Basic Information | |
---|---|
Family ID | F015940 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 251 |
Average Sequence Length | 43 residues |
Representative Sequence | HDVVHFALEEVQKELDEGHEDIVVNRLRAHLEANQKKKAPKT |
Number of Associated Samples | 174 |
Number of Associated Scaffolds | 251 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 0.00 % |
% of genes near scaffold ends (potentially truncated) | 98.80 % |
% of genes from short scaffolds (< 2000 bps) | 90.84 % |
Associated GOLD sequencing projects | 157 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.47 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (53.785 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (30.677 % of family members) |
Environment Ontology (ENVO) | Unclassified (29.880 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (53.386 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 40.00% β-sheet: 0.00% Coil/Unstructured: 60.00% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.47 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 251 Family Scaffolds |
---|---|---|
PF01741 | MscL | 76.89 |
PF00160 | Pro_isomerase | 4.78 |
PF07992 | Pyr_redox_2 | 1.59 |
PF13487 | HD_5 | 0.80 |
PF12867 | DinB_2 | 0.80 |
PF10571 | UPF0547 | 0.80 |
PF00364 | Biotin_lipoyl | 0.40 |
PF00076 | RRM_1 | 0.40 |
PF02371 | Transposase_20 | 0.40 |
PF01979 | Amidohydro_1 | 0.40 |
PF02452 | PemK_toxin | 0.40 |
PF13483 | Lactamase_B_3 | 0.40 |
PF04237 | YjbR | 0.40 |
PF02441 | Flavoprotein | 0.40 |
COG ID | Name | Functional Category | % Frequency in 251 Family Scaffolds |
---|---|---|---|
COG1970 | Large-conductance mechanosensitive channel | Cell wall/membrane/envelope biogenesis [M] | 76.89 |
COG0652 | Peptidyl-prolyl cis-trans isomerase (rotamase) - cyclophilin family | Posttranslational modification, protein turnover, chaperones [O] | 4.78 |
COG2315 | Predicted DNA-binding protein with ‘double-wing’ structural motif, MmcQ/YjbR family | Transcription [K] | 0.40 |
COG2337 | mRNA-degrading endonuclease MazF, toxin component of the MazEF toxin-antitoxin module | Defense mechanisms [V] | 0.40 |
COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.40 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 54.18 % |
Unclassified | root | N/A | 45.82 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300001471|JGI12712J15308_10210927 | Not Available | 512 | Open in IMG/M |
3300001527|A3513AW1_1293150 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia → Daphnia pulex | 562 | Open in IMG/M |
3300002245|JGIcombinedJ26739_100368901 | Not Available | 1316 | Open in IMG/M |
3300002245|JGIcombinedJ26739_101606936 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 547 | Open in IMG/M |
3300002908|JGI25382J43887_10026618 | All Organisms → cellular organisms → Bacteria | 3111 | Open in IMG/M |
3300002914|JGI25617J43924_10103023 | All Organisms → cellular organisms → Bacteria | 1019 | Open in IMG/M |
3300004080|Ga0062385_11066144 | Not Available | 546 | Open in IMG/M |
3300004082|Ga0062384_100970020 | Not Available | 606 | Open in IMG/M |
3300004082|Ga0062384_101087620 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 576 | Open in IMG/M |
3300004091|Ga0062387_101032470 | Not Available | 632 | Open in IMG/M |
3300005174|Ga0066680_10423247 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 844 | Open in IMG/M |
3300005174|Ga0066680_10635536 | Not Available | 664 | Open in IMG/M |
3300005174|Ga0066680_10838629 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 550 | Open in IMG/M |
3300005332|Ga0066388_102014224 | Not Available | 1035 | Open in IMG/M |
3300005332|Ga0066388_102428306 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 951 | Open in IMG/M |
3300005445|Ga0070708_101472894 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 634 | Open in IMG/M |
3300005451|Ga0066681_10226986 | All Organisms → cellular organisms → Bacteria | 1125 | Open in IMG/M |
3300005536|Ga0070697_101326285 | Not Available | 642 | Open in IMG/M |
3300005537|Ga0070730_11023301 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 514 | Open in IMG/M |
3300005541|Ga0070733_10387868 | All Organisms → cellular organisms → Bacteria | 929 | Open in IMG/M |
3300005541|Ga0070733_10637093 | Not Available | 715 | Open in IMG/M |
3300005553|Ga0066695_10545398 | All Organisms → cellular organisms → Bacteria | 706 | Open in IMG/M |
3300005555|Ga0066692_10764802 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
3300005602|Ga0070762_10877365 | All Organisms → cellular organisms → Bacteria | 611 | Open in IMG/M |
3300006163|Ga0070715_10268175 | Not Available | 900 | Open in IMG/M |
3300006163|Ga0070715_10847552 | Not Available | 558 | Open in IMG/M |
3300006174|Ga0075014_100201228 | Not Available | 1004 | Open in IMG/M |
3300006176|Ga0070765_101682115 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 596 | Open in IMG/M |
3300006237|Ga0097621_101833453 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
3300006358|Ga0068871_102312322 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 512 | Open in IMG/M |
3300006881|Ga0068865_100549800 | Not Available | 969 | Open in IMG/M |
3300006904|Ga0075424_101142548 | Not Available | 830 | Open in IMG/M |
3300006914|Ga0075436_101126970 | Not Available | 591 | Open in IMG/M |
3300007255|Ga0099791_10192690 | Not Available | 959 | Open in IMG/M |
3300007258|Ga0099793_10172721 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1030 | Open in IMG/M |
3300007258|Ga0099793_10188797 | Not Available | 986 | Open in IMG/M |
3300007265|Ga0099794_10003097 | All Organisms → cellular organisms → Bacteria | 6290 | Open in IMG/M |
3300007788|Ga0099795_10581844 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 531 | Open in IMG/M |
3300009012|Ga0066710_104311900 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 531 | Open in IMG/M |
3300009088|Ga0099830_10201883 | Not Available | 1556 | Open in IMG/M |
3300009088|Ga0099830_10291575 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1300 | Open in IMG/M |
3300009089|Ga0099828_10496647 | All Organisms → cellular organisms → Bacteria | 1100 | Open in IMG/M |
3300009089|Ga0099828_11645212 | Not Available | 565 | Open in IMG/M |
3300009137|Ga0066709_101534962 | All Organisms → cellular organisms → Bacteria | 958 | Open in IMG/M |
3300009143|Ga0099792_10986513 | Not Available | 562 | Open in IMG/M |
3300009644|Ga0116121_1136355 | Not Available | 774 | Open in IMG/M |
3300010043|Ga0126380_11466206 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 603 | Open in IMG/M |
3300010046|Ga0126384_10378083 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1189 | Open in IMG/M |
3300010159|Ga0099796_10100074 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1089 | Open in IMG/M |
3300010304|Ga0134088_10129214 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1197 | Open in IMG/M |
3300010325|Ga0134064_10214463 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 697 | Open in IMG/M |
