| Basic Information | |
|---|---|
| Family ID | F015935 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 251 |
| Average Sequence Length | 43 residues |
| Representative Sequence | AIRNLPDWDAQQTLQFLMKRVDEFVGATRQSDDITCLVFRSK |
| Number of Associated Samples | 191 |
| Number of Associated Scaffolds | 251 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 1.20 % |
| % of genes near scaffold ends (potentially truncated) | 98.41 % |
| % of genes from short scaffolds (< 2000 bps) | 90.44 % |
| Associated GOLD sequencing projects | 172 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.49 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (100.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (26.295 % of family members) |
| Environment Ontology (ENVO) | Unclassified (28.287 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (45.817 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 31.43% β-sheet: 0.00% Coil/Unstructured: 68.57% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.49 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 251 Family Scaffolds |
|---|---|---|
| PF01743 | PolyA_pol | 41.83 |
| PF12627 | PolyA_pol_RNAbd | 31.47 |
| PF02190 | LON_substr_bdg | 3.98 |
| PF05362 | Lon_C | 1.20 |
| PF00557 | Peptidase_M24 | 0.80 |
| PF02321 | OEP | 0.80 |
| PF04255 | DUF433 | 0.40 |
| PF02371 | Transposase_20 | 0.40 |
| PF13735 | tRNA_NucTran2_2 | 0.40 |
| PF02517 | Rce1-like | 0.40 |
| PF07228 | SpoIIE | 0.40 |
| PF02518 | HATPase_c | 0.40 |
| PF00069 | Pkinase | 0.40 |
| COG ID | Name | Functional Category | % Frequency in 251 Family Scaffolds |
|---|---|---|---|
| COG0617 | tRNA nucleotidyltransferase/poly(A) polymerase | Translation, ribosomal structure and biogenesis [J] | 41.83 |
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 1.59 |
| COG1538 | Outer membrane protein TolC | Cell wall/membrane/envelope biogenesis [M] | 1.59 |
| COG0466 | ATP-dependent Lon protease, bacterial type | Posttranslational modification, protein turnover, chaperones [O] | 1.20 |
| COG1067 | Predicted ATP-dependent protease | Posttranslational modification, protein turnover, chaperones [O] | 1.20 |
| COG1750 | Predicted archaeal serine protease, S18 family | General function prediction only [R] | 1.20 |
| COG3480 | Predicted secreted protein YlbL, contains PDZ domain | Signal transduction mechanisms [T] | 1.20 |
| COG1266 | Membrane protease YdiL, CAAX protease family | Posttranslational modification, protein turnover, chaperones [O] | 0.40 |
| COG2442 | Predicted antitoxin component of a toxin-antitoxin system, DUF433 family | Defense mechanisms [V] | 0.40 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.40 |
| COG4449 | Predicted protease, Abi (CAAX) family | General function prediction only [R] | 0.40 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 100.00 % |
| Unclassified | root | N/A | 0.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459013|GO6OHWN02IEZTA | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300001471|JGI12712J15308_10069653 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 890 | Open in IMG/M |
| 3300001593|JGI12635J15846_10705347 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 581 | Open in IMG/M |
| 3300002568|C688J35102_120921429 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 2361 | Open in IMG/M |
| 3300002914|JGI25617J43924_10106656 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 997 | Open in IMG/M |
| 3300002914|JGI25617J43924_10318346 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 537 | Open in IMG/M |
| 3300002917|JGI25616J43925_10074627 | All Organisms → cellular organisms → Bacteria | 1428 | Open in IMG/M |
| 3300004080|Ga0062385_10198119 | All Organisms → cellular organisms → Bacteria | 1081 | Open in IMG/M |
| 3300004152|Ga0062386_100195554 | All Organisms → cellular organisms → Bacteria | 1590 | Open in IMG/M |
| 3300005167|Ga0066672_10141970 | All Organisms → cellular organisms → Bacteria | 1500 | Open in IMG/M |
| 3300005175|Ga0066673_10342839 | All Organisms → cellular organisms → Bacteria | 872 | Open in IMG/M |
| 3300005180|Ga0066685_11000347 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
| 3300005184|Ga0066671_10782288 | All Organisms → cellular organisms → Bacteria | 611 | Open in IMG/M |
| 3300005186|Ga0066676_10020383 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 3456 | Open in IMG/M |
| 3300005186|Ga0066676_11040879 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
| 3300005468|Ga0070707_101409987 | All Organisms → cellular organisms → Bacteria | 663 | Open in IMG/M |
| 3300005545|Ga0070695_101664366 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300005556|Ga0066707_10038309 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2711 | Open in IMG/M |
| 3300005586|Ga0066691_10003016 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 7031 | Open in IMG/M |
| 3300005598|Ga0066706_10844326 | All Organisms → cellular organisms → Bacteria | 718 | Open in IMG/M |
| 3300005602|Ga0070762_10370391 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 917 | Open in IMG/M |
| 3300005602|Ga0070762_11114089 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
| 3300005610|Ga0070763_10733814 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
| 3300005921|Ga0070766_10036527 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2705 | Open in IMG/M |
| 3300005993|Ga0080027_10477911 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300006163|Ga0070715_10989137 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 523 | Open in IMG/M |
