLFEQLQHWTNQKLKDEGWDLPS |
| Ga0209168_101830871 | 3300027986 | Surface Soil | RFHAKARLMWVGDEGRVGIRFAVIEPALFEQLQHWTNRKMKEDGWDFPS |
| Ga0209526_102562501 | 3300028047 | Forest Soil | GRLVWAGDGGRVGLRFAVIEPVLFEDLQHWTNMKMREEGWEFPN |
| Ga0209526_102760372 | 3300028047 | Forest Soil | GEGRVGLRFAVIDPALFEQLQHWSNQKMKDEGWELPAQPST |
| Ga0209526_107299152 | 3300028047 | Forest Soil | GRLVWAGDGGRVGLRFAVIEPVLFEDLQHWTNKKMREEGWEFPS |
| Ga0302152_103230022 | 3300028572 | Bog | VFQAKARIVWIGDESRVGLRFAVIDPALFEQLQHWTNKKMKDEGWESPAQS |
| Ga0302153_100901321 | 3300028574 | Bog | PETETVILAKGRLVWSDGGGRAGLRFVVVEPELFEQLQHWTNRKMKDEGWEIPS |
| Ga0302232_104819742 | 3300028789 | Palsa | ARLMWVGEEGRVGIRFAVIEPALFEQLQHWTNRKMKEEGWEFQA |
| Ga0302221_103990831 | 3300028806 | Palsa | WMGGEGRVGLRFAVIDPQLFEQLQHWTNKKMRDEGWESRA |
| Ga0302235_100981303 | 3300028877 | Palsa | MGDEGRVGLRFAVIDPALFEQLQHWTNKKMKDEGWDLPA |
| Ga0308309_102691313 | 3300028906 | Soil | RIVWFGGEGRVGLRFAVIDPALFEQLQHWTNNKMKNEGWELPTGPQ |
| Ga0247275_11728711 | 3300029817 | Soil | ETVIQAKGRLVWSDAGGRAGLRFVVVEPALFEQLQHWTNRKMKDEGWEIPS |
| Ga0302141_10639461 | 3300029919 | Bog | VWSDAGGRAGLRFVVVEPELFEKLQHWTNRKMKDEGWEVPS |
| Ga0311363_114618811 | 3300029922 | Fen | WAEAGGRAGLRFVVIEPALFEQLQHWTNRKMKDEGWEIPS |
| Ga0311328_107386201 | 3300029939 | Bog | RAKARIVWMGDEGRVGVRFSVIDPALFEQLQHWTNKKMKDEGWELPA |
| Ga0311340_106003622 | 3300029943 | Palsa | EAKGRLMWIGDEKRVGIRFAVIEPAIFEQLQHWSNKKMREEGWDFPS |
| Ga0311371_118147962 | 3300029951 | Palsa | QFQAKARLMWIGDEGRVGIRFAVIEPALFEHLQHWSNKKMKEEGWDFPT |
| Ga0311371_122431831 | 3300029951 | Palsa | IVWIGDESRVGLRFAVIDPALFEQLQHWTNKKMKDEGWDLPA |
| Ga0302275_104114902 | 3300030518 | Bog | KGRLVWSDGGGRAGLRFVVVEPELFEQLQHWTNRKMKDEGWEIPS |
| Ga0210275_101369052 | 3300030578 | Soil | SRVGLRFAVIDPALFEQLQHWTNKKMKDEGWESPA |
| Ga0316363_100503881 | 3300030659 | Peatlands Soil | DVVFRAKARLVWIGDEGRVGLRFAVIEPALFEHLQHWTSQKMQAEGWDFPG |
| Ga0302313_100964343 | 3300030693 | Palsa | IFRAKARIVWMGDEGRVGLRFAVIDPALFEQLQHWTNKKMKDEGWDLPA |
| Ga0265762_10844311 | 3300030760 | Soil | SETEIRAKGRLVWADAGGRAGLRFIVIEPALFEQLQHWTNRKMKDEGWEIPS |
| Ga0265762_11275132 | 3300030760 | Soil | EAKGRLVWAEAGGRAGLRFIVIEPAIFVQLQHWTNKKMKDEGWETPS |
| Ga0170834_1110724042 | 3300031057 | Forest Soil | GRAGLRFVVIEPALFEQLQHWTNRKMKDEGWEIPS |
| Ga0170824_1220073872 | 3300031231 | Forest Soil | WIGEEGRVGVRFVVIEPALFEHLQRWSNKKMKEEGWEFPA |
| Ga0265339_101401171 | 3300031249 | Rhizosphere | AKARLMWVGDEGRVGIRFAVIEPALFEQLQHWTNRKMKEEGWDFLA |
| Ga0302326_110020541 | 3300031525 | Palsa | RLVWAEAGGRAGLRFVVIEPAIFVQLQHWTNRKMKDEGWEIPS |
