Basic Information | |
---|---|
Family ID | F016182 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 249 |
Average Sequence Length | 45 residues |
Representative Sequence | MPRVNFLVHYILPVFKYLFFAGLIGAVPVIIVTAIKTAQSMLEED |
Number of Associated Samples | 159 |
Number of Associated Scaffolds | 248 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 73.49 % |
% of genes near scaffold ends (potentially truncated) | 28.11 % |
% of genes from short scaffolds (< 2000 bps) | 79.92 % |
Associated GOLD sequencing projects | 143 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.51 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (66.667 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (13.253 % of family members) |
Environment Ontology (ENVO) | Unclassified (24.900 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (47.390 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 57.53% β-sheet: 0.00% Coil/Unstructured: 42.47% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.51 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 248 Family Scaffolds |
---|---|---|
PF13520 | AA_permease_2 | 54.03 |
PF00795 | CN_hydrolase | 4.84 |
PF03462 | PCRF | 2.82 |
PF10778 | DehI | 0.81 |
PF05237 | Obsolete Pfam Family | 0.40 |
PF07642 | BBP2 | 0.40 |
PF05694 | SBP56 | 0.40 |
PF00144 | Beta-lactamase | 0.40 |
COG ID | Name | Functional Category | % Frequency in 248 Family Scaffolds |
---|---|---|---|
COG0216 | Protein chain release factor RF1 | Translation, ribosomal structure and biogenesis [J] | 2.82 |
COG1186 | Protein chain release factor PrfB | Translation, ribosomal structure and biogenesis [J] | 2.82 |
COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 0.40 |
COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.40 |
COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 0.40 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 66.67 % |
Unclassified | root | N/A | 33.33 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2170459010|GIO7OMY02J2R4B | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 520 | Open in IMG/M |
2170459017|G14TP7Y01CPF8J | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 654 | Open in IMG/M |
3300000156|NODE_c0707178 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4415 | Open in IMG/M |
3300000156|NODE_c0707178 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4415 | Open in IMG/M |
3300002245|JGIcombinedJ26739_100422494 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1211 | Open in IMG/M |
3300002568|C688J35102_119517443 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 711 | Open in IMG/M |
3300002906|JGI25614J43888_10138020 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 644 | Open in IMG/M |
3300003321|soilH1_10020220 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 7016 | Open in IMG/M |
3300003321|soilH1_10126632 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 2551 | Open in IMG/M |
3300003321|soilH1_10240783 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1248 | Open in IMG/M |
3300003321|soilH1_10272875 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 1003 | Open in IMG/M |
3300004114|Ga0062593_100191191 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 1616 | Open in IMG/M |
3300004479|Ga0062595_101703661 | Not Available | 593 | Open in IMG/M |
3300004479|Ga0062595_102592607 | Not Available | 508 | Open in IMG/M |
3300004799|Ga0058863_10072532 | Not Available | 1035 | Open in IMG/M |
3300004799|Ga0058863_10549491 | Not Available | 581 | Open in IMG/M |
3300005171|Ga0066677_10473890 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 718 | Open in IMG/M |
3300005177|Ga0066690_10389380 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 946 | Open in IMG/M |
3300005177|Ga0066690_10463826 | All Organisms → cellular organisms → Bacteria | 856 | Open in IMG/M |
3300005184|Ga0066671_11051183 | Not Available | 510 | Open in IMG/M |
3300005187|Ga0066675_10475492 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 932 | Open in IMG/M |
3300005329|Ga0070683_100061009 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3505 | Open in IMG/M |
3300005329|Ga0070683_101138949 | Not Available | 749 | Open in IMG/M |
3300005332|Ga0066388_100303907 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2241 | Open in IMG/M |
3300005332|Ga0066388_101688573 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 1120 | Open in IMG/M |
3300005332|Ga0066388_103066119 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 854 | Open in IMG/M |
3300005336|Ga0070680_100012250 | All Organisms → cellular organisms → Bacteria | 6659 | Open in IMG/M |
3300005338|Ga0068868_101687136 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 597 | Open in IMG/M |
3300005345|Ga0070692_10678596 | Not Available | 691 | Open in IMG/M |
3300005366|Ga0070659_101738461 | Not Available | 558 | Open in IMG/M |
3300005434|Ga0070709_10036276 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3002 | Open in IMG/M |
3300005434|Ga0070709_10256147 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 1263 | Open in IMG/M |
3300005434|Ga0070709_10291848 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1188 | Open in IMG/M |
3300005434|Ga0070709_10523650 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 904 | Open in IMG/M |
3300005434|Ga0070709_10548114 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 884 | Open in IMG/M |
3300005435|Ga0070714_100352499 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 1382 | Open in IMG/M |
3300005435|Ga0070714_100769152 | Not Available | 931 | Open in IMG/M |
3300005436|Ga0070713_100325080 | Not Available | 1421 | Open in IMG/M |
3300005436|Ga0070713_101058246 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 783 | Open in IMG/M |
3300005436|Ga0070713_101171699 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 743 | Open in IMG/M |
3300005436|Ga0070713_101648701 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 622 | Open in IMG/M |
3300005436|Ga0070713_101695229 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 613 | Open in IMG/M |
3300005437|Ga0070710_10590460 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 772 | Open in IMG/M |
3300005437|Ga0070710_10600669 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 766 | Open in IMG/M |
3300005439|Ga0070711_100045600 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 2983 | Open in IMG/M |
3300005439|Ga0070711_100244152 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1405 | Open in IMG/M |
3300005439|Ga0070711_101288904 | Not Available | 634 | Open in IMG/M |
3300005439|Ga0070711_101361052 | Not Available | 617 | Open in IMG/M |
3300005445|Ga0070708_101755937 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 576 | Open in IMG/M |
3300005458|Ga0070681_10709696 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 922 | Open in IMG/M |
3300005458|Ga0070681_10811945 | Not Available | 853 | Open in IMG/M |
3300005458|Ga0070681_11080105 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 723 | Open in IMG/M |
3300005468|Ga0070707_101021692 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 792 | Open in IMG/M |
3300005526|Ga0073909_10007891 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3182 | Open in IMG/M |