| 3300006173|Ga0070716_100282582 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium | 1146 | Open in IMG/M |
| 3300006173|Ga0070716_101516305 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 548 | Open in IMG/M |
| 3300006174|Ga0075014_100333694 | All Organisms → cellular organisms → Bacteria | 809 | Open in IMG/M |
| 3300006176|Ga0070765_100782439 | All Organisms → cellular organisms → Bacteria | 902 | Open in IMG/M |
| 3300006796|Ga0066665_10112935 | All Organisms → cellular organisms → Bacteria | 2011 | Open in IMG/M |
| 3300006804|Ga0079221_11215936 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
| 3300006854|Ga0075425_103147048 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300006903|Ga0075426_11297195 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
| 3300007255|Ga0099791_10424713 | All Organisms → cellular organisms → Bacteria | 641 | Open in IMG/M |
| 3300007258|Ga0099793_10009318 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3746 | Open in IMG/M |
| 3300007265|Ga0099794_10466517 | All Organisms → cellular organisms → Bacteria | 663 | Open in IMG/M |
| 3300009012|Ga0066710_104658832 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300009038|Ga0099829_10162034 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1792 | Open in IMG/M |
| 3300009038|Ga0099829_10336749 | All Organisms → cellular organisms → Bacteria | 1241 | Open in IMG/M |
| 3300009088|Ga0099830_10715647 | All Organisms → cellular organisms → Bacteria | 825 | Open in IMG/M |
| 3300009088|Ga0099830_11499677 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
| 3300009089|Ga0099828_12031629 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300009143|Ga0099792_11041977 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300009143|Ga0099792_11088638 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
| 3300009143|Ga0099792_11152542 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 524 | Open in IMG/M |
| 3300009520|Ga0116214_1314972 | All Organisms → cellular organisms → Bacteria | 602 | Open in IMG/M |
| 3300009551|Ga0105238_11279774 | All Organisms → cellular organisms → Bacteria | 759 | Open in IMG/M |
| 3300009792|Ga0126374_11557693 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
| 3300010320|Ga0134109_10411892 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
| 3300010325|Ga0134064_10221673 | All Organisms → cellular organisms → Bacteria | 687 | Open in IMG/M |
| 3300010343|Ga0074044_11097930 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300010360|Ga0126372_11957321 | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
| 3300010361|Ga0126378_10464849 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1379 | Open in IMG/M |
| 3300010361|Ga0126378_10520399 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1305 | Open in IMG/M |
| 3300010361|Ga0126378_10804444 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1049 | Open in IMG/M |
| 3300010361|Ga0126378_12848570 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 552 | Open in IMG/M |
| 3300010373|Ga0134128_11355689 | All Organisms → cellular organisms → Bacteria | 784 | Open in IMG/M |
| 3300010379|Ga0136449_100358314 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium | 2616 | Open in IMG/M |
| 3300010379|Ga0136449_101785399 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 921 | Open in IMG/M |
| 3300010379|Ga0136449_103366549 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
| 3300010398|Ga0126383_10315411 | All Organisms → cellular organisms → Bacteria | 1569 | Open in IMG/M |
| 3300010398|Ga0126383_10577539 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1193 | Open in IMG/M |
| 3300010401|Ga0134121_13301513 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300011269|Ga0137392_10205722 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1611 | Open in IMG/M |
| 3300011269|Ga0137392_10378029 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1175 | Open in IMG/M |
| 3300012189|Ga0137388_10201334 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1794 | Open in IMG/M |
| 3300012198|Ga0137364_10415730 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1007 | Open in IMG/M |
| 3300012199|Ga0137383_10855885 | All Organisms → cellular organisms → Bacteria | 664 | Open in IMG/M |
| 3300012202|Ga0137363_10089058 | All Organisms → cellular organisms → Bacteria | 2319 | Open in IMG/M |
| 3300012202|Ga0137363_11476259 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
| 3300012203|Ga0137399_11259006 | All Organisms → cellular organisms → Bacteria | 623 | Open in IMG/M |
| 3300012203|Ga0137399_11273962 | All Organisms → cellular organisms → Bacteria | 618 | Open in IMG/M |
| 3300012205|Ga0137362_10240248 | All Organisms → cellular organisms → Bacteria | 1563 | Open in IMG/M |
| 3300012205|Ga0137362_11061830 | All Organisms → cellular organisms → Bacteria | 689 | Open in IMG/M |
| 3300012205|Ga0137362_11606411 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
| 3300012207|Ga0137381_11382046 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
| 3300012209|Ga0137379_10398887 | All Organisms → cellular organisms → Bacteria | 1285 | Open in IMG/M |
| 3300012349|Ga0137387_10122509 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1834 | Open in IMG/M |
| 3300012351|Ga0137386_10103808 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2012 | Open in IMG/M |
| 3300012361|Ga0137360_10130313 | All Organisms → cellular organisms → Bacteria | 1968 | Open in IMG/M |