3300010343|Ga0074044_10390149 | Not Available | 912 | Open in IMG/M |
3300010358|Ga0126370_11072880 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 740 | Open in IMG/M |
3300010358|Ga0126370_12586559 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 507 | Open in IMG/M |
3300010358|Ga0126370_12622167 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 504 | Open in IMG/M |
3300010359|Ga0126376_12360044 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 578 | Open in IMG/M |
3300010361|Ga0126378_11167918 | Not Available | 869 | Open in IMG/M |
3300010366|Ga0126379_10295122 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1623 | Open in IMG/M |
3300010366|Ga0126379_12836383 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 580 | Open in IMG/M |
3300010376|Ga0126381_103358743 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 631 | Open in IMG/M |
3300010379|Ga0136449_100150889 | All Organisms → cellular organisms → Bacteria | 4560 | Open in IMG/M |
3300010398|Ga0126383_12121637 | Not Available | 649 | Open in IMG/M |
3300010865|Ga0126346_1427067 | All Organisms → cellular organisms → Bacteria | 704 | Open in IMG/M |
3300011120|Ga0150983_10242094 | Not Available | 758 | Open in IMG/M |
3300011120|Ga0150983_11223966 | Not Available | 1471 | Open in IMG/M |
3300011120|Ga0150983_13343627 | Not Available | 655 | Open in IMG/M |
3300011269|Ga0137392_10123189 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2070 | Open in IMG/M |
3300011269|Ga0137392_10399118 | Not Available | 1141 | Open in IMG/M |
3300011269|Ga0137392_10768710 | Not Available | 796 | Open in IMG/M |
3300011269|Ga0137392_10860674 | Not Available | 747 | Open in IMG/M |
3300011270|Ga0137391_10151159 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2022 | Open in IMG/M |
3300011270|Ga0137391_10662174 | Not Available | 870 | Open in IMG/M |
3300011271|Ga0137393_10363171 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1238 | Open in IMG/M |
3300011271|Ga0137393_10703763 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 865 | Open in IMG/M |
3300011271|Ga0137393_10804108 | Not Available | 804 | Open in IMG/M |
3300012096|Ga0137389_10430737 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1128 | Open in IMG/M |
3300012189|Ga0137388_10431840 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1221 | Open in IMG/M |
3300012189|Ga0137388_10568394 | Not Available | 1054 | Open in IMG/M |
3300012189|Ga0137388_10775058 | Not Available | 889 | Open in IMG/M |
3300012189|Ga0137388_10778779 | Not Available | 887 | Open in IMG/M |
3300012189|Ga0137388_10844847 | Not Available | 848 | Open in IMG/M |
3300012189|Ga0137388_11830914 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 538 | Open in IMG/M |
3300012189|Ga0137388_11928928 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 520 | Open in IMG/M |
3300012199|Ga0137383_10634049 | Not Available | 781 | Open in IMG/M |
3300012201|Ga0137365_10493548 | Not Available | 900 | Open in IMG/M |
3300012202|Ga0137363_10108468 | All Organisms → cellular organisms → Bacteria | 2123 | Open in IMG/M |
3300012202|Ga0137363_10389242 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1160 | Open in IMG/M |
3300012203|Ga0137399_10181138 | Not Available | 1701 | Open in IMG/M |
3300012203|Ga0137399_10445835 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1083 | Open in IMG/M |
3300012203|Ga0137399_10741543 | Not Available | 827 | Open in IMG/M |
3300012203|Ga0137399_10863289 | Not Available | 762 | Open in IMG/M |
3300012203|Ga0137399_10977044 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 713 | Open in IMG/M |
3300012205|Ga0137362_10063488 | All Organisms → cellular organisms → Bacteria | 3042 | Open in IMG/M |
3300012205|Ga0137362_10149052 | All Organisms → cellular organisms → Bacteria | 1999 | Open in IMG/M |
3300012205|Ga0137362_10351018 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1277 | Open in IMG/M |
3300012205|Ga0137362_10924465 | Not Available | 744 | Open in IMG/M |
3300012205|Ga0137362_11089735 | Not Available | 679 | Open in IMG/M |
3300012207|Ga0137381_10438236 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1140 | Open in IMG/M |
3300012207|Ga0137381_10784581 | Not Available | 826 | Open in IMG/M |
3300012210|Ga0137378_10419360 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1241 | Open in IMG/M |
3300012210|Ga0137378_10545104 | Not Available | 1068 | Open in IMG/M |
3300012212|Ga0150985_107849812 | Not Available | 716 | Open in IMG/M |
3300012359|Ga0137385_10499345 | Not Available | 1030 | Open in IMG/M |
3300012361|Ga0137360_10044912 | All Organisms → cellular organisms → Bacteria | 3153 | Open in IMG/M |
3300012361|Ga0137360_11200875 | Not Available | 656 | Open in IMG/M |
3300012362|Ga0137361_10665896 | Not Available | 952 | Open in IMG/M |
3300012362|Ga0137361_11530846 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 589 | Open in IMG/M |
3300012685|Ga0137397_11291459 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 520 | Open in IMG/M |
3300012918|Ga0137396_10688299 | Not Available | 754 | Open in IMG/M |
3300012918|Ga0137396_10909990 | Not Available | 644 | Open in IMG/M |
3300012918|Ga0137396_11316456 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 501 | Open in IMG/M |
3300012922|Ga0137394_10605241 | Not Available | 927 | Open in IMG/M |
3300012922|Ga0137394_10952171 | All Organisms → cellular organisms → Bacteria | 715 | Open in IMG/M |
3300012922|Ga0137394_11629051 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 502 | Open in IMG/M |
3300012925|Ga0137419_10787254 | Not Available | 777 | Open in IMG/M |
3300012925|Ga0137419_11397408 | Not Available | 591 | Open in IMG/M |
3300012925|Ga0137419_11496232 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 572 | Open in IMG/M |
3300012927|Ga0137416_10660176 | Not Available | 916 | Open in IMG/M |
3300012930|Ga0137407_10691636 | Not Available | 960 | Open in IMG/M |
3300012944|Ga0137410_11504404 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 587 | Open in IMG/M |
3300014169|Ga0181531_10864914 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 565 | Open in IMG/M |
3300015241|Ga0137418_10802858 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 705 | Open in IMG/M |
3300015245|Ga0137409_11038690 | Not Available | 657 | Open in IMG/M |
3300015264|Ga0137403_10537720 | Not Available | 1037 | Open in IMG/M |
3300016294|Ga0182041_10943353 | Not Available | 778 | Open in IMG/M |
3300016341|Ga0182035_11553085 | Not Available | 596 | Open in IMG/M |
3300016404|Ga0182037_10038775 | All Organisms → cellular organisms → Bacteria | 3096 | Open in IMG/M |
3300016404|Ga0182037_10247137 | Not Available | 1410 | Open in IMG/M |
3300016750|Ga0181505_10030781 | Not Available | 1336 | Open in IMG/M |
3300017659|Ga0134083_10011590 | All Organisms → cellular organisms → Bacteria | 2969 | Open in IMG/M |