3300005526|Ga0073909_10271763 | All Organisms → cellular organisms → Bacteria | 760 | Open in IMG/M |
3300005530|Ga0070679_100100230 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2883 | Open in IMG/M |
3300005532|Ga0070739_10044615 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2974 | Open in IMG/M |
3300005533|Ga0070734_10021752 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 4215 | Open in IMG/M |
3300005537|Ga0070730_10025984 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4474 | Open in IMG/M |
3300005537|Ga0070730_10038481 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3542 | Open in IMG/M |
3300005537|Ga0070730_10040347 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 3444 | Open in IMG/M |
3300005537|Ga0070730_10842108 | Not Available | 577 | Open in IMG/M |
3300005542|Ga0070732_10007612 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5895 | Open in IMG/M |
3300005542|Ga0070732_10021175 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3662 | Open in IMG/M |
3300005554|Ga0066661_10038709 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2678 | Open in IMG/M |
3300005555|Ga0066692_10118074 | Not Available | 1596 | Open in IMG/M |
3300005559|Ga0066700_10950207 | Not Available | 568 | Open in IMG/M |
3300005568|Ga0066703_10645555 | Not Available | 613 | Open in IMG/M |
3300005575|Ga0066702_10011179 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4022 | Open in IMG/M |
3300005587|Ga0066654_10155183 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 1165 | Open in IMG/M |
3300005713|Ga0066905_101241332 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 668 | Open in IMG/M |
3300005764|Ga0066903_100103295 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3864 | Open in IMG/M |
3300005764|Ga0066903_100309396 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2510 | Open in IMG/M |
3300005764|Ga0066903_101394471 | Not Available | 1316 | Open in IMG/M |
3300005764|Ga0066903_102264074 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1049 | Open in IMG/M |
3300005764|Ga0066903_102598227 | Not Available | 981 | Open in IMG/M |
3300005834|Ga0068851_10374561 | Not Available | 833 | Open in IMG/M |
3300005842|Ga0068858_101348624 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 702 | Open in IMG/M |
3300005949|Ga0066791_10023540 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1235 | Open in IMG/M |
3300006028|Ga0070717_10188427 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1801 | Open in IMG/M |
3300006028|Ga0070717_10659877 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 950 | Open in IMG/M |
3300006028|Ga0070717_11613733 | Not Available | 588 | Open in IMG/M |
3300006050|Ga0075028_100028622 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 2534 | Open in IMG/M |
3300006050|Ga0075028_100244190 | Not Available | 984 | Open in IMG/M |
3300006173|Ga0070716_101405057 | Not Available | 568 | Open in IMG/M |
3300006175|Ga0070712_100745826 | Not Available | 837 | Open in IMG/M |
3300006354|Ga0075021_10619128 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 692 | Open in IMG/M |
3300006354|Ga0075021_10891390 | Not Available | 577 | Open in IMG/M |
3300006426|Ga0075037_1811013 | Not Available | 625 | Open in IMG/M |
3300006755|Ga0079222_10124737 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1410 | Open in IMG/M |
3300006794|Ga0066658_10623453 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 589 | Open in IMG/M |
3300006794|Ga0066658_10815767 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 527 | Open in IMG/M |
3300006804|Ga0079221_10243450 | All Organisms → cellular organisms → Bacteria | 1017 | Open in IMG/M |
3300006854|Ga0075425_100026827 | All Organisms → cellular organisms → Bacteria | 6361 | Open in IMG/M |
3300006854|Ga0075425_101415374 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 786 | Open in IMG/M |
3300006914|Ga0075436_101389034 | Not Available | 532 | Open in IMG/M |
3300006954|Ga0079219_10030193 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 2133 | Open in IMG/M |
3300006954|Ga0079219_10108932 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 1381 | Open in IMG/M |
3300006954|Ga0079219_10425391 | Not Available | 893 | Open in IMG/M |
3300007788|Ga0099795_10032389 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1807 | Open in IMG/M |
3300007788|Ga0099795_10363612 | Not Available | 650 | Open in IMG/M |
3300009038|Ga0099829_10016046 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5012 | Open in IMG/M |
3300009088|Ga0099830_11300970 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 604 | Open in IMG/M |
3300009093|Ga0105240_10237520 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2114 | Open in IMG/M |
3300009143|Ga0099792_11112852 | Not Available | 532 | Open in IMG/M |
3300009174|Ga0105241_10358293 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 1269 | Open in IMG/M |
3300009174|Ga0105241_10608455 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 988 | Open in IMG/M |
3300009174|Ga0105241_11419184 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 665 | Open in IMG/M |
3300009661|Ga0105858_1206324 | Not Available | 580 | Open in IMG/M |
3300010043|Ga0126380_10250377 | Not Available | 1226 | Open in IMG/M |
3300010043|Ga0126380_10533149 | Not Available | 909 | Open in IMG/M |
3300010043|Ga0126380_11955602 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 535 | Open in IMG/M |
3300010046|Ga0126384_11076153 | Not Available | 736 | Open in IMG/M |
3300010046|Ga0126384_11191362 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 702 | Open in IMG/M |
3300010048|Ga0126373_11588025 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 719 | Open in IMG/M |
3300010048|Ga0126373_12493031 | Not Available | 576 | Open in IMG/M |
3300010154|Ga0127503_10711700 | Not Available | 552 | Open in IMG/M |
3300010159|Ga0099796_10122360 | Not Available | 1001 | Open in IMG/M |
3300010358|Ga0126370_10876514 | Not Available | 808 | Open in IMG/M |
3300010359|Ga0126376_11695975 | Not Available | 667 | Open in IMG/M |
3300010359|Ga0126376_13084761 | Not Available | 515 | Open in IMG/M |
3300010360|Ga0126372_10530317 | All Organisms → cellular organisms → Bacteria | 1113 | Open in IMG/M |
3300010361|Ga0126378_10000018 | All Organisms → cellular organisms → Bacteria | 143585 | Open in IMG/M |
3300010361|Ga0126378_11261771 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 835 | Open in IMG/M |
3300010361|Ga0126378_12228109 | Not Available | 625 | Open in IMG/M |
3300010362|Ga0126377_11700878 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 706 | Open in IMG/M |
3300010362|Ga0126377_13096441 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 537 | Open in IMG/M |
3300010371|Ga0134125_10014874 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium | 8705 | Open in IMG/M |
3300010371|Ga0134125_10603078 | Not Available | 1213 | Open in IMG/M |
3300010373|Ga0134128_10102550 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3254 | Open in IMG/M |
3300010373|Ga0134128_10254524 | All Organisms → cellular organisms → Bacteria | 1970 | Open in IMG/M |
3300010375|Ga0105239_10225279 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 2103 | Open in IMG/M |