| 3300012362|Ga0137361_10819351 | All Organisms → cellular organisms → Bacteria | 846 | Open in IMG/M |
| 3300012362|Ga0137361_10947686 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 779 | Open in IMG/M |
| 3300012363|Ga0137390_11611923 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
| 3300012363|Ga0137390_11730983 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
| 3300012582|Ga0137358_10300173 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1090 | Open in IMG/M |
| 3300012582|Ga0137358_10945989 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300012685|Ga0137397_10578712 | All Organisms → cellular organisms → Bacteria | 836 | Open in IMG/M |
| 3300012917|Ga0137395_10885601 | All Organisms → cellular organisms → Bacteria | 646 | Open in IMG/M |
| 3300012918|Ga0137396_10516488 | All Organisms → cellular organisms → Bacteria | 885 | Open in IMG/M |
| 3300012918|Ga0137396_11107084 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 566 | Open in IMG/M |
| 3300012922|Ga0137394_11014858 | All Organisms → cellular organisms → Bacteria | 689 | Open in IMG/M |
| 3300012922|Ga0137394_11450269 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
| 3300012924|Ga0137413_10575533 | All Organisms → cellular organisms → Bacteria | 839 | Open in IMG/M |
| 3300012924|Ga0137413_10759792 | All Organisms → cellular organisms → Bacteria | 741 | Open in IMG/M |
| 3300012925|Ga0137419_10727624 | All Organisms → cellular organisms → Bacteria | 807 | Open in IMG/M |
| 3300012925|Ga0137419_11857702 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300012929|Ga0137404_11091275 | All Organisms → cellular organisms → Bacteria | 732 | Open in IMG/M |
| 3300012929|Ga0137404_12165693 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300012930|Ga0137407_10351237 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1358 | Open in IMG/M |
| 3300012930|Ga0137407_12054169 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
| 3300012930|Ga0137407_12340325 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
| 3300012957|Ga0164303_11356672 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 529 | Open in IMG/M |
| 3300012977|Ga0134087_10641615 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
| 3300013306|Ga0163162_12546592 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
| 3300015053|Ga0137405_1130040 | All Organisms → cellular organisms → Bacteria | 838 | Open in IMG/M |
| 3300015054|Ga0137420_1001199 | All Organisms → cellular organisms → Bacteria | 1119 | Open in IMG/M |
| 3300015054|Ga0137420_1174984 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2022 | Open in IMG/M |
| 3300015242|Ga0137412_11276709 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300015245|Ga0137409_10479760 | All Organisms → cellular organisms → Bacteria | 1066 | Open in IMG/M |
| 3300015356|Ga0134073_10119857 | All Organisms → cellular organisms → Bacteria | 800 | Open in IMG/M |
| 3300015371|Ga0132258_10000863 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 49946 | Open in IMG/M |
| 3300015372|Ga0132256_102264514 | All Organisms → cellular organisms → Bacteria | 647 | Open in IMG/M |
| 3300016270|Ga0182036_11166604 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
| 3300016294|Ga0182041_10554126 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1004 | Open in IMG/M |
| 3300016404|Ga0182037_11494191 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
| 3300017654|Ga0134069_1310863 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
| 3300017955|Ga0187817_10817484 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
| 3300017995|Ga0187816_10216836 | All Organisms → cellular organisms → Bacteria | 833 | Open in IMG/M |
| 3300018006|Ga0187804_10279222 | All Organisms → cellular organisms → Bacteria | 725 | Open in IMG/M |
| 3300018006|Ga0187804_10310421 | All Organisms → cellular organisms → Bacteria | 688 | Open in IMG/M |
| 3300018023|Ga0187889_10476985 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300018058|Ga0187766_10785353 | All Organisms → cellular organisms → Bacteria | 664 | Open in IMG/M |
| 3300020170|Ga0179594_10030491 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1717 | Open in IMG/M |
| 3300020199|Ga0179592_10230774 | All Organisms → cellular organisms → Bacteria | 834 | Open in IMG/M |
| 3300020199|Ga0179592_10257041 | All Organisms → cellular organisms → Bacteria | 783 | Open in IMG/M |
| 3300020579|Ga0210407_10432186 | All Organisms → cellular organisms → Bacteria | 1030 | Open in IMG/M |
| 3300020579|Ga0210407_10504814 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 945 | Open in IMG/M |
| 3300020579|Ga0210407_10850830 | All Organisms → cellular organisms → Bacteria | 701 | Open in IMG/M |
| 3300020579|Ga0210407_10957179 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 654 | Open in IMG/M |
| 3300020580|Ga0210403_10056035 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3154 | Open in IMG/M |
| 3300020580|Ga0210403_10132774 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2030 | Open in IMG/M |
| 3300020580|Ga0210403_10584619 | All Organisms → cellular organisms → Bacteria | 903 | Open in IMG/M |
| 3300020581|Ga0210399_11426174 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 540 | Open in IMG/M |
| 3300020582|Ga0210395_10607711 | All Organisms → cellular organisms → Bacteria | 820 | Open in IMG/M |
| 3300020583|Ga0210401_11167642 | All Organisms → cellular organisms → Bacteria | 628 | Open in IMG/M |