3300017933|Ga0187801_10281015 | Not Available | 674 | Open in IMG/M |
3300017934|Ga0187803_10022203 | All Organisms → cellular organisms → Bacteria | 2528 | Open in IMG/M |
3300017955|Ga0187817_10881514 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 572 | Open in IMG/M |
3300017959|Ga0187779_10121568 | All Organisms → cellular organisms → Bacteria | 1590 | Open in IMG/M |
3300017961|Ga0187778_10454729 | Not Available | 846 | Open in IMG/M |
3300018057|Ga0187858_10354120 | Not Available | 920 | Open in IMG/M |
3300018086|Ga0187769_10176990 | All Organisms → cellular organisms → Bacteria | 1572 | Open in IMG/M |
3300018086|Ga0187769_10467636 | Not Available | 951 | Open in IMG/M |
3300018088|Ga0187771_11220097 | All Organisms → cellular organisms → Bacteria | 638 | Open in IMG/M |
3300018089|Ga0187774_10606328 | All Organisms → cellular organisms → Bacteria | 709 | Open in IMG/M |
3300018090|Ga0187770_10133195 | All Organisms → cellular organisms → Bacteria | 1883 | Open in IMG/M |
3300018468|Ga0066662_12438054 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 551 | Open in IMG/M |
3300019786|Ga0182025_1344041 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1916 | Open in IMG/M |
3300019890|Ga0193728_1207040 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 819 | Open in IMG/M |
3300020199|Ga0179592_10533104 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 500 | Open in IMG/M |
3300020579|Ga0210407_10168027 | Not Available | 1696 | Open in IMG/M |
3300020579|Ga0210407_10288342 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1281 | Open in IMG/M |
3300020579|Ga0210407_10575729 | Not Available | 878 | Open in IMG/M |
3300020579|Ga0210407_10739195 | Not Available | 761 | Open in IMG/M |
3300020580|Ga0210403_11091201 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 620 | Open in IMG/M |
3300020581|Ga0210399_10109001 | All Organisms → cellular organisms → Bacteria | 2269 | Open in IMG/M |
3300020581|Ga0210399_10128704 | All Organisms → cellular organisms → Bacteria | 2084 | Open in IMG/M |
3300020583|Ga0210401_11493867 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 533 | Open in IMG/M |
3300021086|Ga0179596_10383610 | Not Available | 708 | Open in IMG/M |
3300021088|Ga0210404_10370720 | All Organisms → cellular organisms → Bacteria | 797 | Open in IMG/M |
3300021168|Ga0210406_10721447 | Not Available | 766 | Open in IMG/M |
3300021170|Ga0210400_10158975 | All Organisms → cellular organisms → Bacteria | 1823 | Open in IMG/M |
3300021170|Ga0210400_10560448 | Not Available | 942 | Open in IMG/M |
3300021170|Ga0210400_11478722 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 539 | Open in IMG/M |
3300021171|Ga0210405_10923826 | Not Available | 662 | Open in IMG/M |
3300021171|Ga0210405_11320940 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 529 | Open in IMG/M |
3300021178|Ga0210408_10113107 | All Organisms → cellular organisms → Bacteria | 2137 | Open in IMG/M |
3300021178|Ga0210408_10274928 | Not Available | 1343 | Open in IMG/M |
3300021180|Ga0210396_10949027 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 731 | Open in IMG/M |
3300021180|Ga0210396_11090398 | Not Available | 673 | Open in IMG/M |
3300021180|Ga0210396_11240872 | Not Available | 622 | Open in IMG/M |
3300021181|Ga0210388_11739396 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 515 | Open in IMG/M |
3300021404|Ga0210389_10093971 | All Organisms → cellular organisms → Bacteria | 2306 | Open in IMG/M |
3300021407|Ga0210383_10055908 | All Organisms → cellular organisms → Bacteria | 3290 | Open in IMG/M |
3300021407|Ga0210383_11103741 | Not Available | 670 | Open in IMG/M |
3300021432|Ga0210384_11530309 | Not Available | 572 | Open in IMG/M |
3300021474|Ga0210390_11408135 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 555 | Open in IMG/M |
3300021475|Ga0210392_11508169 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 502 | Open in IMG/M |
3300021478|Ga0210402_10884767 | Not Available | 819 | Open in IMG/M |
3300021478|Ga0210402_10917976 | Not Available | 802 | Open in IMG/M |
3300021479|Ga0210410_10264787 | Not Available | 1542 | Open in IMG/M |
3300021479|Ga0210410_11456524 | Not Available | 578 | Open in IMG/M |
3300021559|Ga0210409_10711839 | Not Available | 875 | Open in IMG/M |
3300021559|Ga0210409_11392394 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 577 | Open in IMG/M |
3300021560|Ga0126371_11344900 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 847 | Open in IMG/M |
3300021560|Ga0126371_11436734 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 820 | Open in IMG/M |
3300021560|Ga0126371_11487441 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 806 | Open in IMG/M |
3300021560|Ga0126371_12296096 | All Organisms → cellular organisms → Bacteria | 652 | Open in IMG/M |
3300021560|Ga0126371_13175593 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 556 | Open in IMG/M |
3300022873|Ga0224550_1030889 | Not Available | 761 | Open in IMG/M |
3300022873|Ga0224550_1038329 | Not Available | 684 | Open in IMG/M |
3300024186|Ga0247688_1025991 | Not Available | 879 | Open in IMG/M |
3300024331|Ga0247668_1123552 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 525 | Open in IMG/M |
3300025906|Ga0207699_10533674 | Not Available | 850 | Open in IMG/M |
3300025938|Ga0207704_10962705 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 720 | Open in IMG/M |
3300026305|Ga0209688_1059672 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 699 | Open in IMG/M |
3300026328|Ga0209802_1281554 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 555 | Open in IMG/M |
3300026334|Ga0209377_1062438 | Not Available | 1627 | Open in IMG/M |
3300026361|Ga0257176_1028797 | Not Available | 831 | Open in IMG/M |
3300026514|Ga0257168_1102849 | Not Available | 636 | Open in IMG/M |
3300026515|Ga0257158_1079715 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 632 | Open in IMG/M |
3300026557|Ga0179587_10966485 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 561 | Open in IMG/M |
3300027174|Ga0207948_1012772 | Not Available | 972 | Open in IMG/M |
3300027381|Ga0208983_1045789 | Not Available | 849 | Open in IMG/M |
3300027545|Ga0209008_1079772 | Not Available | 735 | Open in IMG/M |
3300027565|Ga0209219_1102717 | Not Available | 703 | Open in IMG/M |
3300027591|Ga0209733_1039415 | Not Available | 1264 | Open in IMG/M |
3300027629|Ga0209422_1020944 | All Organisms → cellular organisms → Bacteria | 1625 | Open in IMG/M |
3300027655|Ga0209388_1148198 | Not Available | 664 | Open in IMG/M |
3300027725|Ga0209178_1011132 | All Organisms → cellular organisms → Bacteria | 2812 | Open in IMG/M |
3300027729|Ga0209248_10069607 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1070 | Open in IMG/M |
3300027787|Ga0209074_10500616 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 527 | Open in IMG/M |
3300027795|Ga0209139_10071203 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1219 | Open in IMG/M |