3300010375|Ga0105239_10317003 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 1758 | Open in IMG/M |
3300010375|Ga0105239_11026941 | Not Available | 948 | Open in IMG/M |
3300010396|Ga0134126_11713688 | Not Available | 690 | Open in IMG/M |
3300010401|Ga0134121_11543946 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 681 | Open in IMG/M |
3300011270|Ga0137391_11516838 | Not Available | 515 | Open in IMG/M |
3300011332|Ga0126317_10928796 | Not Available | 635 | Open in IMG/M |
3300012096|Ga0137389_11392034 | Not Available | 597 | Open in IMG/M |
3300012096|Ga0137389_11833281 | Not Available | 502 | Open in IMG/M |
3300012189|Ga0137388_10958766 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 790 | Open in IMG/M |
3300012189|Ga0137388_11458163 | Not Available | 622 | Open in IMG/M |
3300012202|Ga0137363_10023128 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4198 | Open in IMG/M |
3300012207|Ga0137381_11687947 | Not Available | 524 | Open in IMG/M |
3300012210|Ga0137378_10376696 | All Organisms → cellular organisms → Bacteria | 1318 | Open in IMG/M |
3300012212|Ga0150985_118255759 | Not Available | 641 | Open in IMG/M |
3300012357|Ga0137384_10000072 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 65814 | Open in IMG/M |
3300012357|Ga0137384_11401054 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
3300012469|Ga0150984_108304377 | Not Available | 610 | Open in IMG/M |
3300012469|Ga0150984_122820205 | Not Available | 652 | Open in IMG/M |
3300012683|Ga0137398_10308542 | Not Available | 1065 | Open in IMG/M |
3300012683|Ga0137398_10341891 | All Organisms → cellular organisms → Bacteria | 1012 | Open in IMG/M |
3300012685|Ga0137397_10377882 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1055 | Open in IMG/M |
3300012917|Ga0137395_10035291 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3050 | Open in IMG/M |
3300012924|Ga0137413_10589156 | All Organisms → cellular organisms → Bacteria | 830 | Open in IMG/M |
3300012929|Ga0137404_10024122 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4429 | Open in IMG/M |
3300012929|Ga0137404_10144346 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1973 | Open in IMG/M |
3300012929|Ga0137404_11956688 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 546 | Open in IMG/M |
3300012931|Ga0153915_10124631 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 2764 | Open in IMG/M |
3300012931|Ga0153915_10469369 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1435 | Open in IMG/M |
3300012944|Ga0137410_12014575 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 513 | Open in IMG/M |
3300012960|Ga0164301_10403636 | Not Available | 957 | Open in IMG/M |
3300012961|Ga0164302_10992481 | Not Available | 653 | Open in IMG/M |
3300012971|Ga0126369_10942232 | Not Available | 950 | Open in IMG/M |
3300012971|Ga0126369_11642817 | All Organisms → cellular organisms → Bacteria | 732 | Open in IMG/M |
3300012971|Ga0126369_12279544 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 628 | Open in IMG/M |
3300012971|Ga0126369_13059019 | Not Available | 548 | Open in IMG/M |
3300012985|Ga0164308_12200983 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 513 | Open in IMG/M |
3300012987|Ga0164307_10802538 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 748 | Open in IMG/M |
3300012989|Ga0164305_10795117 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 784 | Open in IMG/M |
3300012989|Ga0164305_11427665 | Not Available | 611 | Open in IMG/M |
3300013296|Ga0157374_11260045 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 761 | Open in IMG/M |
3300013307|Ga0157372_11461439 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 788 | Open in IMG/M |
3300014969|Ga0157376_11602552 | Not Available | 685 | Open in IMG/M |
3300015089|Ga0167643_1019740 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 1027 | Open in IMG/M |
3300015245|Ga0137409_10110711 | All Organisms → cellular organisms → Bacteria | 2539 | Open in IMG/M |
3300015245|Ga0137409_11382297 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 549 | Open in IMG/M |
3300017936|Ga0187821_10302208 | Not Available | 636 | Open in IMG/M |
3300018431|Ga0066655_10498703 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 807 | Open in IMG/M |
3300018433|Ga0066667_10429876 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1074 | Open in IMG/M |
3300018468|Ga0066662_10200067 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1578 | Open in IMG/M |
3300018468|Ga0066662_10212430 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1542 | Open in IMG/M |
3300018468|Ga0066662_10351576 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1268 | Open in IMG/M |
3300018468|Ga0066662_10414385 | Not Available | 1190 | Open in IMG/M |
3300018468|Ga0066662_12954006 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 505 | Open in IMG/M |
3300019789|Ga0137408_1141405 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2000 | Open in IMG/M |
3300019789|Ga0137408_1252669 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 1733 | Open in IMG/M |
3300020069|Ga0197907_10884324 | Not Available | 513 | Open in IMG/M |
3300020075|Ga0206349_1073517 | Not Available | 567 | Open in IMG/M |
3300020076|Ga0206355_1158453 | All Organisms → cellular organisms → Bacteria | 749 | Open in IMG/M |
3300020078|Ga0206352_10538458 | Not Available | 782 | Open in IMG/M |
3300020140|Ga0179590_1216664 | Not Available | 524 | Open in IMG/M |
3300020610|Ga0154015_1517740 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1985 | Open in IMG/M |
3300021180|Ga0210396_10189828 | Not Available | 1838 | Open in IMG/M |
3300021403|Ga0210397_10172304 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1529 | Open in IMG/M |
3300021403|Ga0210397_10356667 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 1085 | Open in IMG/M |
3300021404|Ga0210389_10013406 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 6330 | Open in IMG/M |
3300021560|Ga0126371_10441168 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1447 | Open in IMG/M |
3300021560|Ga0126371_10704723 | Not Available | 1157 | Open in IMG/M |
3300021560|Ga0126371_10775821 | Not Available | 1105 | Open in IMG/M |
3300021560|Ga0126371_11650891 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 766 | Open in IMG/M |
3300021560|Ga0126371_11920724 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 711 | Open in IMG/M |
3300021560|Ga0126371_12147727 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 673 | Open in IMG/M |
3300022467|Ga0224712_10291885 | Not Available | 761 | Open in IMG/M |
3300022467|Ga0224712_10433420 | Not Available | 629 | Open in IMG/M |
3300025544|Ga0208078_1006848 | All Organisms → cellular organisms → Bacteria | 2804 | Open in IMG/M |
3300025905|Ga0207685_10128332 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 1122 | Open in IMG/M |
3300025905|Ga0207685_10424587 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 686 | Open in IMG/M |
3300025906|Ga0207699_10105257 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1798 | Open in IMG/M |
3300025912|Ga0207707_10014393 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 6890 | Open in IMG/M |
3300025912|Ga0207707_10164251 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1940 | Open in IMG/M |