| 3300021088|Ga0210404_10119608 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1352 | Open in IMG/M |
| 3300021168|Ga0210406_10129398 | All Organisms → cellular organisms → Bacteria | 2129 | Open in IMG/M |
| 3300021168|Ga0210406_11090170 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
| 3300021170|Ga0210400_10721720 | All Organisms → cellular organisms → Bacteria | 819 | Open in IMG/M |
| 3300021171|Ga0210405_10465019 | All Organisms → cellular organisms → Bacteria | 993 | Open in IMG/M |
| 3300021401|Ga0210393_10468987 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1028 | Open in IMG/M |
| 3300021403|Ga0210397_10401257 | All Organisms → cellular organisms → Bacteria | 1025 | Open in IMG/M |
| 3300021403|Ga0210397_11171755 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
| 3300021406|Ga0210386_11308159 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 610 | Open in IMG/M |
| 3300021432|Ga0210384_11176617 | All Organisms → cellular organisms → Bacteria | 671 | Open in IMG/M |
| 3300021474|Ga0210390_10051024 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3400 | Open in IMG/M |
| 3300021475|Ga0210392_10014284 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 4349 | Open in IMG/M |
| 3300021478|Ga0210402_10029802 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4711 | Open in IMG/M |
| 3300021478|Ga0210402_11534643 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
| 3300021559|Ga0210409_10558043 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1011 | Open in IMG/M |
| 3300021559|Ga0210409_11368554 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 584 | Open in IMG/M |
| 3300021560|Ga0126371_10706339 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1156 | Open in IMG/M |
| 3300021560|Ga0126371_11856922 | All Organisms → cellular organisms → Bacteria | 723 | Open in IMG/M |
| 3300024288|Ga0179589_10140880 | All Organisms → cellular organisms → Bacteria | 1021 | Open in IMG/M |
| 3300025446|Ga0208038_1086537 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 536 | Open in IMG/M |
| 3300025509|Ga0208848_1048501 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 907 | Open in IMG/M |
| 3300025898|Ga0207692_10823977 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
| 3300025905|Ga0207685_10452817 | All Organisms → cellular organisms → Bacteria | 668 | Open in IMG/M |
| 3300025924|Ga0207694_11898666 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300025972|Ga0207668_11325523 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
| 3300026304|Ga0209240_1006716 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4336 | Open in IMG/M |
| 3300026312|Ga0209153_1285842 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300026323|Ga0209472_1017762 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3444 | Open in IMG/M |
| 3300026323|Ga0209472_1147957 | All Organisms → cellular organisms → Bacteria | 885 | Open in IMG/M |
| 3300026475|Ga0257147_1061010 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
| 3300026515|Ga0257158_1033635 | All Organisms → cellular organisms → Bacteria | 909 | Open in IMG/M |
| 3300026532|Ga0209160_1097823 | All Organisms → cellular organisms → Bacteria | 1495 | Open in IMG/M |
| 3300026551|Ga0209648_10065486 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3070 | Open in IMG/M |
| 3300026557|Ga0179587_10034592 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2827 | Open in IMG/M |
| 3300026557|Ga0179587_10767678 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
| 3300026979|Ga0207817_1003538 | All Organisms → cellular organisms → Bacteria | 1892 | Open in IMG/M |
| 3300027565|Ga0209219_1081630 | All Organisms → cellular organisms → Bacteria | 801 | Open in IMG/M |
| 3300027574|Ga0208982_1041338 | All Organisms → cellular organisms → Bacteria | 911 | Open in IMG/M |
| 3300027604|Ga0208324_1129840 | All Organisms → cellular organisms → Bacteria | 693 | Open in IMG/M |
| 3300027643|Ga0209076_1026011 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1613 | Open in IMG/M |
| 3300027643|Ga0209076_1070439 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 994 | Open in IMG/M |
| 3300027674|Ga0209118_1139564 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 672 | Open in IMG/M |
| 3300027738|Ga0208989_10296181 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 518 | Open in IMG/M |
| 3300027812|Ga0209656_10391911 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
| 3300027842|Ga0209580_10359548 | All Organisms → cellular organisms → Bacteria | 725 | Open in IMG/M |
| 3300027846|Ga0209180_10367353 | All Organisms → cellular organisms → Bacteria | 819 | Open in IMG/M |
| 3300027855|Ga0209693_10502307 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
| 3300027875|Ga0209283_10229248 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1233 | Open in IMG/M |
| 3300027884|Ga0209275_10360403 | All Organisms → cellular organisms → Bacteria | 816 | Open in IMG/M |
| 3300028047|Ga0209526_10923666 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
| 3300028069|Ga0255358_1066670 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300028536|Ga0137415_10546574 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 967 | Open in IMG/M |
| 3300028536|Ga0137415_10854287 | All Organisms → cellular organisms → Bacteria | 720 | Open in IMG/M |
| 3300028789|Ga0302232_10218662 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 948 | Open in IMG/M |
| 3300028863|Ga0302218_10089587 | All Organisms → cellular organisms → Bacteria | 965 | Open in IMG/M |