3300027826|Ga0209060_10313224 | Not Available | 716 | Open in IMG/M |
3300027846|Ga0209180_10471659 | Not Available | 705 | Open in IMG/M |
3300027853|Ga0209274_10389935 | Not Available | 719 | Open in IMG/M |
3300027857|Ga0209166_10539752 | Not Available | 597 | Open in IMG/M |
3300027862|Ga0209701_10303362 | Not Available | 916 | Open in IMG/M |
3300027862|Ga0209701_10455982 | Not Available | 702 | Open in IMG/M |
3300027875|Ga0209283_10925067 | Not Available | 525 | Open in IMG/M |
3300027903|Ga0209488_10547629 | Not Available | 844 | Open in IMG/M |
3300027908|Ga0209006_10528738 | Not Available | 981 | Open in IMG/M |
3300028138|Ga0247684_1088644 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 515 | Open in IMG/M |
3300028536|Ga0137415_10483766 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1045 | Open in IMG/M |
3300028795|Ga0302227_10108617 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1137 | Open in IMG/M |
3300028906|Ga0308309_10329453 | Not Available | 1297 | Open in IMG/M |
3300029944|Ga0311352_10075839 | All Organisms → cellular organisms → Bacteria | 2998 | Open in IMG/M |
3300030854|Ga0075385_11737637 | Not Available | 561 | Open in IMG/M |
3300031231|Ga0170824_125649285 | Not Available | 1333 | Open in IMG/M |
3300031545|Ga0318541_10641858 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
3300031708|Ga0310686_101060079 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1086 | Open in IMG/M |
3300031719|Ga0306917_11511317 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 516 | Open in IMG/M |
3300031720|Ga0307469_10348549 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1242 | Open in IMG/M |
3300031744|Ga0306918_10035778 | All Organisms → cellular organisms → Bacteria | 3184 | Open in IMG/M |
3300031754|Ga0307475_10042832 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3363 | Open in IMG/M |
3300031777|Ga0318543_10397409 | All Organisms → cellular organisms → Bacteria | 618 | Open in IMG/M |
3300031823|Ga0307478_11549281 | Not Available | 548 | Open in IMG/M |
3300031879|Ga0306919_10284900 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1250 | Open in IMG/M |
3300031890|Ga0306925_10322471 | All Organisms → cellular organisms → Bacteria | 1660 | Open in IMG/M |
3300031910|Ga0306923_10062508 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4135 | Open in IMG/M |
3300031910|Ga0306923_10270224 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1944 | Open in IMG/M |
3300031910|Ga0306923_10653690 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1175 | Open in IMG/M |
3300031941|Ga0310912_10662230 | All Organisms → cellular organisms → Bacteria | 810 | Open in IMG/M |
3300031947|Ga0310909_11180778 | Not Available | 619 | Open in IMG/M |
3300031962|Ga0307479_10248732 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1755 | Open in IMG/M |
3300031962|Ga0307479_10825914 | Not Available | 901 | Open in IMG/M |
3300031962|Ga0307479_11290348 | Not Available | 691 | Open in IMG/M |
3300031962|Ga0307479_11352612 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 672 | Open in IMG/M |
3300031962|Ga0307479_11697600 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 585 | Open in IMG/M |
3300032160|Ga0311301_12292457 | Not Available | 615 | Open in IMG/M |
3300032180|Ga0307471_100100000 | All Organisms → cellular organisms → Bacteria | 2628 | Open in IMG/M |
3300032180|Ga0307471_100247166 | All Organisms → cellular organisms → Bacteria | 1833 | Open in IMG/M |
3300032180|Ga0307471_100833446 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1089 | Open in IMG/M |
3300033289|Ga0310914_10259923 | Not Available | 1561 | Open in IMG/M |
3300033290|Ga0318519_10213421 | All Organisms → cellular organisms → Bacteria | 1105 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 30.68% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 18.33% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 6.77% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 5.18% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.38% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.38% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.59% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.79% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.39% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.59% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.20% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.20% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.99% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.99% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.99% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.80% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.80% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.80% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.80% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.80% |
Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.80% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.80% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.80% |
Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.80% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.80% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.40% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.40% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.40% |
Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.40% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.40% |
Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.40% |
Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.40% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.40% |
Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.40% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300001471 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 | Environmental | Open in IMG/M |
3300001527 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A3-5cm-13A)- 1 week illumina | Environmental | Open in IMG/M |
3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
3300002908 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
3300002914 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm | Environmental | Open in IMG/M |
3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
3300009644 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_10 | Environmental | Open in IMG/M |
3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300010865 | Boreal forest soil eukaryotic communities from Alaska, USA - C3-3 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300014169 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaG | Environmental | Open in IMG/M |
3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
3300016750 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
3300017934 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3 | Environmental | Open in IMG/M |
3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