3300025912|Ga0207707_10540718 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 991 | Open in IMG/M |
3300025913|Ga0207695_10508709 | Not Available | 1086 | Open in IMG/M |
3300025917|Ga0207660_10975847 | Not Available | 691 | Open in IMG/M |
3300025921|Ga0207652_10941449 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 761 | Open in IMG/M |
3300025928|Ga0207700_10037518 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 3510 | Open in IMG/M |
3300025929|Ga0207664_11068494 | Not Available | 722 | Open in IMG/M |
3300025929|Ga0207664_11602492 | Not Available | 573 | Open in IMG/M |
3300026304|Ga0209240_1109101 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 973 | Open in IMG/M |
3300026551|Ga0209648_10030200 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4735 | Open in IMG/M |
3300026552|Ga0209577_10110349 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2216 | Open in IMG/M |
3300026557|Ga0179587_10569777 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 745 | Open in IMG/M |
3300027037|Ga0209005_1009739 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1108 | Open in IMG/M |
3300027117|Ga0209732_1066916 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 625 | Open in IMG/M |
3300027521|Ga0209524_1135985 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 510 | Open in IMG/M |
3300027574|Ga0208982_1031545 | All Organisms → cellular organisms → Bacteria | 1042 | Open in IMG/M |
3300027591|Ga0209733_1069726 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 912 | Open in IMG/M |
3300027765|Ga0209073_10089141 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1074 | Open in IMG/M |
3300027773|Ga0209810_1128014 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 1092 | Open in IMG/M |
3300027775|Ga0209177_10005651 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2576 | Open in IMG/M |
3300027842|Ga0209580_10037908 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2213 | Open in IMG/M |
3300027846|Ga0209180_10139662 | Not Available | 1393 | Open in IMG/M |
3300027857|Ga0209166_10036024 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2975 | Open in IMG/M |
3300027857|Ga0209166_10454747 | Not Available | 661 | Open in IMG/M |
3300027894|Ga0209068_10419345 | Not Available | 765 | Open in IMG/M |
3300027903|Ga0209488_10264269 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1289 | Open in IMG/M |
3300028800|Ga0265338_10122464 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2070 | Open in IMG/M |
3300028800|Ga0265338_10352012 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1059 | Open in IMG/M |
3300031231|Ga0170824_119126936 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2063 | Open in IMG/M |
3300031231|Ga0170824_125823513 | Not Available | 616 | Open in IMG/M |
3300031716|Ga0310813_10438294 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 1131 | Open in IMG/M |
3300031720|Ga0307469_10442128 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1123 | Open in IMG/M |
3300032174|Ga0307470_11866642 | Not Available | 510 | Open in IMG/M |
3300032180|Ga0307471_100897522 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1054 | Open in IMG/M |
3300033412|Ga0310810_10604806 | Not Available | 1052 | Open in IMG/M |
3300033475|Ga0310811_11120231 | Not Available | 664 | Open in IMG/M |
3300033480|Ga0316620_10703443 | Not Available | 961 | Open in IMG/M |
3300033480|Ga0316620_10881534 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 864 | Open in IMG/M |
3300033513|Ga0316628_100023755 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5810 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 13.25% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 11.24% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 10.44% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 5.62% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.22% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 4.82% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 4.02% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.61% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.61% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 3.21% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 2.81% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.81% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.41% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.41% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.01% |
Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 1.61% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.61% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 1.61% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.20% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.20% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.20% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.20% |
Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.80% |
Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.80% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.80% |
Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 0.80% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.80% |
Host-Associated | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated | 0.80% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.80% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.80% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.80% |
Sugar Cane Bagasse Incubating Bioreactor | Engineered → Solid Waste → Grass → Composting → Bioreactor → Sugar Cane Bagasse Incubating Bioreactor | 0.80% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.40% |
Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.40% |
Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.40% |
Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.40% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.40% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.40% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.40% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.40% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.40% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.40% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.40% |
Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 0.40% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2170459010 | Grass soil microbial communities from Rothamsted Park, UK - December 2009 direct MP BIO1O1 lysis 0-9cm (no DNA from 10 to 21cm!!!) | Environmental | Open in IMG/M |
2170459017 | Litter degradation ZMR4 | Engineered | Open in IMG/M |
3300000156 | Sugar cane bagasse incubating bioreactor microbial communities from Sao Carlos, Brazil, that are aerobic and semianaerobic | Engineered | Open in IMG/M |
3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
3300002906 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm | Environmental | Open in IMG/M |
3300003321 | Sugarcane bulk soil Sample H1 | Environmental | Open in IMG/M |
3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
3300005532 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1 | Environmental | Open in IMG/M |
3300005533 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 | Environmental | Open in IMG/M |