| 3300029636|Ga0222749_10152041 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1128 | Open in IMG/M |
| 3300030659|Ga0316363_10346914 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
| 3300030693|Ga0302313_10351288 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
| 3300031128|Ga0170823_16855222 | All Organisms → cellular organisms → Bacteria | 771 | Open in IMG/M |
| 3300031231|Ga0170824_102257436 | All Organisms → cellular organisms → Bacteria | 1172 | Open in IMG/M |
| 3300031234|Ga0302325_12046817 | All Organisms → cellular organisms → Bacteria | 704 | Open in IMG/M |
| 3300031474|Ga0170818_106377996 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300031543|Ga0318516_10305061 | All Organisms → cellular organisms → Bacteria | 920 | Open in IMG/M |
| 3300031682|Ga0318560_10220953 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1015 | Open in IMG/M |
| 3300031718|Ga0307474_11630300 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 506 | Open in IMG/M |
| 3300031720|Ga0307469_11222398 | All Organisms → cellular organisms → Bacteria | 711 | Open in IMG/M |
| 3300031724|Ga0318500_10148703 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1101 | Open in IMG/M |
| 3300031740|Ga0307468_101528177 | All Organisms → cellular organisms → Bacteria | 620 | Open in IMG/M |
| 3300031744|Ga0306918_10222042 | All Organisms → cellular organisms → Bacteria | 1432 | Open in IMG/M |
| 3300031753|Ga0307477_10230971 | All Organisms → cellular organisms → Bacteria | 1283 | Open in IMG/M |
| 3300031754|Ga0307475_10213836 | All Organisms → cellular organisms → Bacteria | 1542 | Open in IMG/M |
| 3300031754|Ga0307475_10571906 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 906 | Open in IMG/M |
| 3300031754|Ga0307475_10579435 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 899 | Open in IMG/M |
| 3300031754|Ga0307475_10858311 | All Organisms → cellular organisms → Bacteria | 718 | Open in IMG/M |
| 3300031754|Ga0307475_10993356 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 660 | Open in IMG/M |
| 3300031754|Ga0307475_11199270 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
| 3300031754|Ga0307475_11543715 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 508 | Open in IMG/M |
| 3300031771|Ga0318546_10779352 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
| 3300031781|Ga0318547_10131392 | All Organisms → cellular organisms → Bacteria | 1459 | Open in IMG/M |
| 3300031781|Ga0318547_10424903 | All Organisms → cellular organisms → Bacteria | 817 | Open in IMG/M |
| 3300031820|Ga0307473_10589651 | All Organisms → cellular organisms → Bacteria | 765 | Open in IMG/M |
| 3300031820|Ga0307473_10975401 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
| 3300031823|Ga0307478_10881919 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 749 | Open in IMG/M |
| 3300031823|Ga0307478_11071652 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
| 3300031823|Ga0307478_11475200 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 563 | Open in IMG/M |
| 3300031879|Ga0306919_10513848 | All Organisms → cellular organisms → Bacteria | 923 | Open in IMG/M |
| 3300031879|Ga0306919_11354411 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
| 3300031893|Ga0318536_10513402 | All Organisms → cellular organisms → Bacteria | 602 | Open in IMG/M |
| 3300031896|Ga0318551_10473571 | All Organisms → cellular organisms → Bacteria | 717 | Open in IMG/M |
| 3300031912|Ga0306921_10485691 | All Organisms → cellular organisms → Bacteria | 1437 | Open in IMG/M |
| 3300031912|Ga0306921_12649671 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300031941|Ga0310912_10721703 | All Organisms → cellular organisms → Bacteria | 772 | Open in IMG/M |
| 3300031941|Ga0310912_11446416 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300031942|Ga0310916_10750063 | All Organisms → cellular organisms → Bacteria | 824 | Open in IMG/M |
| 3300031954|Ga0306926_12461970 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
| 3300031962|Ga0307479_10641900 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1042 | Open in IMG/M |
| 3300032001|Ga0306922_10047120 | All Organisms → cellular organisms → Bacteria | 4450 | Open in IMG/M |
| 3300032039|Ga0318559_10406720 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
| 3300032041|Ga0318549_10235344 | All Organisms → cellular organisms → Bacteria | 824 | Open in IMG/M |
| 3300032042|Ga0318545_10009768 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2869 | Open in IMG/M |
| 3300032076|Ga0306924_11361234 | All Organisms → cellular organisms → Bacteria | 759 | Open in IMG/M |
| 3300032090|Ga0318518_10510920 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
| 3300032160|Ga0311301_12798855 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300032174|Ga0307470_10835292 | All Organisms → cellular organisms → Bacteria | 717 | Open in IMG/M |
| 3300032180|Ga0307471_100478335 | All Organisms → cellular organisms → Bacteria | 1390 | Open in IMG/M |
| 3300032180|Ga0307471_103248464 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
| 3300032205|Ga0307472_100494200 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1053 | Open in IMG/M |
| 3300032261|Ga0306920_102017598 | All Organisms → cellular organisms → Bacteria | 808 | Open in IMG/M |
| 3300032782|Ga0335082_10456290 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1141 | Open in IMG/M |
| 3300032805|Ga0335078_12423535 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