3300018057 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150 | Environmental | Open in IMG/M |
3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
3300018089 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MG | Environmental | Open in IMG/M |
3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300019786 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (PacBio error correction) | Environmental | Open in IMG/M |
3300019890 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1 | Environmental | Open in IMG/M |
3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300022873 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P3 10-14 | Environmental | Open in IMG/M |
3300024186 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK29 | Environmental | Open in IMG/M |
3300024331 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK09 | Environmental | Open in IMG/M |
3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026305 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 (SPAdes) | Environmental | Open in IMG/M |
3300026328 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes) | Environmental | Open in IMG/M |
3300026334 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes) | Environmental | Open in IMG/M |
3300026361 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-03-B | Environmental | Open in IMG/M |
3300026514 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-13-B | Environmental | Open in IMG/M |
3300026515 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-03-A | Environmental | Open in IMG/M |
3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
3300027174 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF040 (SPAdes) | Environmental | Open in IMG/M |
3300027381 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027545 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O3 (SPAdes) | Environmental | Open in IMG/M |
3300027565 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027591 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027629 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027655 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes) | Environmental | Open in IMG/M |
3300027725 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes) | Environmental | Open in IMG/M |
3300027729 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM1 (SPAdes) | Environmental | Open in IMG/M |
3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
3300027795 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM3 (SPAdes) | Environmental | Open in IMG/M |
3300027826 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
3300027857 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
3300028138 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK25 | Environmental | Open in IMG/M |
3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300028795 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_1 | Environmental | Open in IMG/M |
3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
3300029944 | II_Palsa_E1 coassembly | Environmental | Open in IMG/M |
3300030854 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OB2 SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI12712J15308_102109272 | 3300001471 | Forest Soil | EEVKKEIEEGQEDAVVKRLRAHLEGNQSKKTPSS* |
A3513AW1_12931501 | 3300001527 | Permafrost | HDVVHFALEEVQKELDDGREDEVVKRLRAHLDANLDKRKPGPKN* |
JGIcombinedJ26739_1003689011 | 3300002245 | Forest Soil | LEEVQKELDDGHEDEVVKRLRAHLDANQNKRKPTPQDKLN* |
JGIcombinedJ26739_1016069361 | 3300002245 | Forest Soil | ESLAREELHHHDVVHFALEEVQKEIEEGHEDQVVNRLRTHLESNQNKRKPKV* |
JGI25382J43887_100266186 | 3300002908 | Grasslands Soil | SVAPLEMHHHDVVHFALEEVQKELDEGHEDIVLNRLRAHLEAIQKKRKQPS* |
JGI25617J43924_101030231 | 3300002914 | Grasslands Soil | LEIHHHDVVHFALEEVKKEMEEGHEDIVVNRLRVHLEANQKKKAPKT* |
Ga0062385_110661441 | 3300004080 | Bog Forest Soil | ALGGSHELHHHDVVHFALEEVKKELEQGREEEVLERLRIHLAANSEKKPPLN* |
Ga0062384_1009700202 | 3300004082 | Bog Forest Soil | VVHFALEEVKKEIDEGKEDEVVKRLRAHLEGNQSKKPPSS* |
Ga0062384_1010876202 | 3300004082 | Bog Forest Soil | HHHDVVHFALEEVKKELEQGREEEVLERLRTHLAANSEKKTPLN* |
Ga0062387_1010324701 | 3300004091 | Bog Forest Soil | APQELHHHDVVHFALEEVQKEIDDGQEEAVVERLRVHLAANQKNRNPSS* |
Ga0066680_104232473 | 3300005174 | Soil | HDVVHFALEEVQKEMDEGHEDIVVARLRAHLEANQKKKAPKT* |
Ga0066680_106355361 | 3300005174 | Soil | MHHHDVVHFALEEVQKEVDEGHEDIVVNRLRAHLEANQKKKNPKA* |
Ga0066680_108386292 | 3300005174 | Soil | VHFALEEVQKEVEEGHEDIVVNRLRAHLEANQTKKTPRT* |
Ga0066388_1020142243 | 3300005332 | Tropical Forest Soil | VHFALEEVQKEIEEGHEEDVVCRLRSHLETNQKKRKQPS* |
Ga0066388_1024283063 | 3300005332 | Tropical Forest Soil | HHDVVHFALEEVQKELDEGREEEVTARLRAHVESNMKKKKKSQS* |
Ga0070708_1014728941 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | VAPEELHHHDVVHFSLEEVQRELDEGREVQVVERLRAHLIANRKKKTPGI* |
Ga0066681_102269863 | 3300005451 | Soil | AVAPLEMHHHDVVHFALEEVQKEMEEGHEDAVVNRLRQHLEANQQKKSPKA* |
Ga0070697_1013262852 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | VLAPQELHHHDVVHFALEEVQKEIEEGQEEAVVKRLRAHIEANQQKKKSSS* |
Ga0070730_110233011 | 3300005537 | Surface Soil | MLAPQELHHHDVVHFALEEVQKEIEDGQEDAVVKRLRAHLEANQTKKKPQSS* |
Ga0070733_103878683 | 3300005541 | Surface Soil | HDVVHFALEEVQKELDAGHEDIVVKHLRAHIEANLSKKKPSA* |
Ga0070733_106370931 | 3300005541 | Surface Soil | DVVHFALEEVQKEIDDGQEDAVVKRLRAHIEANQKKKTPSS* |
Ga0066695_105453983 | 3300005553 | Soil | HHDVVHFALEEVQKEMEEGHEDIVVSRLRQHLEANQKKKASKS* |
Ga0066692_107648021 | 3300005555 | Soil | EEVQKELEEGHEDIVVKRLRAHLEENQKRRKPPA* |
Ga0070762_108773652 | 3300005602 | Soil | LEEVKKEIEEGQEDAVVKRLRAHIEANQSKKPPSS* |
Ga0070715_102681753 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | TVAPLELHHHDVVHFALEEVKKELEDGQEDAVVNRLKGHLEANQKKKPTQT* |
Ga0070715_108475521 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | EEVQKEIDEGHEDQVVTRLRNHLESNQSKRKPKV* |
Ga0075014_1002012283 | 3300006174 | Watersheds | ALEEVKKELEDGQEDAVVARLRAHLEANTRKKPTQN* |
Ga0070765_1016821152 | 3300006176 | Soil | FALEEVQKEIDEGHEESVVGRLRAHLEANQNKRKPKV* |
Ga0097621_1018334531 | 3300006237 | Miscanthus Rhizosphere | LEEVKKELEDGQEDAVVNRLKAHLEANQKKKPTQT* |
Ga0068871_1023123221 | 3300006358 | Miscanthus Rhizosphere | EEVQKEIDEGQEDAVVGRLRSHLEANQKKRKPKT* |
Ga0068865_1005498003 | 3300006881 | Miscanthus Rhizosphere | LEEVQKEIDEGEEDAVVGRLRAHLEANQKKRKLKS* |
Ga0075424_1011425482 | 3300006904 | Populus Rhizosphere | LEEVQKEIDEGEEDAVVGRLRAHLDANQKKRKLKS* |
Ga0075436_1011269702 | 3300006914 | Populus Rhizosphere | EEVQKEVDDGHEDIVVNRLRAHLEANQKKKSPKT* |
Ga0099791_101926901 | 3300007255 | Vadose Zone Soil | AVAPLEMHHHDVVHFALEEVQKEVDEGHEDIVVNRLRAHLEANQKKKNPKA* |
Ga0099793_101727213 | 3300007258 | Vadose Zone Soil | VHFALEEVQKEIEEGHEDQVVNRLRTHLEANQSKRKPKV* |
Ga0099793_101887971 | 3300007258 | Vadose Zone Soil | HHHDVVHFALEEVQKEVEEGHEDMVVNRLRAHLEANQKKKTPRT* |
Ga0099794_100030971 | 3300007265 | Vadose Zone Soil | LAREELHHQDVVHFAWEEVQKDIEEGHEDEVVNRLRTHLESNQSKRKSKV* |