3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Host-Associated | Open in IMG/M |
3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
3300005949 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil leachate replicate DNA2013-051 | Environmental | Open in IMG/M |
3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
3300006426 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate RNA 2013_054 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
3300009661 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-062 | Environmental | Open in IMG/M |
3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010154 | Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
3300011332 | Soil microbial communities from California, USA to study soil gas exchange rates - SR-CA-SC2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
3300015089 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G8A, Adjacent to main proglacial river, end of transect (Watson river)) | Environmental | Open in IMG/M |
3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300017936 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1 | Environmental | Open in IMG/M |
3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) | Environmental | Open in IMG/M |
3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300020140 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300025544 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-2 deep-072012 (SPAdes) | Environmental | Open in IMG/M |
3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes) | Environmental | Open in IMG/M |
3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
3300027037 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_O2 (SPAdes) | Environmental | Open in IMG/M |
3300027117 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O1 (SPAdes) | Environmental | Open in IMG/M |
3300027521 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027574 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_O3 (SPAdes) | Environmental | Open in IMG/M |
3300027591 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027765 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes) | Environmental | Open in IMG/M |
3300027773 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027775 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes) | Environmental | Open in IMG/M |
3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027857 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Host-Associated | Open in IMG/M |
3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
3300033475 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC | Environmental | Open in IMG/M |
3300033480 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D5_B | Environmental | Open in IMG/M |
3300033513 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_C | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
F62_05597470 | 2170459010 | Grass Soil | MPTVNFLAHHILPVFQYLFIAGLIGAVPVIIITAIKTAQSM |
4ZMR_02314060 | 2170459017 | Switchgrass, Maize And Mischanthus Litter | MPRVSFLVHYILPVFKYLFFIGLIGAVPVIIVTAVKTAQSMLEED |
NODE_07071786 | 3300000156 | Sugar Cane Bagasse Incubating Bioreactor | MTVVNFLLHHFLLLFQYLFFAGLIGAVPVIIITAIKTAQSMLEHD* |
NODE_07071787 | 3300000156 | Sugar Cane Bagasse Incubating Bioreactor | MTIVNFVLHHFLLLFQYLFFAGLIGAVPVIIITAIKTAQSMLEHD* |
JGIcombinedJ26739_1004224942 | 3300002245 | Forest Soil | MPAVNFLVHHXLPLFQYLFLAGLIGAVPVIIVTAIKTAQSMLEED* |
C688J35102_1195174432 | 3300002568 | Soil | VNFLVHYFLPVFKYLFFIGLIGAVPVIIVTAVKTAQSMLEED* |
JGI25614J43888_101380202 | 3300002906 | Grasslands Soil | MTIVNFVVHYVLPFFKYLFFAGLIGAVPVIIITAIKTAQSMLEED* |
soilH1_100202202 | 3300003321 | Sugarcane Root And Bulk Soil | MTAVQFVVDHLLPFFKYLFFLGMIGAIPVIIITAVKTAQSMLERD* |
soilH1_101266322 | 3300003321 | Sugarcane Root And Bulk Soil | VNFLVHYFLPAFKYLFFAGLLGAVPVIIVTAVKTAQSIFEEDEPVRDHKA* |
soilH1_102407832 | 3300003321 | Sugarcane Root And Bulk Soil | MQIVNFVVHYLLPVFKYLFFAGMLGAVPVIVITAIKTAQSMFEEDEPARDHQA* |
soilH1_102728752 | 3300003321 | Sugarcane Root And Bulk Soil | VNFVVHIFLPFFKYLFFAGLIGAVPVIIITAIKTAQSMLEED* |
Ga0062593_1001911912 | 3300004114 | Soil | VNFVVNHILPIFKYLFIVGMLGAVPVIIVTAIKTAQSMFETDESARDHKA* |
Ga0062595_1017036612 | 3300004479 | Soil | VNFVVHYFLPAFKYLFFAGLIGAIPVIIITAIKTAQSMLEQD* |
Ga0062595_1025926071 | 3300004479 | Soil | VNFVVEHILPIFKYLFFVGMLGAVPVIIVTAIKTAQSIFESDESARDHKA* |
Ga0058863_100725322 | 3300004799 | Host-Associated | VVNHILPIFKYLFIVGMLGAVPVIIVTAIKTAQSMFETDESARDHKA* |
Ga0058863_105494911 | 3300004799 | Host-Associated | HILPVFKYLFFVGLIGAVPVIVITAIKTAQSMLEEDEPARENKA* |
Ga0066677_104738902 | 3300005171 | Soil | VNFVVRYFLPVFQYLFIAGLIGAIPVIIITAIRTAESMLEEDQNGQAGHGS* |
Ga0066690_103893802 | 3300005177 | Soil | MLGVSFLVHYILPVFKYLFFAGLIGAVPVIIVTAIKTAQSMLEED* |
Ga0066690_104638262 | 3300005177 | Soil | MPRVNFLVHHILPLFQYLFIAGLIGAVPVIIITAIKTAQSMLEED* |
Ga0066671_110511831 | 3300005184 | Soil | IRHFLPIFQYLFLAGLIGSIPVIIITAIKTAQSMLEEDAGGQTGSNS* |
Ga0066675_104754922 | 3300005187 | Soil | VNFVVRYFLPVFQYLFIAGLIGAIPVIIITAIRTAESMLEEDQNGQAGHSS* |
Ga0070683_1000610093 | 3300005329 | Corn Rhizosphere | MSRVNFLVHYILPVFKYLFFVGLIGAVPVIIVTAVKTAQSMLEED* |
Ga0070683_1011389492 | 3300005329 | Corn Rhizosphere | MPRVSFLVHYILPVFKYLFFIGLIGAVPVIIVTAVKTAQSMLEED* |
Ga0066388_1003039072 | 3300005332 | Tropical Forest Soil | MTIVNFVVHYILPVFNYLFIAGLIGAVPVIIITAVKTAQSMLEED* |
Ga0066388_1016885732 | 3300005332 | Tropical Forest Soil | VNFVVHYLLPVFKYLFFIGLIGAVPVIIITAIKTAKSMLEQD* |
Ga0066388_1030661192 | 3300005332 | Tropical Forest Soil | MTIVNFLVHHILPLFQYLFLAGLIGAVPVIIITAVKTAQSMLEED* |
Ga0070680_1000122506 | 3300005336 | Corn Rhizosphere | VNFVVHYILPVFKYLFFAGMIGAVPVIIITAIKTAQSMFEQDEPAPDHKA* |
Ga0068868_1016871362 | 3300005338 | Miscanthus Rhizosphere | MPRVNFLVHYILPVFKYLFFAGLIGAVPVIIVTAVKTAQSMLEED* |
Ga0070692_106785961 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | MLRVSFLVHYILPVFKYLFFAGLIGAVPVIIVTAVKTAQSMLEED* |
Ga0070659_1017384612 | 3300005366 | Corn Rhizosphere | YILPVFKYLFFAGMIGAVPVIIITAIKTAQSMFEQDEPAPDHKA* |
Ga0070709_100362762 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MPEVNFLAHYILPMFQYLFIAGLIGAVPVIIITAIKTAQSMLEED* |
Ga0070709_102561471 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | VNFLAHYILPVFQYVFIAGLIGAVPVIIITAIKTAQSMLEED |
Ga0070709_102918482 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MPRVSFLVHYILPVFKYLFFAGLIGAVPVIIVTAIKTAQSMLEED* |
Ga0070709_105236502 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MHRTTMPRVNFLVHYILPVFKYLFFAGLIGAVPVIIVTAVKTAQSMLEED* |
Ga0070709_105481142 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MTIVNFVVHHVLPLFKYLFFAGLVGAVPVIIITAIKTAQSMLEED* |
Ga0070714_1003524991 | 3300005435 | Agricultural Soil | MPRVSFLVHYILPVFKYLFFAGLIGAVPVIIVTAVKTAQSMLEED* |
Ga0070714_1007691521 | 3300005435 | Agricultural Soil | VNFLVHYVLPVFKYLFFAGMIGAVPVIVITAVMTAKSMLEQDQ* |
Ga0070713_1003250802 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MPEVNFLAHYILPVFQYVFIAGLIGAVPVIIITAIKTAQSMLEED* |
Ga0070713_1010582462 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MPRVNFLAHYILPVFQYLFIAGLIGAVPVIIITAIKTAQSMLEED* |
Ga0070713_1011716992 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MPRVNFLVHHVLPLFQYLFIAGLIGAVPVIIITAIKTAQSMLEED* |