| 3300032829|Ga0335070_10464835 | All Organisms → cellular organisms → Bacteria | 1202 | Open in IMG/M |
| 3300032898|Ga0335072_11071436 | All Organisms → cellular organisms → Bacteria | 731 | Open in IMG/M |
| 3300033134|Ga0335073_10327605 | All Organisms → cellular organisms → Bacteria | 1825 | Open in IMG/M |
| 3300033289|Ga0310914_10420950 | All Organisms → cellular organisms → Bacteria | 1209 | Open in IMG/M |
| 3300033412|Ga0310810_11129703 | All Organisms → cellular organisms → Bacteria | 647 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 26.29% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 17.93% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 8.37% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.18% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.78% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.98% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 2.79% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.79% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.79% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.79% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.39% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.59% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.59% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.20% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.20% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.99% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.99% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.80% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.80% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.80% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.80% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.80% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.40% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.40% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.40% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.40% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.40% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.40% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.40% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.40% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.40% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.40% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.40% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.40% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.40% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.40% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.40% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.40% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459013 | Grass soil microbial communities from Rothamsted Park, UK - July 2010 direct MP BIO 1O1 lysis soil at the rocks surface 0-21cm | Environmental | Open in IMG/M |
| 3300001471 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300002914 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm | Environmental | Open in IMG/M |
| 3300002917 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_100cm | Environmental | Open in IMG/M |
| 3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300005993 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015356 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300017654 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300018023 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_100 | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300025446 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_100 (SPAdes) | Environmental | Open in IMG/M |
| 3300025509 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-1 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026312 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 (SPAdes) | Environmental | Open in IMG/M |
| 3300026323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 (SPAdes) | Environmental | Open in IMG/M |
| 3300026475 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-12-A | Environmental | Open in IMG/M |
| 3300026515 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-03-A | Environmental | Open in IMG/M |
| 3300026532 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 (SPAdes) | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300026979 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 13 (SPAdes) | Environmental | Open in IMG/M |
| 3300027565 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027574 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027604 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027643 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027674 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027738 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028069 | Peat soil microbial communities from Stordalen Mire, Sweden - G.F.S.T0 | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028789 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_3 | Environmental | Open in IMG/M |
| 3300028863 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_1 | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030659 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG (v2) | Environmental | Open in IMG/M |
| 3300030693 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N2_2 | Environmental | Open in IMG/M |
| 3300031128 | Oak Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
| 3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