Ga0099795_105818441 | 3300007788 | Vadose Zone Soil | EELHHHDVVHFALEEVQKEIDEGHEDEVVNRLRSHLESNQNKRKPKA* |
Ga0066710_1043119001 | 3300009012 | Grasslands Soil | FALEEVRKETREGHEDEVVARLREHLETNKRKRNGGKPN |
Ga0099830_102018831 | 3300009088 | Vadose Zone Soil | PLEMHHHDVVHFALEEVQKELEEGHEDIVVKRLRAHLEENQKRRKPPA* |
Ga0099830_102915751 | 3300009088 | Vadose Zone Soil | APQEIHHHDVVHFALEEVQKEVDEGHEDIVVNRLRAHLEANQKKKAPKT* |
Ga0099828_104966473 | 3300009089 | Vadose Zone Soil | VVHFALEEVQKELEEGHEDIVVKRLRAHLEAIQKKRKPSS* |
Ga0099828_116452121 | 3300009089 | Vadose Zone Soil | HHDVVHFALEEVQKEIDEGHEDIVVNRLRAHLEANQKKKAPKA* |
Ga0066709_1015349621 | 3300009137 | Grasslands Soil | LGVAEGQKESEEGGEDGVVGRFRAHLEANQKKRKPES* |
Ga0099792_109865132 | 3300009143 | Vadose Zone Soil | DVVHFALEEVQKEIDEGHEDIVVSRLRAHLEANQKKKAPKT* |
Ga0116121_11363552 | 3300009644 | Peatland | VVHFALEEVQKELDEGREEEVLNRLRAHLEANLKKKPSSE* |
Ga0126380_114662061 | 3300010043 | Tropical Forest Soil | LEEVQKEIDEGEEDAVLSRLRAHLDANQKKRKPKS* |
Ga0126384_103780831 | 3300010046 | Tropical Forest Soil | GTSGFELHHHDVVHFALEEVQKELDEGRDDEVMTRLRAHLESNEKKKKGGKQ* |
Ga0099796_101000743 | 3300010159 | Vadose Zone Soil | AREELHHHDVVHFALEEVQKEIDEGHEDEVVNRLRSHLESNQNKRKPKA* |
Ga0134088_101292141 | 3300010304 | Grasslands Soil | ALEEVQKEVEEGHEDDVVHRLRAHLEENQKKKTPKA* |
Ga0134064_102144631 | 3300010325 | Grasslands Soil | FALEEVQKEVEEGHEDIVVNRLRAHLEANQTKKTPRS* |
Ga0074044_103901492 | 3300010343 | Bog Forest Soil | LEEVQKEMDEGHEDIVVNRLREHLEAIQKSKAPKP* |
Ga0126370_110728801 | 3300010358 | Tropical Forest Soil | DVVHFALEEVQKELEDGHEDDVVCRLRGHLEENQKKRKTSAS* |
Ga0126370_125865592 | 3300010358 | Tropical Forest Soil | HHDVVHFALEEVQKELEEGHEDDVVCRLRAHLEENQKKRKQPS* |
Ga0126370_126221672 | 3300010358 | Tropical Forest Soil | FALEEVQKELEEGREEDVVCRLRNHLEINQKKRKQPS* |
Ga0126376_100074501 | 3300010359 | Tropical Forest Soil | HHHDVVHFSLEELQSDLDAGKEQELVNRLRSHLAANRSKKKTPPA* |
Ga0126376_123600442 | 3300010359 | Tropical Forest Soil | LAREELHHHDVVHFALEEVIKEIEEGHEEEVVNRLRAHLESNLNK |
Ga0126378_111679181 | 3300010361 | Tropical Forest Soil | FHHHDVVHFALEEVKKELEEGHEEDVICRLRNHLETNQKERKQPS* |
Ga0126379_102951221 | 3300010366 | Tropical Forest Soil | FSENVGGMDLHHHDVVHFALEEVQKELDEGRDEEVVSRLKAHLESNEKKKARKP* |
Ga0126379_128363832 | 3300010366 | Tropical Forest Soil | HDVVHFALEEVQKELEDGREEDVVHRLRDHLEENQKKRKPSS* |
Ga0126381_1033587431 | 3300010376 | Tropical Forest Soil | LRFSEASAPLELHHHDVVHFALEEVMKELDDGQEEALMARLKAHLESNVKKKQPKI* |
Ga0136449_1001508891 | 3300010379 | Peatlands Soil | HHDVVHFALEEVQKELDEGHEDSVVARLRAHLETNQKKKEPKS* |
Ga0126383_121216372 | 3300010398 | Tropical Forest Soil | VHFALQEVQKEIDEGHEDEVVERLRAHLESNLKKKKPVS* |
Ga0126346_14270672 | 3300010865 | Boreal Forest Soil | LEEVKKEIEDGQEEAVVKRLRAHLEGNQSKKPPSS* |
Ga0150983_102420941 | 3300011120 | Forest Soil | MHHHDVVHFALEEVKKEMEEGHEDIVVNRLRAHLEANQKKKAPKT* |
Ga0150983_112239664 | 3300011120 | Forest Soil | PQELHHHDVVHFALEEVKKEIEEGQEDAVVKRLRAHIEANQSKKPSSS* |
Ga0150983_133436272 | 3300011120 | Forest Soil | APLEMHHHDVVHFALEEVQKEVEEGHEDIVVNRLRAHLEGNQKKKAPKS* |
Ga0137392_101231891 | 3300011269 | Vadose Zone Soil | VVHFALEEVQKELEEGNEENVVNRLRAHLETNQKKKAPKT* |
Ga0137392_103991181 | 3300011269 | Vadose Zone Soil | DAVAPLEMHHHDVVHFALEEVQKEVDEGHEDIVVNRLRAHLEANQKKKNPKA* |
Ga0137392_107687102 | 3300011269 | Vadose Zone Soil | HHHDVVHFALEEVQKEIDDGHEDEVVNRLRAHLESNLNKRKPKA* |
Ga0137392_108606742 | 3300011269 | Vadose Zone Soil | LEEVQKEMEEGHEDIVVNRLRTHLEANQKKKAPKS* |
Ga0137391_101511594 | 3300011270 | Vadose Zone Soil | HHHDVVHFALEEVQKEMDEGHEDIVVARLRAHLEANQKKKAPKT* |
Ga0137391_106621741 | 3300011270 | Vadose Zone Soil | HHDVVHFALEEVQKEMEEGHEDIVVNRLRAHLEANQKKKAPKT* |
Ga0137393_103631713 | 3300011271 | Vadose Zone Soil | DAVAPLEMHHHDVVHFALEEVKKEMEEGHEDIVVNRLRAHLEANQKKKAPKT* |
Ga0137393_107037632 | 3300011271 | Vadose Zone Soil | VAPLEMHHHDVVHFALEEVQKEVDEGHEDIVVNRLRAHLEANQKKKTPKA* |
Ga0137393_108041082 | 3300011271 | Vadose Zone Soil | VHFALEEVQKEMEEGHEDIVVNRLRAHLEANQKKKAPKT* |
Ga0137389_104307371 | 3300012096 | Vadose Zone Soil | HHHDVVHFALEEVQKELEEGNEENVVNRLRAHLETNQKKKAPKT* |
Ga0137388_104318403 | 3300012189 | Vadose Zone Soil | VHFRREEVKKDMEEGHEDIVVNRLRAHLEANQKKKAPKT* |
Ga0137388_105683943 | 3300012189 | Vadose Zone Soil | EMHHHDVVHFALEEVKKEMEEGHEDIVVNRLRAHLEANQKKKAPKT* |
Ga0137388_107750581 | 3300012189 | Vadose Zone Soil | LEEVQKEVDEGHEDIVVNRLRAHLEANQKKKAPKA* |
Ga0137388_107787792 | 3300012189 | Vadose Zone Soil | LPAQELHHHDVVHFALQEVQKELEEGQEHAVVDRLRAHLEANLKKKTPSS* |
Ga0137388_108448471 | 3300012189 | Vadose Zone Soil | VVHFALEEVKKEMEEGHEDDVVNRLRAHLEANQKKKTPKT* |
Ga0137388_118309142 | 3300012189 | Vadose Zone Soil | HFALEEVQKEVDEGHEDIVVNRLRAHLEANQKKKTPKA* |
Ga0137388_119289281 | 3300012189 | Vadose Zone Soil | IHHHDVVHFALEEVQKEVEEGHEDDVVHRLRTHLEENQKKRKPSA* |
Ga0137383_106340492 | 3300012199 | Vadose Zone Soil | FALEEVQKELEEGNEENVVNRLRAHLETNQKKKAPKT* |
Ga0137365_104935482 | 3300012201 | Vadose Zone Soil | DVVHFALEEVQKEVEEGHEDDVVNRLRAHLEEIQKKKAPKT* |
Ga0137363_101084685 | 3300012202 | Vadose Zone Soil | HDVVHFALEEVQKEIDDGQEDQVVKRLRAHIEANERKKAPKT* |
Ga0137363_103892421 | 3300012202 | Vadose Zone Soil | FALEEVQKEVDEGHEDIVVNRLRAHLEANQKKKAPKV* |
Ga0137399_101811384 | 3300012203 | Vadose Zone Soil | HDVVHFALEEVQKELDEGHEDIVVNRLRAHLEANQKKKAPKT* |
Ga0137399_104458351 | 3300012203 | Vadose Zone Soil | PLEMHHHDVVHFALEEVQKEVDEGHEDIVVNRLRAHLEANQKKKNPKA* |
Ga0137399_107415431 | 3300012203 | Vadose Zone Soil | HHDVVHFALEEVQKEIEEGHEDQVVNRLRTHLEANQSKRKPKV* |
Ga0137399_108632891 | 3300012203 | Vadose Zone Soil | DVVHFALEEVQKEIEEGREDEVVTRLRNHLESNQSKRKPKS* |
Ga0137399_109770442 | 3300012203 | Vadose Zone Soil | APQEIHHHDVVHFALEELQKELDDGHEDIVVNRLRAHLEANQKKKAPKA* |
Ga0137362_100634881 | 3300012205 | Vadose Zone Soil | VAPLEMHHHDVVHFALEEVQKEVDEGHEDIVVNRLRAHLEANQKKKNPKA* |
Ga0137362_101490521 | 3300012205 | Vadose Zone Soil | LHHHDVVHFALEEVQKEIEEGHEDEVVNRLRNHLKSNQSKRKSKV* |
Ga0137362_103510181 | 3300012205 | Vadose Zone Soil | HHDVVHFALEEVQKEVDEGHEDIVVNRLRAHLEANQKKKAPKV* |
Ga0137362_109244652 | 3300012205 | Vadose Zone Soil | VHFALEEVQKEIEEGHEDEVVNRLRNHLVSNQSKRKSKA* |
Ga0137362_110897352 | 3300012205 | Vadose Zone Soil | HHHDVVHFALEEVQKEVDEGHEDIVVNRLRAHLEANQKKKNPKA* |
Ga0137381_104382361 | 3300012207 | Vadose Zone Soil | DVVHFALEEVQKELEEGNEENVVNRLRAHLETNQKKKAPKT* |
Ga0137381_107845813 | 3300012207 | Vadose Zone Soil | EEVKKEIEEGHEDTVVSRLRTHLEANQKKKAPKT* |
Ga0137378_104193601 | 3300012210 | Vadose Zone Soil | LEMHHHDVVHFALEEVQKEVEEGHEDIVVNRLRAHLEANQKKKAPKT* |
Ga0137378_105451041 | 3300012210 | Vadose Zone Soil | LEMHHHHVVHFALEELQKELDEGTEENLVNRLRAHLETNQKKKAPKT* |
Ga0150985_1078498122 | 3300012212 | Avena Fatua Rhizosphere | HHHDVVHFALEEVQKEIDEGEEDAVVGRLRAHLEANQKKRRPKG* |
Ga0137385_104993451 | 3300012359 | Vadose Zone Soil | DSVAPLEMHHHDVVHFALEEVQKELEEGNEENVVNRLRAHLETNQKKKVPKT* |
Ga0137360_100449126 | 3300012361 | Vadose Zone Soil | ALEEVQKEMDEGHEDIVVARLRAHLEANQKKKAPKT* |