Ga0070713_1016487011 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MPRVNFLAHYILPVFQYLFIAGLIGAVPVIIVTAIKTAQSMLEED* |
Ga0070713_1016952291 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MPTVNFLVHHVLPLFQYLFIAGLIGAVPVIIITAIKTAQSMLEED* |
Ga0070710_105904602 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | VNFLVHYVLPVFKYLFFAGMIGAVPVVVITAVMTAKSMLEQDQ* |
Ga0070710_106006692 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | VNFLVHHVLPVFQYLFLAGLIGAVPVIIITAIKTAQSMLEED* |
Ga0070711_1000456001 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MPTVNFLAHHILPVFQYLFIAGLIGAVPVIIITAIKTAQSMLEED* |
Ga0070711_1002441522 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MPRVNFLAHYILSAFQYLFIAGLIGAVPVIIITAIKTAQSMLEED* |
Ga0070711_1012889041 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | VNFLVHYVLPVFKYLFFAGMIGAVPVIVITAVMTAKSMLEPDQ* |
Ga0070711_1013610521 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | GSTTISTVNFVVHYFLPAFKFLFFAGMIGAVPVIIITAIKTAQSMLEPD* |
Ga0070708_1017559372 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | LIPLRYRTTIAIVNFLVHHVLPVFQYLFLAGLIGAVPVIIITAIK |
Ga0070681_107096962 | 3300005458 | Corn Rhizosphere | MPRVNFLVHYILPVFKYLFFVGLIGAVPVIIVTAVKTAQSMLEED* |
Ga0070681_108119452 | 3300005458 | Corn Rhizosphere | MHGVDFLVHYILPVFKYLFFAGLIGAVPVIIVTAIKTAQSMLEED* |
Ga0070681_110801052 | 3300005458 | Corn Rhizosphere | MPTVNFLVHHILPLFQYLFLAGLIGAVPVIIVTAIKTAQSMLEED* |
Ga0070707_1010216921 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MPRVNFLVHYILPVFQYLFIAGLIGAVPVIIITAIKTAQSMLEED* |
Ga0073909_100078912 | 3300005526 | Surface Soil | MTIVNFLVHHVLPVFQYLFLAGLIGAVPVIIITAIKTAQSMLEED* |
Ga0073909_102717632 | 3300005526 | Surface Soil | LVHHVLPVFQYLFLAGLIGAVPVIIITAIKTAQSMLEED* |
Ga0070679_1001002302 | 3300005530 | Corn Rhizosphere | MPTVSFLVHYILPVFKYLFFIGLIGAVPVIIVTAVKTAQSMLEED* |
Ga0070739_100446152 | 3300005532 | Surface Soil | MSYVNFVVRHVLPIFQYLFIAGLIGAVPVIIITAVKTAQSMLEED* |
Ga0070734_100217524 | 3300005533 | Surface Soil | VSFLVHHILPVFEYTFLAGLIGAVPVIIITAIKTAQSMLEED* |
Ga0070730_100259842 | 3300005537 | Surface Soil | LEIVNFLVHHILPVFKYLFFAGLIGAIPVIIITAIKTAQSMLEQD* |
Ga0070730_100384813 | 3300005537 | Surface Soil | MHRTTMQRVNFLAHHILPLFQYLFIAGLIGAVPVIIITAIKTAQSMLEED* |
Ga0070730_100403472 | 3300005537 | Surface Soil | MPRVNFLVHYILPVFQYLFIAGLIGAVPVIIVTAIKTAQSMLEED* |
Ga0070730_108421082 | 3300005537 | Surface Soil | VSFLVHYILPVFKYLFFAGLIGAVPVIIVTAIKTAQSMLEED* |
Ga0070732_100076123 | 3300005542 | Surface Soil | MQRVNFLVHYILPVFKYLFFAGLIGAVPVIIVTAVKTAQSMLEED* |
Ga0070732_100211752 | 3300005542 | Surface Soil | MPRVNFLVHHILPLFQYLFIAGLIGAVPVIIVTAIKTAQSMLEED* |
Ga0066661_100387092 | 3300005554 | Soil | MCAVNFVVRHILPLFQYLFLAGLIGAIPVIIVTAIRTAESMFEEDHDGQTGRRS* |
Ga0066692_101180742 | 3300005555 | Soil | KLLQTRENMANRASSLIPLRYRTTIAIVNFLVHHVLPVFQYLFLAGLIGAVPVIIITAIKTAQSMLEED* |
Ga0066700_109502071 | 3300005559 | Soil | HHILPLFQYLFIAGLIGAVPVIIITAIKTAQSMLEED* |
Ga0066703_106455552 | 3300005568 | Soil | MLRVSFLVHYILPVFKYLFFAGLIGAVPVIIVTAIKTAQSMLEED* |
Ga0066702_100111792 | 3300005575 | Soil | VNFLVHHVLPVFKYLFFTGLIGAVPVIIITAIKTAKSILEED* |
Ga0066654_101551831 | 3300005587 | Soil | VNFVVRYFLPVFQYLFIIGLIGAIPVIIITAIRTAESMLEEDQNGQTGHSS* |
Ga0066905_1012413322 | 3300005713 | Tropical Forest Soil | MTIVNFVVHYFLPVVQYLFFAGLIGAVPVIVITAIKTAKSMLEED* |
Ga0066903_1001032952 | 3300005764 | Tropical Forest Soil | MTIVNFVVHYILPVFNYLFIAGLIGAVPVIIITAIKTAQSMVEED* |
Ga0066903_1003093962 | 3300005764 | Tropical Forest Soil | MAIVNFLVHHVLPIFQFLFFAGLIGAVPVILITAVKTAQSMLEED* |
Ga0066903_1013944711 | 3300005764 | Tropical Forest Soil | VNFVVHYLLPVIKYLFFAGMIGAVPVIVITAVMTAKSMLEQDQ* |
Ga0066903_1022640742 | 3300005764 | Tropical Forest Soil | MKIVNFVVHYILPVFNYLFIAGLIGAVPVIIITAVKTAQSMLEED* |
Ga0066903_1025982272 | 3300005764 | Tropical Forest Soil | PARTTMTIVNFVVHYFFPLVQYLFFVGLIGAVPVIVITAIKTAKSMLEED* |
Ga0068851_103745611 | 3300005834 | Corn Rhizosphere | HRTTMPRVNFLVHYILPVFKYLFFIGLIGAVPVIIVTAVKTAQSMLEED* |
Ga0068858_1013486242 | 3300005842 | Switchgrass Rhizosphere | MFRVSFLVHYILPVFKYLFFAGLIGAVPVIIVTAIKTAQSMLEED* |
Ga0066791_100235402 | 3300005949 | Soil | VNFLVHHILPVFQYFFFAGLFGAVPVIIITAIKTAQSMLEGE* |
Ga0070717_101884272 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | VKFLVHHVLPVFQYLFLAGLIGAVPVIIITAIKTAQSMLEED* |
Ga0070717_106598771 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MTIVNFVVHHVLPLFQYLFFAGLIGAVPVIIVTAIKTAQSMLEED* |
Ga0070717_116137331 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | RVSFLVHYILPVFKYLFFAGLIGAVPVIIVTAIKTAQSMLEED* |
Ga0075028_1000286222 | 3300006050 | Watersheds | VNFLVHHVFPVFQYLFLAGLIGAVPVIIITAIKTAQSMLEED* |
Ga0075028_1002441902 | 3300006050 | Watersheds | IVNFLVHHVFPVFQWLFLAGLIGAVPVIIITAIKTAQSMLEED* |
Ga0070716_1014050571 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | FLVHYILPVFKYLFFAGLIGAVPVIIVTAVKTAQSMLEED* |
Ga0070712_1007458261 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | RTLIPPTHRTTMPRVSFLVHYILPVFKYLFFAGLIGAVPVIIVTAVKTAQSMLEED* |
Ga0075021_106191282 | 3300006354 | Watersheds | MPRMNFLAHYILPVFQYLFIAGLIGAVPVIIITAIKTAQSMLEED* |
Ga0075021_108913902 | 3300006354 | Watersheds | MTIVNFLVHHVFPVFQWLFLAGLIGAVPVIIITAIKTAQSMLEED* |
Ga0075037_18110132 | 3300006426 | Permafrost Soil | YFLPAFKYLFFAGLIGAIPVIIVTAIRTAGSMLEEDEPAREHKG* |
Ga0079222_101247372 | 3300006755 | Agricultural Soil | MPRVNFLVHYILPVFQYLFIAGLIGAVPVIIVTAIKTAQSMLKED* |
Ga0066658_106234532 | 3300006794 | Soil | VVRYFLPVFQYLFIAGLIGAIPVIIITAIRTAESMLEEDQNG |
Ga0066658_108157672 | 3300006794 | Soil | VNFVERYFLPVFQYLFIAGLIGAIPVIIITAIRTAESMLEEDQNG |
Ga0079221_102434502 | 3300006804 | Agricultural Soil | MPTVNFLVHHVLPLFQYLYIAGLIGAVPVIIITAIKTAQSMLEED* |
Ga0075425_1000268279 | 3300006854 | Populus Rhizosphere | VVRYFLPVFQYLFIAGLIGAIPVIIITAIRTAESMLEEDQNGQAGHGS* |
Ga0075425_1014153741 | 3300006854 | Populus Rhizosphere | MTIVNFLVHHILPLFQYLFFAGLIGAVPVIIVTAVKTAQSMLEED* |
Ga0075436_1013890341 | 3300006914 | Populus Rhizosphere | HTMPRVNFLVHYILPVFQYLFIAGLIGAVPVIIVTAIKTAQSMLEED* |
Ga0079219_100301932 | 3300006954 | Agricultural Soil | VNFLVHHVLPIFEYLFLAGLIGAVPVIVITAMKTAQSMLEED* |
Ga0079219_101089322 | 3300006954 | Agricultural Soil | VNFVVHYILPVFKYLFFAGMIGAVPVIIITAIKTAQS |
Ga0079219_104253912 | 3300006954 | Agricultural Soil | VNFVVHYFLPAFKYLFFAGLIGAVPVIIITAIKTAQSMLESD* |
Ga0099795_100323892 | 3300007788 | Vadose Zone Soil | MPTVNFLVHHILPLFQYLFLAGLIGAVPVIIITAIKTAQSMLEED* |
Ga0099795_103636122 | 3300007788 | Vadose Zone Soil | MPTVNFLVHHILPLFQYLFFAGLIGAVPVIIVTAIKTAQSMLEED* |
Ga0099829_100160464 | 3300009038 | Vadose Zone Soil | VNFLVHYFLPVFKYLFFAGLIGAIPVIIVTAIRTAESMLEEDEPVRENKG* |
Ga0099830_113009701 | 3300009088 | Vadose Zone Soil | MAGMHFVVKYVLPVFQYLFFAGLVGAIPVVVITAIRTAKSMTERG* |
Ga0105240_102375202 | 3300009093 | Corn Rhizosphere | VNFLVQHFLPVFKYLFFAGLIGAIPVIIITAIRTAGSMLEEDEPLRENKG* |
Ga0099792_111128522 | 3300009143 | Vadose Zone Soil | LPVFKYLFFIGLIGAVPVIIVTAVKTAQSMLEED* |
Ga0105241_103582932 | 3300009174 | Corn Rhizosphere | VNFLVQYFLPVFKYLFFAGLIGAIPVIIITAIRTAGSMLEEDEPLRENKG* |
Ga0105241_106084552 | 3300009174 | Corn Rhizosphere | VDFLVEHILPVFKYLFFVGLIGAVPVIVITAIKTAQSMLEEDEPAREKKA* |
Ga0105241_114191842 | 3300009174 | Corn Rhizosphere | MSRVNFLVHYILPVFKYLFFVGLIGAVPVIIVTAVKTAQSMLEE |
Ga0105858_12063242 | 3300009661 | Permafrost Soil | VNFLVHHILPIFQYVFLAGLLGAVPVIIITAIKTAQSMLEDE* |