| 3300032041 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22 | Environmental | Open in IMG/M |
| 3300032042 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
| 3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
| 3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| N57_05163550 | 2170459013 | Grass Soil | PDCDAQRSLQFLLQRVDEFVGVTKQFDDITCLVLRCE |
| JGI12712J15308_100696532 | 3300001471 | Forest Soil | IRALPDWGAQESLQFLMKRVDDFVGLTRQSDDITCLVVRAK* |
| JGI12635J15846_107053472 | 3300001593 | Forest Soil | FGNERWLGAIRNLPDWDAQQTLQFLMKRVDEFAGATRQSDDITCLVFRSR* |
| C688J35102_1209214291 | 3300002568 | Soil | VRSLPQGSAQQCLEYLMWQLDVFVGATRQSDDITCLVFRCK* |
| JGI25617J43924_101066562 | 3300002914 | Grasslands Soil | NLPDWDAQQSLKFLMKRVDEFVGATRESDDITCLVFRSR* |
| JGI25617J43924_103183461 | 3300002914 | Grasslands Soil | GNERWLSAIRNLPDWDAQQSLQFLMKHVDEFVGVTRQSDDITCLVFRSK* |
| JGI25616J43925_100746272 | 3300002917 | Grasslands Soil | DARWLAAIRGLPEVTAQESLQYLMTRVDAFVGVTRQADDITCMIFRCKRSA* |
| Ga0062385_101981191 | 3300004080 | Bog Forest Soil | IRELPDFSAQESLQYLMKRVDEFAGATRQSDDITCMVFRSK* |
| Ga0062386_1001955541 | 3300004152 | Bog Forest Soil | EFTDARWLGLIRDLPSLPAQATLQYLMQQVGQFVGATRQSDDITCLVLRCN* |
| Ga0066672_101419702 | 3300005167 | Soil | FGNERWLGAIRSLPDWDASQTLQFLMKRVDEFVGATRQSDDITCLVFRSR* |
| Ga0066673_103428392 | 3300005175 | Soil | SRWQGAIRSLPDWSSQETLQFLMKRVDEFVGATRQSDDITCLVFRCK* |
| Ga0066685_110003472 | 3300005180 | Soil | WLGAIRSLPDWDASQTLQFLMKRVDEFVGATRQSDDITCLVFRSR* |
| Ga0066671_107822881 | 3300005184 | Soil | FTDARWIAAIRSLPEFDAQTSLHLLMQRVDEFVGTTRQSDDITCLVLCRE* |
| Ga0066676_100203833 | 3300005186 | Soil | IRSLPDWDASETLQFLMKRVDEFVGATRQSDDITCLVFCSR* |
| Ga0066676_110408792 | 3300005186 | Soil | EFGNERWNGAIRNLPDWGAQQTLQHLMKQVDEFVRATRQSDDITCLVFRSR* |
| Ga0070707_1014099872 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | NLPDWDAQRSLQLLMQRVDEFVGATRQSDDITCLVLRCE* |
| Ga0070695_1016643662 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | IRALPDWGAQESLEFLMKPVDAFVGFTRQSDDITCLVFRCK* |
| Ga0066707_100383091 | 3300005556 | Soil | RNLPDWDAQQTLQLLMKRVDEFVGVTRQSDDITCLVFRSRAETL* |
| Ga0066691_100030161 | 3300005586 | Soil | NAIRSLPDWDASETLQFLMKRVDEFVGATRQSDDITCLVFRSR* |
| Ga0066706_108443261 | 3300005598 | Soil | LPDWDASQTLQFLMKRVDEFVGATRQSDDITCLVFRSR* |
| Ga0070762_103703912 | 3300005602 | Soil | WGAAESLQFLIKRVDDFVGLTRQSDDITCLVFRTK* |
| Ga0070762_111140892 | 3300005602 | Soil | EAIRALPDWGAAESLQFLMSRVDDFVGTTRQSDDITCLVVRTK* |
| Ga0070763_107338142 | 3300005610 | Soil | PDSNAQQTLEFLMKRVDEFVGATRQSDDITCLVFRSR* |
| Ga0070766_100365273 | 3300005921 | Soil | SAIRGLPEINAEETLRSLMQQVDGFVGATRQSDDITCLIFRSVR* |
| Ga0080027_104779112 | 3300005993 | Prmafrost Soil | GLPMFNAQESLQFLMKPVDQFVGATHQSDDITYLILRCK* |
| Ga0070715_109891372 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | IRALPMMNAQESLQFLMNPVDEFVGATRQADDITCLVFRSK* |
| Ga0070716_1002825821 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | EEFGNDRWSSVIRALPMMNAQESLQFLMKPVDEFVGATRQSDDITYLVFRSK* |
| Ga0070716_1015163052 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | ERWLAAIRALPEVTAQESLHFLMMRVDAFVGVTRQSDDITCMIFRAKRPA* |
| Ga0075014_1003336942 | 3300006174 | Watersheds | GEPRWIEAIRVLPDWNATESLQFLMKRVDEFVGATRQSDDITCLVFRCK* |
| Ga0070765_1007824392 | 3300006176 | Soil | TAQESLHYLMRHVDEFVGATRQADDITCMIFRCK* |
| Ga0066665_101129351 | 3300006796 | Soil | LPQADAPSMLRHLMQRVDEFVGRTRQSDDITCLVLRVRS* |
| Ga0079221_112159361 | 3300006804 | Agricultural Soil | EEFGNTRWLEAVRALPDWDAAESLKFLMKRVDDFVRATRQSDDITCLVLRCK* |
| Ga0075425_1031470481 | 3300006854 | Populus Rhizosphere | RNLPDWDAQRSLQFLMQRVDEFVGTTRQFDDITCLILRCE* |
| Ga0075426_112971951 | 3300006903 | Populus Rhizosphere | DWNAQEALQFLMKRVDEFVGATRQADDITCLVFRSK* |
| Ga0099791_104247132 | 3300007255 | Vadose Zone Soil | FNETSEEFGNERWNGAIRNLPDWNAHQTLQHLMKKVDEFVGATRQSDDITCLVFRSR* |
| Ga0099793_100093183 | 3300007258 | Vadose Zone Soil | WDAQQTLQFLMKRVDEFVGATRQSDDITCLVFRSK* |
| Ga0099794_104665172 | 3300007265 | Vadose Zone Soil | DWNAQQTLQHLMKKVDEFVRATRQSDDITCLVFRSR* |
| Ga0066710_1046588321 | 3300009012 | Grasslands Soil | LNAIRSLPDWDASETLQFLMKRVDEFVGATRQSDDITCLVFRSR |
| Ga0099829_101620341 | 3300009038 | Vadose Zone Soil | ERWLGAIRNLPDWDAQQTLQLLMKQVDEFVGATRQSDDITCLVFRSR* |
| Ga0099829_103367491 | 3300009038 | Vadose Zone Soil | LPEVSAQDSLQFLMTSVDAFVGATRQSDDITCMIFRAKRTA* |
| Ga0099830_107156471 | 3300009088 | Vadose Zone Soil | AIRNLPDWDAQQTLQFLMKRVDEFVGATRQSDDITCLVFRSK* |
| Ga0099830_114996772 | 3300009088 | Vadose Zone Soil | ERWLSAIRNLPDWDAQQTLQFLMKRVDEFAGATRQSDDITCLVFRSR* |
| Ga0099828_120316292 | 3300009089 | Vadose Zone Soil | FGNERWLGAIRNLPDWKAQETLQYLMKRVDEFVGATRQSDDITCMVFRSR* |
| Ga0099792_110419771 | 3300009143 | Vadose Zone Soil | DWDASQTLQFLMKRVDEFAGATRQSDDITCMVFRSR* |
| Ga0099792_110886382 | 3300009143 | Vadose Zone Soil | RGLPDWDASQTLQFLMKRVDEFVGATRQSDDITCLVFRSR* |
| Ga0099792_111525422 | 3300009143 | Vadose Zone Soil | AVRALPAVTAQESLQFLMTRVDAFVGATRQSDDITCMIFRCSRPA* |
| Ga0116214_13149722 | 3300009520 | Peatlands Soil | VRVLPDWGAAESLQFLMKRVDEFVGLTRQSDDITCLVFRIK* |
| Ga0105238_112797741 | 3300009551 | Corn Rhizosphere | RWLNAIRNLPAGTAGQSLQFLMRQVDDFVGATRQSDDITCLVFQRK* |
| Ga0126374_115576932 | 3300009792 | Tropical Forest Soil | WVLAIRNLPDWDAERSLEFLLQRVDEFVGATRQFDDITCLVLRCE* |
| Ga0134109_104118921 | 3300010320 | Grasslands Soil | SLPDWNSQETLQFLMKRVDEFVGATRQSDDITCLVFRCK* |
| Ga0134064_102216731 | 3300010325 | Grasslands Soil | AIRDLPDWDAQQTLQFLIKRVDEFVGATRQSEDITCLVFRSK* |
| Ga0074044_110979302 | 3300010343 | Bog Forest Soil | DLPDLSAQATLQYLMQQVGQFVGATRQSDDITCLVLRCK* |