Ga0137360_112008751 | 3300012361 | Vadose Zone Soil | DVVHFALEEVQKEIEEGHEDEVVTRLRNHLESNQSKRKPTKP* |
Ga0137361_106658961 | 3300012362 | Vadose Zone Soil | REELHHHDVVHFALEEVQKEIEEGHEDEVVNRLRHHLESNQSKRKSKV* |
Ga0137361_115308461 | 3300012362 | Vadose Zone Soil | DVVHFALEEVQKELEEGNEENVVNRLRAHLETNQKKKVPKT* |
Ga0137397_112914591 | 3300012685 | Vadose Zone Soil | EMHHHDVVHFALEEVQKEIDEGHEDIVVSRLRAHLEANQKKKAPKT* |
Ga0137396_106882991 | 3300012918 | Vadose Zone Soil | FALEEVQKEIDEGQEDQVVNRLRAHIESNQTKRAPKA* |
Ga0137396_109099902 | 3300012918 | Vadose Zone Soil | HHDVVHFALEEVKKEMEEGHEDIVVNRLRAHLEANQKKKAPKT* |
Ga0137396_113164561 | 3300012918 | Vadose Zone Soil | DAVAPLEIHHHDVVHFALEEVKKELDEGQEDAVVARLRAHLESNQKKKKSPTS* |
Ga0137394_106052411 | 3300012922 | Vadose Zone Soil | AREELHHHDVVHFALEEVQKEIEEGHEDEVVTRLRNHLESNQSKRKPKS* |
Ga0137394_109521711 | 3300012922 | Vadose Zone Soil | ALEEVKKEVDEGHEDMVVNRLRAHLEANQKKKTPKA* |
Ga0137394_116290512 | 3300012922 | Vadose Zone Soil | ALEEVQKEIEEGHEDEVVTRLRNHLESNQSKRKPKS* |
Ga0137419_107872541 | 3300012925 | Vadose Zone Soil | DVVHFALEEVKKEMEEGHEDDVVNRLRAHLEANQKKKVPKT* |
Ga0137419_113974081 | 3300012925 | Vadose Zone Soil | LHHHDVVHFALEEVQKEIEEGHEDEVVTRLRNHLESNQSKRKPKS* |
Ga0137419_114962322 | 3300012925 | Vadose Zone Soil | FSESAAPLELHHHDVVHFALEEVMKEVDDGQEEAVIARLKAHLEANVKKKPPSN* |
Ga0137416_106601762 | 3300012927 | Vadose Zone Soil | LEIHHHDVVHFALEEVKKEVDEGHEDMVVNRLRAHLEANQKKKAPKA* |
Ga0137407_106916363 | 3300012930 | Vadose Zone Soil | EMHHHDVVHFALEEVQKEVDEGHEDIVVNRLRAHLEANQKKKNPKA* |
Ga0137410_115044041 | 3300012944 | Vadose Zone Soil | DVLAPQELHHHDVVHFALEEVQKELDEGHEDIVVKRLRDHLAVNQTKKTPSGLG* |
Ga0181531_108649142 | 3300014169 | Bog | GAELHHHDVVHFALEEVQKELDEGEEDEVVARLRAHLEANQSKRSKSKI* |
Ga0137418_108028581 | 3300015241 | Vadose Zone Soil | FSESAAPLELHHHDVVHFALEEVMKEVDEGQEEAVITRLKAHLEANVKKKPPGI* |
Ga0137409_110386901 | 3300015245 | Vadose Zone Soil | HHHDVVHFALEEVQKEIEEGHEDEVVTRLRNHLESNQSKRKPKS* |
Ga0137403_105377201 | 3300015264 | Vadose Zone Soil | LEEVQKELDEGHEDIVVNPLRAHLEANQKKKAPKT* |
Ga0182041_109433531 | 3300016294 | Soil | TVAPLELHHHDVVHFALEEVKKELEDGQEDAVVNRLKGHLEANQKKKPAQT |
Ga0182035_115530851 | 3300016341 | Soil | FALEEVKKELEDGQEDAVVNRLKGHLEANQKKKPAQT |
Ga0182037_100387751 | 3300016404 | Soil | LHHHDVVHFALEEVQKELEDGAEDGVVHRLRAHLDANQRKRKTPS |
Ga0182037_102471374 | 3300016404 | Soil | DVVHFALEEVQKELDEGREEEVTARLRAHVESNMRKKSQS |
Ga0181505_100307811 | 3300016750 | Peatland | VVHFALEEVQKEIDEGQEEEVLNRLRAHVQANLKKKPEKN |
Ga0134083_100115901 | 3300017659 | Grasslands Soil | LEEVQKEMEEGHEDAVVNRLRQHLEANQQKKSPKA |
Ga0187801_102810152 | 3300017933 | Freshwater Sediment | HHHDVVHFALEEVQKEMEEGQEEQVVARLKAHLESNLKKKPGEKQ |
Ga0187803_100222035 | 3300017934 | Freshwater Sediment | FSETTTPLEMHHHDVVHFALEEVQKEIDEGKEDAVVARLRAHLEANLKKKPDKK |
Ga0187817_108815142 | 3300017955 | Freshwater Sediment | LELHHHDVVHFALEEVQKELDEGQEEALLARLRAHVEANLKKKPEKS |
Ga0187779_101215681 | 3300017959 | Tropical Peatland | HHDVVHFALEEVQKELADGKEGEVITRLHEHLEENKRKRDKPAV |
Ga0187778_104547292 | 3300017961 | Tropical Peatland | SESTGPLEFHHHDVVHFALEEVQKELEEGHEEEIVARLRAHLESNLRKPPPKD |
Ga0187858_103541201 | 3300018057 | Peatland | EVLAREELHHHDVVHFALEEVQKEIDEGQEDAVVGRLRAHLEANQKQKKPKA |
Ga0187769_101769901 | 3300018086 | Tropical Peatland | ALEEVQKELDEGHEENVVNRLRAHLEENQKKRKPSS |
Ga0187769_104676362 | 3300018086 | Tropical Peatland | VVHFALEELQKELDEGQEEKLLERLRAHVESNLKKKQPKS |
Ga0187771_112200972 | 3300018088 | Tropical Peatland | EMHHHDVVHFALEEVQKELEEGHEDDVVNRLRAHLEENVKKRKPSS |
Ga0187774_106063282 | 3300018089 | Tropical Peatland | DVVHFALEEVQKEIEEGKEEAVVSRLREHLESNLRKRPGRA |
Ga0187770_101331954 | 3300018090 | Tropical Peatland | VHFALEEVQKEMDEGQEDKVVARLRAHVEANLKKRPEKT |
Ga0066662_124380541 | 3300018468 | Grasslands Soil | FALEEVQKEVDEGHEDIVVNRLRAHLEANQKKKNPKA |
Ga0182025_13440413 | 3300019786 | Permafrost | LEEVQKELDDGREDEVVRRLRAHLDSNLTKRKPAEKN |
Ga0193728_12070402 | 3300019890 | Soil | MLAPLELHHHDVVHFALEEVQKELDEGHEDEVVKRLRAHLDANQKKRKATPQDKLN |
Ga0179592_105331041 | 3300020199 | Vadose Zone Soil | MHHHDVVHFALEEVQKEVEDGHEDIVVNRLRAHLEANQKKNPPKA |
Ga0210407_101680274 | 3300020579 | Soil | APLEMHHHDVVHFALEEVQKEMDEGHEDIVVNRLRAHLEEIQKKKTPKA |
Ga0210407_102883421 | 3300020579 | Soil | MLAPQELHHHDVVHFALEEVQKEIEDGQEDAVLKRLRAHLEANQTKKKPQSS |
Ga0210407_105757291 | 3300020579 | Soil | DVVHFALEEVKKEIEEGQEDAVVKRLRAHIEANQSKKPPSS |
Ga0210407_107391952 | 3300020579 | Soil | QELHHHDVVHFALEEVQKELEEGREHEVVDRLRAHLESNLKKKIPPC |
Ga0210403_110912011 | 3300020580 | Soil | SAAPLELHHHDVVHFALEEVMKEVEDGQEESVITRLKAHLESNAKKKPPAN |
Ga0210399_101090015 | 3300020581 | Soil | SAAPLELHHHDVVHFALEEVMKEVEEGQEEAVITRLKAHLQSNVKQKPPAI |
Ga0210399_101287045 | 3300020581 | Soil | ESLAREELHHHDVVHFALEEVQKEIEEGHEDEVVNRLRNHLVSNQSKRKSKV |
Ga0210401_114938672 | 3300020583 | Soil | LAPQELHHHDVVHFALQEVKKEIEDGEEDAVVKRLRDHLDGNQSKKSPSS |
Ga0179596_103836102 | 3300021086 | Vadose Zone Soil | LEEVQKEVDEGHEDIVVNRLRAHLEANQKKKNPKA |
Ga0210404_103707201 | 3300021088 | Soil | ALEEVKKELEDGQEDAVVNRLKAHLEANQKKKPTQT |
Ga0210406_107214472 | 3300021168 | Soil | LEMHHHDVVHFALEEVQKELEDGQEDAVVARLRAHLEANTRKKPTQN |
Ga0210400_101589755 | 3300021170 | Soil | LAPQELHHHDVVHFALEEVKKEIEDGQEDEVVKRLRAHLEGNQTKKTPSS |
Ga0210400_105604483 | 3300021170 | Soil | FSESLAREELHHHDVVHFALEEVQKEIEEGHEDEVVNRLRTHLESNQSKRKPKV |
Ga0210400_114787222 | 3300021170 | Soil | FALEEVQKEIDEGQEDAVVARLRTHLEANQNKRKPKT |
Ga0210405_109238261 | 3300021171 | Soil | HHDVVHFALEEVQKELEEGQEDAVFNRLRVHIESNLKKKKPPMS |
Ga0210405_113209401 | 3300021171 | Soil | HHDVVHFALEEVQKEVEEGHEDIVVNRLRAHLEGNQKKKAPKS |
Ga0210408_101131075 | 3300021178 | Soil | VVHFALEEVQKEIEEGHEDEVVTRLRNHLESNQSKRKPKA |
Ga0210408_102749281 | 3300021178 | Soil | VLAPQELHHHDVVHFALEEVKKEIEDGQEDEVVKRLRAHLEGNQSKKPPSS |
Ga0210396_109490272 | 3300021180 | Soil | LSESAAVLELHHHDVVHFALEEVMKEVEEGQEEAVITRLKAHLQSNVKQKPPAI |
Ga0210396_110903982 | 3300021180 | Soil | VHFALEEVQKEIDEGQEDAVVARLRAHLEANQKQKKPKA |
Ga0210396_112408721 | 3300021180 | Soil | ALEEVQKEIDEGHEDQVVNRLRTHLESNQSKRKPKV |
Ga0210388_117393961 | 3300021181 | Soil | LELHHHDVVHFALEEVMKEVEEGQEEAVITRLKAHLESNVKKKPPSI |
Ga0210389_100939715 | 3300021404 | Soil | TAPLEMHHHDVVHFALEEVQKELEDGQEDAVVARLRAHLEANTRKKPTQN |
Ga0210383_100559081 | 3300021407 | Soil | VVHFALEEVKKELEDGQEDAVVNRLKGHLDANQKKKPTQT |
Ga0210383_111037411 | 3300021407 | Soil | LHHHDVVHFALEEVKKEMDDGREEEVIIRLKAHLESNQKKKLS |
Ga0210384_115303092 | 3300021432 | Soil | VAPREIHHHDVVHFALEEVKKEVEEGHEDIVVSRLRAHLDANQKKKNPKS |
Ga0210390_114081351 | 3300021474 | Soil | ALEEVQKELDEGEEGEVVARLRAHLEANQSKRSKSKL |
Ga0210392_115081691 | 3300021475 | Soil | HFALEEVKKELEDGQEDAVVNRLKGHLDANQKKKPTQT |
Ga0210402_108847671 | 3300021478 | Soil | LELHHHDVVHFALEEVMKEVEDGQEEAVITRLKSHLESNAKKKPPAL |
Ga0210402_109179762 | 3300021478 | Soil | EEVQKEIDEGHEESVVGRLRAHLEANQTKRKPPKT |
Ga0210410_102647871 | 3300021479 | Soil | LHHHDVVHFALEEVKKEIEEGQEDEVVKRLRAHLEGNQSKKPPSS |
Ga0210410_114565241 | 3300021479 | Soil | LEEIQKEIEEGHEDQVVNRLRTHLEANQSKRKPKV |