| Ga0302326_132599921 | 3300031525 | Palsa | EAKARLMWIGDEKRVGIRFAVIEPAIFEQLQHWSNKKMREEGWDFPS |
| Ga0310686_1004436081 | 3300031708 | Soil | KARIVWMGDEGRVGLRFAVIDPALFEQLQHWTNKRMKDEGWDLPA |
| Ga0307474_100178028 | 3300031718 | Hardwood Forest Soil | WFGGEGRVGLRFAVIDPALFEQLQQWTNKKMKDEGWELPA |
| Ga0307474_104551223 | 3300031718 | Hardwood Forest Soil | GGEGRVGLRFAVIDPALFEQLQHWTNKKMKDEGWELPGA |
| Ga0307474_108162701 | 3300031718 | Hardwood Forest Soil | IHAKGRLVWAEAGGRAGLRFVVIEPALFEHLQHWTNRKMKDEGWDTTS |
| Ga0307469_109656102 | 3300031720 | Hardwood Forest Soil | NTLFHAKARLVWMGEEGRVGVRFAVIEPQLFEQLQQWTNKKMRDEGWDFPS |
| Ga0307475_107946601 | 3300031754 | Hardwood Forest Soil | MGDEGRVGLRFAVIDPLLFEQLQHWTNKKMKDEGWDLPA |
| Ga0318523_105314611 | 3300031798 | Soil | WIGGEGRVGIRFAVIEPALFEELQHWTNRKMKEEGWDLPS |
| Ga0306925_121790202 | 3300031890 | Soil | KARLMWIGGEGRVGIRFAVIEPALFEELQHWTNRKMKEEGWDLPS |
| Ga0306923_101866461 | 3300031910 | Soil | ARLMWIGGEGRVGIRFAVIEPALFEELQHWTNRKMKEEGWDLPS |
| Ga0306924_113638572 | 3300032076 | Soil | MWIGDEGRVGIRFAVIEPALFEQLQHWTNRKMKEEGWDFPS |
| Ga0311301_112801352 | 3300032160 | Peatlands Soil | ETVFRAKARIVWFGGEGRVGLRFAVIDPALFEQLQHWTNNKMKNEGWELPAGPQ |
| Ga0307471_1005158591 | 3300032180 | Hardwood Forest Soil | GRLVWADVGGKAGLRFVVIEPTLFQQLQHWTNRKMKDEGWEFPA |
| Ga0348332_147731941 | 3300032515 | Plant Litter | RIVWFGGEGRVGLRFAVIDPALFERLQHWSNQKMKDEGWELPAGPK |
| Ga0335082_110545122 | 3300032782 | Soil | QFQAKARLMWVGDEGRVGIRFAVIEPALFEQLQHWTNRKMKEEGWEFLS |
| Ga0335082_116451231 | 3300032782 | Soil | ARLVWADAGGRAGARFVVIEPRLFERLQLWTNQKMKQEGWELPI |
| Ga0335079_112635071 | 3300032783 | Soil | WIGEEGRVGIRFAVIEPALFEQLQHWTNRKIKEEGWEFPA |
| Ga0335078_116452811 | 3300032805 | Soil | EVHFQAKARLMWIGDQGRVGIRFAVIEPALFEELQHWTNRKMKDEGWDFLV |
| Ga0335080_121875661 | 3300032828 | Soil | QFKAKARLMWVGDDGRVGIRFSVIEPVLFEQLQRWTNRKMKEEGWDFPA |
| Ga0335069_118787321 | 3300032893 | Soil | LMWIGGEGRVGIRFAVIEPALFEQLQHWTNCKMKEEGWDLPS |
| Ga0335072_101460101 | 3300032898 | Soil | LMWVGDDGRVGIRFAVIEPALFEQLQRWSNRKIKEEGWEFSS |
| Ga0307507_106119761 | 3300033179 | Ectomycorrhiza | DVRFEAKARLMWVGDESRVGVRFAVIEPALFEQLQHWTNRKMKEEGWEFPS |
| Ga0371489_0493758_341_490 | 3300033755 | Peat Soil | MQVKGRLVWADVGGRAGLRFVVVEPALYEKLQHWSNQKMKNEGWEVPVE |
| Ga0334822_070454_2_121 | 3300034070 | Soil | SDAGGRAGLRFVVIDPAMFEQLQHWTNRKMKDEGWEIPS |
| Ga0370501_0251102_3_149 | 3300034195 | Untreated Peat Soil | IQAKGRLVWADVGGRAGLRFVVIEPTLFEHLQHWTNRKMKDEGWEFTS |
| Ga0370514_178026_392_550 | 3300034199 | Untreated Peat Soil | TTFRAKARIVWFGGEGRVGLRFTVIDPALFEQLQHWTNNKMKDEGWELPAQP |
| ⦗Top⦘ |