Ga0126380_102503772 | 3300010043 | Tropical Forest Soil | MTIVNFVVHHFLPFFQYLFFAGLIGAVPVIIITAIKTAQSMLEED* |
Ga0126380_105331492 | 3300010043 | Tropical Forest Soil | VNFVVHYFFPLVQYLFFVGLIGAVPVIVITAIKTAKSMLEED* |
Ga0126380_119556021 | 3300010043 | Tropical Forest Soil | VNFVVHYVLPVFKYLFFVGLIGAVPVIIITAIKTAKSMLEQD* |
Ga0126384_110761532 | 3300010046 | Tropical Forest Soil | MAIVNFVVHYFLPFFQYLFFAGLIGAVPVIVVTAIKTAQSMLEED* |
Ga0126384_111913622 | 3300010046 | Tropical Forest Soil | MTIVNFVVHYFFPLVQYLFFVGLIGAVPVIVITAIKTAKSMLEED* |
Ga0126373_115880252 | 3300010048 | Tropical Forest Soil | MTIVNFVLHHFLLLFQYLFFAGLIGAVPVIIVTAIKTAQSMLEHD* |
Ga0126373_124930312 | 3300010048 | Tropical Forest Soil | VNFLAHYILPVFQYLFIAGLIGAVPVIIITAIKTAQSMLEED* |
Ga0127503_107117002 | 3300010154 | Soil | ILPVFQYLFLAGLIGAVPVIIITAIKTAQSMLEED* |
Ga0099796_101223602 | 3300010159 | Vadose Zone Soil | VNFLVHHILPLFQYLFLAGLIGAVPVIIITAIKTAQSMLEED* |
Ga0126370_108765142 | 3300010358 | Tropical Forest Soil | MPRVNFLVHYFLPVFKYLFIAGLIGAVPVIIITAIKTAQSMLEED* |
Ga0126376_116959751 | 3300010359 | Tropical Forest Soil | MRFVVHILPMFTYVFVAGLIGSVPVIIITAIETARSMLEED* |
Ga0126376_130847611 | 3300010359 | Tropical Forest Soil | RTTIAIVNFVVHYFLPAFKYLFFAGLIGAVPVIIITAIKTAQSMLEPD* |
Ga0126372_105303172 | 3300010360 | Tropical Forest Soil | VNFVVHYLLPVFKYLFFVGLIGAVPVIIITAIKTAKSMLEQD* |
Ga0126378_1000001840 | 3300010361 | Tropical Forest Soil | MTIVNFVVHHVLPLFQYLFFAGLLGAVPVIVVTAIKTAESMLEED* |
Ga0126378_112617712 | 3300010361 | Tropical Forest Soil | MTIVNFVVHYFLPFFQYLFFAGLIGAVPVIIVTAVKTAQSMLEED* |
Ga0126378_122281092 | 3300010361 | Tropical Forest Soil | LAHYILPVFQYLFIAGLIGAVPVIIITAIKTAQSMLEED* |
Ga0126377_117008781 | 3300010362 | Tropical Forest Soil | MTIVNFVVHYILPLFQYLFFAGLIGAIPVIIITAIK |
Ga0126377_130964411 | 3300010362 | Tropical Forest Soil | VNFVVHYLLPVFKYLFFIGLIGAVPVIIITAIKTAKSML |
Ga0134125_100148747 | 3300010371 | Terrestrial Soil | VNFLVHYFLPAFKYLFFAGLLGAVPVIIVTAVKTAQSIFEEDEPARDHKA* |
Ga0134125_106030781 | 3300010371 | Terrestrial Soil | LIPLMHRTTMPRVNFLVHYILPVFKYLFFAGLIGAVPVIIVTAVKTAQSMLEED* |
Ga0134128_101025502 | 3300010373 | Terrestrial Soil | VNFLVQYFLPAFKYLFFAGLIGAIPVIIITAIRTAGSMLEEDEPLRENKG* |
Ga0134128_102545241 | 3300010373 | Terrestrial Soil | GSTLIPLRHRTTMPRVSFLVHYILPVFKYLFFIGLIGAVPVIIVTAVKTAQSMLEED* |
Ga0105239_102252792 | 3300010375 | Corn Rhizosphere | MFRVSFLVHYILPVFKYLFFAGLIGAVPVIIVTAVKTAQSMLEED* |
Ga0105239_103170032 | 3300010375 | Corn Rhizosphere | VNFVVNHILPIFKYLFFVGMLGAVPVIIVTAIKTAQSIFETDESARDHKA* |
Ga0105239_110269412 | 3300010375 | Corn Rhizosphere | MLRVSFLVHYILPFFKYLFFIGLIGAVPVIIVTAVKTAQSMLEED* |
Ga0134126_117136881 | 3300010396 | Terrestrial Soil | LFFAGLIGAVPVIIITAIKTAQSMLEEDDGARDHTAQ* |
Ga0134121_115439461 | 3300010401 | Terrestrial Soil | MPRVNFLVHYILPVFKYLFFAGLIGAVPVIIVTAVKTAQS |
Ga0137391_115168382 | 3300011270 | Vadose Zone Soil | VNFVVHYILPVFKYLFIAGLAGSVPVIIITAVRTAQSMVEED* |
Ga0126317_109287962 | 3300011332 | Soil | YILPIFQYLFFAGLIGAVPVIIVTAVKTAQSMLEED* |
Ga0137389_113920342 | 3300012096 | Vadose Zone Soil | MTQPLIPLNRRNTMAVVNFVVQHILPVFKYLFIAGLIGAVPVIIVTAIKTAHSMVEKD* |
Ga0137389_118332811 | 3300012096 | Vadose Zone Soil | MAIVNFVVQYFLPVFKYIFIAGLIGAVPVIIVTAIKTAHSMVEKD* |
Ga0137388_109587662 | 3300012189 | Vadose Zone Soil | MSVVNFVVQHILPVFEYLFLAGLVGAVPVIIVTAVKTAQSMVEKD* |
Ga0137388_114581631 | 3300012189 | Vadose Zone Soil | MAIVNFVVQYFLPVFKYLFIAGLIGAVPVIIVTAIKTAHSMVEKD* |
Ga0137363_100231282 | 3300012202 | Vadose Zone Soil | MTIVNFVVHYILPVFKYLFIAGLAGSVPVIIITAIRTAQSMVEED* |
Ga0137381_116879472 | 3300012207 | Vadose Zone Soil | MSVVNFVVQYILPVFKYLFIAGLIGAIPVIVVTAVKTAHSMVEKD* |
Ga0137378_103766961 | 3300012210 | Vadose Zone Soil | MAVVNFVVQYIVPIFKYLFIAGLIGAIPVIIVTAVKTAQSMAEKD* |
Ga0150985_1182557592 | 3300012212 | Avena Fatua Rhizosphere | SSDLYILPVFKYLFFAGLIGAVPVIIVTAVKTAQSMLEED* |
Ga0137384_1000007244 | 3300012357 | Vadose Zone Soil | MAIVNFVVQYFLPVFKYLFFAGLIGAVPVIIVTAVKTAHSMVEKD* |
Ga0137384_114010542 | 3300012357 | Vadose Zone Soil | MAVVNFVVQYILPIFKYLFIAGLIGAIPVIIVTAVKTAQSMAEKD* |
Ga0150984_1083043772 | 3300012469 | Avena Fatua Rhizosphere | HYFLPVFKYLFFIGLIGAVPVIIVTAVKTAQSMLEED* |
Ga0150984_1228202051 | 3300012469 | Avena Fatua Rhizosphere | ILPVFKYLFFAGLIGAVPVIIVTAVKTAQSMLEED* |
Ga0137398_103085421 | 3300012683 | Vadose Zone Soil | THRITMPTVNFLVHHILPLFQYLFFAGLIGAVPVIIVTAIKTAQSMLEED* |
Ga0137398_103418911 | 3300012683 | Vadose Zone Soil | MSVVNFVVQYFLPVFKYLFIAGLIGAVPVIIVTAVKTAHSMVEKD* |
Ga0137397_103778822 | 3300012685 | Vadose Zone Soil | MPRVNFLVHYILPVFKYLFFIGLIGAVPVIIVTAVKTAQSMLEED* |
Ga0137395_100352912 | 3300012917 | Vadose Zone Soil | MLRVNFLVHHILPLFQYLFIAGLIGAVPVIIITAIKTAQSMLEED* |
Ga0137413_105891561 | 3300012924 | Vadose Zone Soil | THRTTIQVVNFLVHHILPLFQYLFLAGLIGAVPVIIITAIKTAQSMLEED* |
Ga0137404_100241221 | 3300012929 | Vadose Zone Soil | RITMPTVNFLVHHILPLFQYLFLAGLIGAVPVIIVTAIKTAQSMLEED* |
Ga0137404_101443462 | 3300012929 | Vadose Zone Soil | MSVVNFVVQYILPVFKYLFIAGLIGAIPVIIVTAVKTAHSMVEKD* |
Ga0137404_119566882 | 3300012929 | Vadose Zone Soil | MPTVNFLVHHILPLFQYLFLAGLIGAVPVIIVTAIKT |
Ga0153915_101246311 | 3300012931 | Freshwater Wetlands | MTLVHFVVHYFLPVFKYLFLAGLIGAIPVIIVTAIRTAQSMFEGDEPVRDHKA* |
Ga0153915_104693692 | 3300012931 | Freshwater Wetlands | MAIVDFVGHYLLPACTYLFLAGLIGAVPVIIVTAIKTAASIFEEDEPARDHRG* |
Ga0137410_120145752 | 3300012944 | Vadose Zone Soil | MPRVNFLVHHILPLFQYLFFAGLIGAVPVIIVTAIKTAQSMLEED* |
Ga0164301_104036362 | 3300012960 | Soil | TTMPTVNFLVHHVLPLFQYLFIAGLIGAVPVIIITAIKTAQSMLEED* |
Ga0164302_109924812 | 3300012961 | Soil | MTIVNFLVHHILPVFQYLFLAGLIGAVPVIIITAIKTAQSMLEED* |
Ga0126369_109422322 | 3300012971 | Tropical Forest Soil | TTMKIVNFVVHYILPVFNYLFIAGLIGAVPVIIITAVKTAQSMLEED* |
Ga0126369_116428172 | 3300012971 | Tropical Forest Soil | FVVHHFLPLFQYLFFAGLLGAVPVIIITAIKTAQSMLEED* |
Ga0126369_122795442 | 3300012971 | Tropical Forest Soil | MTIVNFLVHHILPLFQYLFLAGLIGAVPVIIITAV |
Ga0126369_130590191 | 3300012971 | Tropical Forest Soil | LEIVNFVVHYLLPVIKYLFFAGMIGAVPVIVITAVMTAKSMLEQDQ* |
Ga0164308_122009832 | 3300012985 | Soil | MPRVSFLVHYILPVFKYLFFIGLIGAVPVIIVTAVKTAQSMLE |
Ga0164307_108025382 | 3300012987 | Soil | MPRVNFLVHYILPVFKYLFFAGLIGAVPVIIVTAVKT |
Ga0164305_107951172 | 3300012989 | Soil | MTIVNFLVHHILPIFQYLFLAGLIGAVPVIIITAVKTAQSMLEED* |
Ga0164305_114276651 | 3300012989 | Soil | THRTTMPRVSFLVHYILPVFKYLFFIGLIGAVPVIIVTAVKTAQSMLEED* |
Ga0157374_112600451 | 3300013296 | Miscanthus Rhizosphere | MLRVNFLVHYILPVFKYLFFAGLIGAVPVIIVTAVKTAQSMLEED* |
Ga0157372_114614392 | 3300013307 | Corn Rhizosphere | MPRVNFLVHYILPVFKYLFFAGLIGAVPVIIVTAIKTAQSMLEED* |
Ga0157376_116025522 | 3300014969 | Miscanthus Rhizosphere | VNFVVQYFLPVFKYLFIAGLIGAVPVIIVTAIKTAHSMVEKD* |
Ga0167643_10197402 | 3300015089 | Glacier Forefield Soil | VNFLVHHVLPIFQYLFLVGLVGAVPVIIITAIKTAQSMLEDD* |
Ga0137409_101107112 | 3300015245 | Vadose Zone Soil | MTIVNFVVQHILPAFVYLFFAGLIGAVPVIIVTAIKTAHSMVEKD* |
Ga0137409_113822972 | 3300015245 | Vadose Zone Soil | MPTVNFLVHHILPLFQYLFFAGLIGAVPVIIVTAIKT |
Ga0187821_103022081 | 3300017936 | Freshwater Sediment | LEIVNFLVHYVLPVFKYLFFAGMIGAVPVVVITAIMTAKSMLEQDQ |
Ga0066655_104987031 | 3300018431 | Grasslands Soil | MLRVSFLVHYILPVFKYLFFAGLIGAVPVIIVTAIKTAQSMLEED |
Ga0066667_104298762 | 3300018433 | Grasslands Soil | VNFVVRYFLPVFQYLFIAGLIGAIPVIIITAIRTAESMLEEDQNGQAGHGS |