Ga0210409_107118393 | 3300021559 | Soil | EELHHHDVVHFALEEVQKEIEEGHEDEVVTRLRNHLESNQSKRKSKV |
Ga0210409_113923942 | 3300021559 | Soil | ALEEVQKEIDEGQEDAVVGRLRAHLEANQSKRKPQS |
Ga0126371_113449001 | 3300021560 | Tropical Forest Soil | HHHDVVHFALEEVQKELDEGREEEVTARLRAHVESNMKKKKQSQS |
Ga0126371_114367343 | 3300021560 | Tropical Forest Soil | HHHDVVHFALEEVQKELDEGREEEVTARLRAHVESNMKKKKKSQS |
Ga0126371_114874411 | 3300021560 | Tropical Forest Soil | ELHHHDVVHFALEEVQKELDEGREEEVTARLRAHVESNMRKKSQS |
Ga0126371_122960963 | 3300021560 | Tropical Forest Soil | ELHHHDVVHFALEEVQKELDDGQEEALLARLRAHVESNMKKKPQS |
Ga0126371_131755931 | 3300021560 | Tropical Forest Soil | VVHFALEEVQKEMEDGHEDDVVCRLRSHLEANQKKRKQPS |
Ga0224550_10308891 | 3300022873 | Soil | GAQELHHHDVVHFALEEVKKELEQGREEQVIIRLREHLAINHQKKPPDN |
Ga0224550_10383291 | 3300022873 | Soil | ALEEVQKEIDEGQEDAVVGRLRAHLEANQKQKKPKT |
Ga0247688_10259913 | 3300024186 | Soil | HDVVHFALEEVQKEIEEGQEDAVVKRLRAHLEGNQKKKTPSS |
Ga0247668_11235521 | 3300024331 | Soil | HHDVVHFALEEVQKEIDEGEEDAVVGRLRAHLDANQKKRKLKS |
Ga0207699_105336742 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | FSESAAPLELHHHDVVHFALEEVMKEVDEGQEEAVITRLKAHLESNVKKKPPGI |
Ga0207704_109627051 | 3300025938 | Miscanthus Rhizosphere | LEEVQKEIDEGEEDAVVGRLRAHLEANQKKRKLKS |
Ga0209688_10596722 | 3300026305 | Soil | HDVVHFALEEVQKEVEEGHEDIVVNRLRAHLEANQTKKTPRS |
Ga0209802_12815541 | 3300026328 | Soil | FALEEVQKEVEEGHEDIVVNRLRAHLEANQTKKTPRT |
Ga0209377_10624384 | 3300026334 | Soil | HFALEEVQKEVDEGHEDAVINRLRQHLEANQKKKAPKS |
Ga0257176_10287971 | 3300026361 | Soil | HDVVHFALEEVKKEMEEGHEDDVVNRLRAHLEANQKKKVPKT |
Ga0257168_11028491 | 3300026514 | Soil | VHFALEEVQKEIEEGHEDQVVNRLRTHLEANQSKRKPKV |
Ga0257158_10797151 | 3300026515 | Soil | FSEVLAREELHHHDVVHFALEEVQKEIDEGQEDAVVARLRAHLEANQKQRKPKT |
Ga0179587_109664851 | 3300026557 | Vadose Zone Soil | QELHHHDVVHFALEEVKKEMDEGREEEVILRLKAHLDSNQKGKAQH |
Ga0207948_10127723 | 3300027174 | Forest Soil | IHHHDVVHFALEELKKEMDEGHEDIVVSRLRAHLEANQKKKTPKA |
Ga0208983_10457891 | 3300027381 | Forest Soil | LHHHDVVHFALEEVQKELDDGQEDEVVKRLRAHLDANENKRKRIPQGKLN |
Ga0209008_10797721 | 3300027545 | Forest Soil | ALEEVKKEIEEGQEDAVVKRLRAHIEANQSKKPPSS |
Ga0209219_11027171 | 3300027565 | Forest Soil | VHFALEEVQKELDEGHEDEVVKRLRAHLDANQSKRKPTPQDKLN |
Ga0209733_10394151 | 3300027591 | Forest Soil | LELHHHDVVHFALEEVMKELDDGQEEALMARLRAHLQSNVKNKPPKN |
Ga0209422_10209441 | 3300027629 | Forest Soil | FALEEVQKEIEEGHEDQVVNRLRTHLESNQSKRKPKA |
Ga0209388_11481982 | 3300027655 | Vadose Zone Soil | HDVVHFALEEVQKEVDEGHEDIVVNRLRAHLEANQKKKAPKA |
Ga0209178_10111326 | 3300027725 | Agricultural Soil | HDVVHFALEEVQKEMEDGHEDDVVCRLRAHLEENQKKRKQSS |
Ga0209248_100696071 | 3300027729 | Bog Forest Soil | HFALEEVKKEIEEGQEDEVVKRLRAHLEGNKSKKTPPS |
Ga0209074_105006162 | 3300027787 | Agricultural Soil | LVSPMELHHHDVVHFALEEVQKEMEDGHEDDVVCRLRAHLEENQKKRKQSS |
Ga0209139_100712031 | 3300027795 | Bog Forest Soil | VHFALEEVKKELEQGREDEVLERLRTHLAANSEKKTPLS |
Ga0209060_103132241 | 3300027826 | Surface Soil | HFALEEVQKELEDGQEDAVVARLKAHLEANSRKKSPK |
Ga0209180_104716592 | 3300027846 | Vadose Zone Soil | HHHDVVHFALEEVQKELEEGKESEVVKRLRNHLEENKRKRTEPS |
Ga0209274_103899352 | 3300027853 | Soil | LAPQELHHHDVVHFALEEVKKEIDEGQEDEVVKRLRAHLEANQSKKPPSA |
Ga0209166_105397521 | 3300027857 | Surface Soil | HDVVHFALEEVQKEIDEGHEEEVINRLRSHLESNQNKRKSKT |
Ga0209701_103033623 | 3300027862 | Vadose Zone Soil | ALEEVQKELEEGNEENVVNRLRAHLETNQKKKVPKT |
Ga0209701_104559822 | 3300027862 | Vadose Zone Soil | ALEEVQKELEEGNEENVVNRLRAHLETNQKKKAPKT |
Ga0209283_109250672 | 3300027875 | Vadose Zone Soil | LEEVQKEIDEGHEDIVVNRLRAHLEANQKKKAPKA |
Ga0209488_105476292 | 3300027903 | Vadose Zone Soil | AVAPLEMHHHDVVHFALEEVQKEVDEGHEDIVVNRLRAHLEANQKKKSPKT |
Ga0209006_105287381 | 3300027908 | Forest Soil | VQKELDDGHEDEVVKRLRAHLDANQSKRKPTPQDKLN |
Ga0247684_10886442 | 3300028138 | Soil | EEVQKEIEDGQEDAVVKRLRAHLEANQTKKKPQAS |
Ga0137415_104837661 | 3300028536 | Vadose Zone Soil | VVHFALEEVQKEIDEGQEDAVVARLRAHLESNLKKKKSPTS |
Ga0302227_101086173 | 3300028795 | Palsa | REELHHHDVVHFALEEVQKEIDEGQEDSVVGRLRAHLEANEKKRKPKP |
Ga0308309_103294533 | 3300028906 | Soil | HFALEEVQKELDEGEEDQVVARLRAHLEANQNKRKPKL |
Ga0311352_100758396 | 3300029944 | Palsa | VVHFALQEVKNELEQGREEEVLSRLRAHLTANSEKKSPHS |
Ga0075385_117376372 | 3300030854 | Soil | LEEVQKELDEGHEDEVVKRLRAHLDANQNKRKPTPQTKVN |
Ga0170824_1256492851 | 3300031231 | Forest Soil | LELHHHDVVHFALEEVKKELEDGQEDAVVNRLKGHLEANQKKKPAQT |
Ga0318541_106418581 | 3300031545 | Soil | TAPLELHHHDVVHFALEEVQKELDEGREEEVTARLRAHVESNMKKKKKSQS |
Ga0310686_1010600793 | 3300031708 | Soil | FSDVLAPQELHHHDVVHFALEEVKKEIEEGQEDVVVKRLRAHLEGNQSKKTPSS |
Ga0306917_115113171 | 3300031719 | Soil | NECTAPLELHHHDVVHFALEEVQKELDEGREEELTARLRAHVESNMRKKSQS |
Ga0307469_103485491 | 3300031720 | Hardwood Forest Soil | REELHHHDVVHFALEEVQKEIEEGHEEEVINRLRSHLESNQNKRKSKT |
Ga0306918_100357783 | 3300031744 | Soil | EEVQKELDEGREEEVTARLRAHVESNMKKKKKSQS |
Ga0307475_100428321 | 3300031754 | Hardwood Forest Soil | FALEEVQKEMEEGHEDGVVNRLRAHLEASQKKRASKT |
Ga0318543_103974091 | 3300031777 | Soil | HDVVHFALEEVQKELDEGREEEVTARLRAHVESNMKKKKKSQS |
Ga0307478_115492812 | 3300031823 | Hardwood Forest Soil | HDVVHFALQEVQKELEEGREEELLSRLRAHIEANQKKKPGQS |
Ga0306919_102849001 | 3300031879 | Soil | FNECTAPLELHHHDVVHFALEEVQKELDEGREEELTARLRAHVESNMRKKSQS |
Ga0306925_103224711 | 3300031890 | Soil | LEEVQKELDEGREEEVTARLRAHVESNMKKKKKSQS |
Ga0306923_100625081 | 3300031910 | Soil | FALEEVQKELDEGREEEVTARLRAHVESNMKKKKKSQS |
Ga0306923_102702241 | 3300031910 | Soil | LRFNECTAPLELHHHDVVHFALEEVQKELDEGREEELTARLRAHVESNMRKKSQS |
Ga0306923_106536903 | 3300031910 | Soil | HFALEEVQKELEEGRDDEVVSRLRAHLESNEKKKGRKP |
Ga0310912_106622303 | 3300031941 | Soil | APLELHHHDVVHFALEEVQKELDEGQEEALMARLRAHVESNMKKKPEKV |
Ga0310909_111807782 | 3300031947 | Soil | DVVHFALEEVQKELDEGREEELTARLRAHVESNMRKKSQS |
Ga0307479_102487324 | 3300031962 | Hardwood Forest Soil | VHFALEEVQKEIEEGHEDEVVTRLRNHLESNQSKRKPKA |
Ga0307479_108259143 | 3300031962 | Hardwood Forest Soil | FALEEVQKELDEGHEDEVVKRLRAHLDANQKKRKATPQDKLN |
Ga0307479_112903481 | 3300031962 | Hardwood Forest Soil | HDVVHFALEEVQKEIDEGEEDAVVGRLRAHLEANQSKRKPKT |
Ga0307479_113526121 | 3300031962 | Hardwood Forest Soil | VVHFALEEVQKEIDEGQEDAVVGRLRAHIESNQKKKQVKG |
Ga0307479_116976001 | 3300031962 | Hardwood Forest Soil | DAVAPMEMHHHDVVHFALEEVQKEMEEGHEDIVVSRLRAHLEAIQKKKTPKS |
Ga0311301_122924571 | 3300032160 | Peatlands Soil | LEEVQKELDEGHEDSVVARLRAHLETNQKKKEPKS |
Ga0307471_1001000005 | 3300032180 | Hardwood Forest Soil | VHFALEEVKKEMEEGHEDIVVNRLRAHLEANQKKKAPKT |
Ga0307471_1002471661 | 3300032180 | Hardwood Forest Soil | EELHHHDVVHFSLEELQKELDEGKDEEVLNRLRAHLASNRSKKKPPSS |
Ga0307471_1008334461 | 3300032180 | Hardwood Forest Soil | ALEEVQKELEEGQEQAVVDRLRAHLEANLKKKTPSS |
Ga0310914_102599231 | 3300033289 | Soil | LEEVQKELDEGQEEKLLTRLREHVESNLRKKQGKA |
Ga0318519_102134212 | 3300033290 | Soil | ELHHHDVVHFALEEVQKELDEGREEEVTARLRAHVESNMKKKKKSQS |
⦗Top⦘ |