Ga0066662_102000672 | 3300018468 | Grasslands Soil | VNFLVHHVLPVFKYLFFTGLIGAVPVIIITAIKTAKSILEED |
Ga0066662_102124302 | 3300018468 | Grasslands Soil | MSIVNFVVRYFLPIFQYLFLIGLAGAIPVIIITAIKTAESMLEEDHDGQSGHGS |
Ga0066662_103515762 | 3300018468 | Grasslands Soil | MLRVSFLVHYILPVFKYLFFAGLIGAVPVIIVTAVKTAQSMLEED |
Ga0066662_104143852 | 3300018468 | Grasslands Soil | MWVVNFIVRHVLPIFQYLFMAGLIGAIPVIIITAIRTAASMLEEDHDGQPGHNG |
Ga0066662_129540062 | 3300018468 | Grasslands Soil | VNFLVHHILPLFQYLFIAGLIGAVPVIIITAIKTAQSMLEED |
Ga0137408_11414052 | 3300019789 | Vadose Zone Soil | MPTVNFLVHHILPLFQYLFLAGLIGAVPVIIVTAIKTAQSMLEED |
Ga0137408_12526692 | 3300019789 | Vadose Zone Soil | MSVVNFVVQYILPVFKYLFIAGLIGAIPVIIVTAVKTAHSMVEKD |
Ga0197907_108843241 | 3300020069 | Corn, Switchgrass And Miscanthus Rhizosphere | VNFLVQHFLPVFKYLFFAGLIGAIPVIIITAIRTAGSMLEEDEPLRENKG |
Ga0206349_10735172 | 3300020075 | Corn, Switchgrass And Miscanthus Rhizosphere | VVHYILPVFKYLFFAGMIGAVPVIIITAIKTAQSMFEQDEPAPDHKA |
Ga0206355_11584532 | 3300020076 | Corn, Switchgrass And Miscanthus Rhizosphere | VVNHILPIFKYLFIVGMLGAVPVIIVTAIKTAQSMFETDESARDHKA |
Ga0206352_105384581 | 3300020078 | Corn, Switchgrass And Miscanthus Rhizosphere | HILPIFKYLFIVGMLGAVPVIIVTAIKTAQSMFETDESARDHKA |
Ga0179590_12166642 | 3300020140 | Vadose Zone Soil | MPTVNFLVHHILPLFQYLFFAGLIGAVPVIIVTAIKTAQSMLEED |
Ga0154015_15177402 | 3300020610 | Corn, Switchgrass And Miscanthus Rhizosphere | VNFVVNHILPIFKYLFIVGMLGAVPVIIVTAIKTAQSMFETDESARDHKA |
Ga0210396_101898282 | 3300021180 | Soil | MTIVNFLVHHVLMLFEYTFLAGLIGAVPVIIITAIKTAQSMLEDE |
Ga0210397_101723042 | 3300021403 | Soil | MEIVNFLVHHILPLFEYSFLAGLIGAVPVIIITAIKTAQSMLEED |
Ga0210397_103566672 | 3300021403 | Soil | VSFLVHHILPVFEYTFLAGLIGAVPVIIITAIKTAQSMLEED |
Ga0210389_100134063 | 3300021404 | Soil | VNFLVHHILPLFEYTFLAGLIGAVPVIIVTAIKTTQSMFEHE |
Ga0126371_104411682 | 3300021560 | Tropical Forest Soil | MPRVNFLAHYILPVFQYVFIAGLIGAVPVIIITAIKTAQSMLEED |
Ga0126371_107047232 | 3300021560 | Tropical Forest Soil | MPRVNFLVHYFLPVFKYLFFAGLIGAVPVIIVTAVKTAQSMLEED |
Ga0126371_107758212 | 3300021560 | Tropical Forest Soil | MTIVNFVVHHVLPLFQYLFFAGLLGAVPVIVVTAIKTAESMLEED |
Ga0126371_116508912 | 3300021560 | Tropical Forest Soil | MAIVNFVVHYFLPFFQYLFFAGLIGAVPVIIVTAIKTAHSMLEED |
Ga0126371_119207241 | 3300021560 | Tropical Forest Soil | MTIVNFVLHHFLLLFQYLFFAGLIGAVPVIIVTAIKTAQSMLEHD |
Ga0126371_121477272 | 3300021560 | Tropical Forest Soil | MTIVNFVVHHFLPLFQYLFFAGLLGAVPVIIITAIKTAQSMLEED |
Ga0224712_102918851 | 3300022467 | Corn, Switchgrass And Miscanthus Rhizosphere | YILPVFKYLFFVGLIGAVPVIIVTAVKTAQSMLEED |
Ga0224712_104334202 | 3300022467 | Corn, Switchgrass And Miscanthus Rhizosphere | GKVVNFVVNHILPIFKYLFIVGMLGAVPVIIVTAIKTAQSMFETDESARDHKA |
Ga0208078_10068482 | 3300025544 | Arctic Peat Soil | VNFLVHHILPLFQYLFIAGMIGAVPVIIVTAIKTAQSMLEED |
Ga0207685_101283322 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | MPRVNFLVHHILPLFQYLFIAGLIGAVPVIIVTAIKTAQSMLE |
Ga0207685_104245871 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | VNFVVHYFLPAFKYLFFAGLIGAVPVIIITAIKTAQSML |
Ga0207699_101052572 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MHRTTMPRVNFLVHYILPVFKYLFFAGLIGAVPVIIVTAVKTAQSMLEED |
Ga0207707_100143932 | 3300025912 | Corn Rhizosphere | VNFVVHYILPVFKYLFFAGMIGAVPVIIITAIKTAQSMFEQDEPAPDHKA |
Ga0207707_101642512 | 3300025912 | Corn Rhizosphere | VDFLVEHILPVFKYLFFVGLIGAVPVIVITAIKTAQSMLEEDEPARENKA |
Ga0207707_105407181 | 3300025912 | Corn Rhizosphere | MPRVNFLVHYILPVFKYLFFVGLIGAVPVIIVTAVKTAQSMLEED |
Ga0207695_105087092 | 3300025913 | Corn Rhizosphere | YLFFAGMIGAIPVIIITAIRTAGSMLEEDEPLRENKG |
Ga0207660_109758472 | 3300025917 | Corn Rhizosphere | VNFLVQYFLPVFKYLFFAGLIGAIPVIIITAIRTAGSMLEEDEPLRENKG |
Ga0207652_109414492 | 3300025921 | Corn Rhizosphere | MPTVSFLVHYILPVFKYLFFIGLIGAVPVIIVTAVKTAQSMLEED |
Ga0207700_100375183 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MHRVSFLVHYILPVFKYLFFAGLIGAVPVIIVTAVKTAQSMLEED |
Ga0207664_110684942 | 3300025929 | Agricultural Soil | IPPTHRTTMPRVSFLVHYILPVFKYLFFAGLIGAVPVIIVTAVKTAQSMLEED |
Ga0207664_116024922 | 3300025929 | Agricultural Soil | KYLFFAGMIGAIPVIIVTAIRTAGSMLEKDEPVRENKG |
Ga0209240_11091011 | 3300026304 | Grasslands Soil | MTIVNFVVHYVLPFFKYLFFAGLIGAVPVIIITAIKTAQSMLEED |
Ga0209648_100302002 | 3300026551 | Grasslands Soil | MTIVYFVVHYVLPVFKYTFFVGLIGSVPVIVITAIETARSMLEED |
Ga0209577_101103491 | 3300026552 | Soil | MCAVNFVVRHILPLFQYLFLAGLIGAIPVIIVTAIRTAESMFEEDHDGQTGRRS |
Ga0179587_105697771 | 3300026557 | Vadose Zone Soil | VNFLVHHILPLFQYLFLAGLIGAVPVIIITAIKTAQSMLEED |
Ga0209005_10097392 | 3300027037 | Forest Soil | LIPLWYRTTIALVNFLVHHILKLFEYTFLAGLIGAIPVIIVTAIKTAQSMLEED |
Ga0209732_10669162 | 3300027117 | Forest Soil | VNFLVHHILPFFEYSFLVGLIGAVPVIIVTAIKTTQSMFEEE |
Ga0209524_11359851 | 3300027521 | Forest Soil | MPAVNFLVHHVLPLFQYLFLAGLIGAVPVIIVTAIKTAQSMLEED |
Ga0208982_10315453 | 3300027574 | Forest Soil | VNFLVHHILPLFEYTFLAGLIGAVPVIIVTAIKTTKSMFENE |
Ga0209733_10697262 | 3300027591 | Forest Soil | VNFLVHHVLPIFQYLFLAGLVGAVPVIIITAIKTAQSMLEDD |
Ga0209073_100891412 | 3300027765 | Agricultural Soil | MPRVNFLVHYILPVFQYLFIAGLIGAVPVIIVTAIKTAQSMLEED |
Ga0209810_11280142 | 3300027773 | Surface Soil | MSYVNFVVRHVLPIFQYLFIAGLIGAVPVIIITAVKTAQSMLEED |
Ga0209177_100056512 | 3300027775 | Agricultural Soil | VNFLVHHVLPIFEYLFLAGLIGAVPVIVITAIKTAQSMLEED |
Ga0209580_100379082 | 3300027842 | Surface Soil | MQRVNFLVHYILPVFKYLFFAGLIGAVPVIIVTAVKTAQSMLEED |
Ga0209180_101396621 | 3300027846 | Vadose Zone Soil | VNFLVHYFLPVFKYLFFAGLIGAIPVIIVTAIRTAESMLEEDEPVRENKG |
Ga0209166_100360242 | 3300027857 | Surface Soil | LEIVNFLVHHILPVFKYLFFAGLIGAIPVIIITAIKTAQSMLEQD |
Ga0209166_104547471 | 3300027857 | Surface Soil | IPPTHRTTMPRVSFLVHYILPVFKYLFFAGLIGAVPVIIVTAIKTAQSMLEED |
Ga0209068_104193452 | 3300027894 | Watersheds | STLIPLRHRTTMPRMNFLAHYILPVFQYLFIAGLIGAVPVIIITAIKTAQSMLEED |
Ga0209488_102642692 | 3300027903 | Vadose Zone Soil | MPTVNFLVHHILPLFQYLFLAGLIGAVPVIIITAIKTAQSMLEED |
Ga0265338_101224642 | 3300028800 | Rhizosphere | VNFLVRYFLPAFKYLFFAGLIGAIPVIIITAIRTAGSMVENDEPARDNKG |
Ga0265338_103520122 | 3300028800 | Rhizosphere | VNFLVHHILPLFEYTFLAGLIGAVPVIIVTAIKTTKSMFEHE |
Ga0170824_1191269362 | 3300031231 | Forest Soil | MTRVNFLVHYILPVFKYLFFVGLIGAVPVIIVTAVKTAQSMLEED |
Ga0170824_1258235132 | 3300031231 | Forest Soil | LWYRTTIAIVSFLVHHILPVFEYTFLAGLIGAVPVIIITAIKTAQSMLEED |
Ga0310813_104382941 | 3300031716 | Soil | MPRVNFLVHHILPHFQYLFIAGLIGAVPVIIITAIKTAQSMLEED |
Ga0307469_104421282 | 3300031720 | Hardwood Forest Soil | VNFVVHYFLPAFKYLFFAGLIGAIPVIIITAIKTAQSMLEQD |
Ga0307470_118666422 | 3300032174 | Hardwood Forest Soil | MHRTTMQRVNFLAHHILPLFQYLFIAGLIGAVPVIIITAIKTAQSMLEED |
Ga0307471_1008975222 | 3300032180 | Hardwood Forest Soil | MTRVNFLVHYVLPAFMYLFFAGLIGAVPVILITAVKTAQSMLEDE |
Ga0310810_106048061 | 3300033412 | Soil | MPRVNFLVHYILPVFKYLFFIGLIGAVPVIIVTAVKTAQSMLEED |
Ga0310811_111202311 | 3300033475 | Soil | ILPVFKYLFFIGLIGAVPVIIVTAVKTAQSMLEED |
Ga0316620_107034432 | 3300033480 | Soil | MAIVDFVVHYLLPACTYLFLAGLIGAVPVIIVTAIKTAASIFEEDEPARDHRG |
Ga0316620_108815341 | 3300033480 | Soil | MTIVNFVVHYLLPVCTYLFLAGLIGAIPVIIITAIKTGASIFEEDEPARDHQV |
Ga0316628_1000237553 | 3300033513 | Soil | MAIVDFVGHYLLPACTYLFLAGLIGAVPVIIVTAIKTAASIFEEDEPARDHRG |
⦗Top⦘ |