| Ga0126372_119573211 | 3300010360 | Tropical Forest Soil | LVSCVLSLQEQTAQQSMQFLMQQVDTFVGATRQFDDITCLVLRCN* |
| Ga0126378_104648491 | 3300010361 | Tropical Forest Soil | ESGQDFGNDRWVGAIRVLLDWSAQETLQFLMKRVDEFVGATRQSDDITCLVFRSK* |
| Ga0126378_105203991 | 3300010361 | Tropical Forest Soil | DEVRRLPDWDAQRSLQFLMQRVDEFVGATKQSDDITCLVLRCE* |
| Ga0126378_108044441 | 3300010361 | Tropical Forest Soil | SGEEFGNSRWQGAIRSLLEWNAQETLQFLMKRVDEFVGATRQSDDITCLVFRSK* |
| Ga0126378_128485701 | 3300010361 | Tropical Forest Soil | FNASGEEFGNERWLQTIRGLPDWNGHLCLKYLMERVDQFVGATRQADDITCMVFRSK* |
| Ga0134128_113556892 | 3300010373 | Terrestrial Soil | GAQESLEFLMKPVDAFVGFTRQSDDITCLVFRCK* |
| Ga0136449_1003583141 | 3300010379 | Peatlands Soil | SAIRNLPDWNAQKTLNYLMKKVDDFVGATRQSDDITCLVFRSR* |
| Ga0136449_1017853991 | 3300010379 | Peatlands Soil | SDARWLNLVRNLPAISAKESLEFLMMSVETFVGPTRQSDDITCLVLRCK* |
| Ga0136449_1033665491 | 3300010379 | Peatlands Soil | LPDWDAQQSLQFLMKRVDEFVGATRQSDDITCLVFRSK* |
| Ga0126383_103154112 | 3300010398 | Tropical Forest Soil | EEFGNSRWQGAIRSLPDWNAQETLQFLMQRVDEFVGATRQSDDITCLVFRSK* |
| Ga0126383_105775391 | 3300010398 | Tropical Forest Soil | DARLVDEVRRLPDWDAQRSLQLLMQRVDEFVGATKQSDDITCLVLRCE* |
| Ga0134121_133015132 | 3300010401 | Terrestrial Soil | PDWGAQESLEFLMKPVDAFVGFTRQSDDITCLVFRCK* |
| Ga0137392_102057221 | 3300011269 | Vadose Zone Soil | QEFTDAQWIAAIHALPDWDAPRSLQFLLQRVDEFVGVTKQFDDITCLVLRCE* |
| Ga0137392_103780292 | 3300011269 | Vadose Zone Soil | WLSAIRSLPDWDASQTLQFLMKRVDEFVGATRQSDDITCMVFRSR* |
| Ga0137388_102013342 | 3300012189 | Vadose Zone Soil | FGNERWNGAIRNLPDWNAQQTLQHLMKTVDEFVRATRQSDDITCLVFRSR* |
| Ga0137364_104157302 | 3300012198 | Vadose Zone Soil | RDLPDWDAQQTLQFLIKRVDEFVGTTRQSDDITCLVFRSK* |
| Ga0137383_108558851 | 3300012199 | Vadose Zone Soil | KGEEFSDARWINAIRNLPDWDAQRSLQVLLQRVDEFVGVTRQFDDITCLVLRCE* |
| Ga0137363_100890584 | 3300012202 | Vadose Zone Soil | SAGEEFSDNHWLNIIRGLPNLNAQQTLQFLMKSVEDFVGATRQSDDITCLVLCCS* |
| Ga0137363_114762592 | 3300012202 | Vadose Zone Soil | WLNIIRGLPNLNAQQTLQFLMKSVEDFVGATRQSDDITCLVLRCI* |
| Ga0137399_112590062 | 3300012203 | Vadose Zone Soil | LNIIRGLPNLNAQQTLQFLMKSVEDFVGATRQSDDITCLVLRCL* |
| Ga0137399_112739622 | 3300012203 | Vadose Zone Soil | AESLQFLMTRVDAFVGVTRQSDDITCMIFRAKRPA* |
| Ga0137362_102402482 | 3300012205 | Vadose Zone Soil | NERWLAAIRALPAVGAAESLQFLMTRVDAFVGVTRQSDDITCMIFRAKRPA* |
| Ga0137362_110618302 | 3300012205 | Vadose Zone Soil | WLNIIRGLPNLNAQQTLQFLMKSVEDFVGATRQSDDITCLVLRCN* |
| Ga0137362_116064112 | 3300012205 | Vadose Zone Soil | RELPEVSAQESLQFLMTSVDAFVGATRQSDDITCMIFRAKRST* |
| Ga0137381_113820461 | 3300012207 | Vadose Zone Soil | GNSRWLGAIRSLPDWNAQETLQFLMKRVDEFVGATRQSDDITCLVFRSK* |
| Ga0137379_103988871 | 3300012209 | Vadose Zone Soil | IRGLPQADAPSMLRHLMQRVDEFVGRTRQSDDITCLVLRVRS* |
| Ga0137387_101225091 | 3300012349 | Vadose Zone Soil | SAIRDLPDWDAQQTLQFLIKRVDEFVGATRQSDDITCLVFRSK* |
| Ga0137386_101038083 | 3300012351 | Vadose Zone Soil | FAAIRALPQADAPSMLRHLMQRVDEFVGRTRQSDDITCLVLRVKS* |
| Ga0137360_101303133 | 3300012361 | Vadose Zone Soil | EFGNERWNGAIRNLPDWNAHQTLQHLMKKVDEFVGATRQSDDITCLVFRSR* |
| Ga0137361_108193512 | 3300012362 | Vadose Zone Soil | RNLPDWDAQQTLHFLMKQVDEFVGATRQSDDITCLVFRSR* |
| Ga0137361_109476862 | 3300012362 | Vadose Zone Soil | LAAIRGLPEVSAQESLQFLMTRVDAFVGATRQSDDITCMIFRAKRST* |
| Ga0137390_116119232 | 3300012363 | Vadose Zone Soil | DWDAQQTLHFLMKQVDEFVGATRQSDDITCLVFRSK* |
| Ga0137390_117309832 | 3300012363 | Vadose Zone Soil | LSAIRNLPDWDAQQTLQVLMKQVDEFVGATRQSDDITCLVFRSR* |
| Ga0137358_103001732 | 3300012582 | Vadose Zone Soil | GAIRNLPHWSAEETLQHLMKKVDEFVGATRQSDDITCLVFRTR* |
| Ga0137358_109459892 | 3300012582 | Vadose Zone Soil | AIRNLPDWDAQRSLQFLLQRVDEFVGVTRQFDDITCLVLRCE* |
| Ga0137397_105787121 | 3300012685 | Vadose Zone Soil | NAQQSLQFLMQRVDEFVGATRQSDDITCLILRCE* |
| Ga0137395_108856011 | 3300012917 | Vadose Zone Soil | SAIRNLPDWDASQTLQFLMKRVDEFVGATRQSDDITCLVFRSR* |
| Ga0137396_105164882 | 3300012918 | Vadose Zone Soil | LSAIRSLPDWDASQTLQFLMSRVDEFVGATRQSDDITCLVFRSR* |
| Ga0137396_111070841 | 3300012918 | Vadose Zone Soil | ERWLAAIRALPEVSAQESLQFLMTRVDAFVGATRQSDDITCMIFRCSRPA* |
| Ga0137394_110148581 | 3300012922 | Vadose Zone Soil | AESLHFLMTRVDAFVGVTRQSDDITCMIFRAKRPA* |
| Ga0137394_114502691 | 3300012922 | Vadose Zone Soil | NAHQTLQHLMKKVDEFVRATRQSDDITCLVFRSS* |
| Ga0137413_105755332 | 3300012924 | Vadose Zone Soil | DWNAQQSLQFLVQRVDEFVGATRQSDDITCLILRCE* |
| Ga0137413_107597921 | 3300012924 | Vadose Zone Soil | IAAIHALPDWDAPRSLQFLLQRVDEFVGVTKQFDDITCLVLRCE* |
| Ga0137419_107276241 | 3300012925 | Vadose Zone Soil | AIRSLPDWDASQTLQFLMSRVDEFVGATRQSDDITCLVFRSR* |
| Ga0137419_118577021 | 3300012925 | Vadose Zone Soil | NAQQTLQFLMKSVEDFVGATRQSDDITCLVLRCD* |
| Ga0137404_110912752 | 3300012929 | Vadose Zone Soil | WLSAIRSLPDWDASQTLQFLMSRVDEFVGATRQSDDITCLVFRSR* |
| Ga0137404_121656932 | 3300012929 | Vadose Zone Soil | EFSDNRWLNIIRGLPDLNAQQTLQFLMKSVEDFVGATRQSDDITCLVLRCF* |
| Ga0137407_103512372 | 3300012930 | Vadose Zone Soil | WISAIRNLPDWDAQQTLQYLMKQVDEFVGATRQSDDITCLVFRSK* |
| Ga0137407_120541692 | 3300012930 | Vadose Zone Soil | EFGNERWNGAIRSLPDWDAQQTLQHLMKQVDEFVRATRQSDDITCLVFRSR* |
| Ga0137407_123403252 | 3300012930 | Vadose Zone Soil | FNEAGEEFGNERWNGAIRNLPDWNAHQTLQHLMKKVDEFVGATRQSDDITCLVFRSR* |
| Ga0164303_113566722 | 3300012957 | Soil | DGIRALPDWGASESLQFLMKRVDDFVGFTRQSDDITCLVLRCGQG* |
| Ga0134087_106416151 | 3300012977 | Grasslands Soil | IRSLPDWDASQTLQFLMKRVDEFVGATRQSDDITCLVFRSR* |
| Ga0163162_125465921 | 3300013306 | Switchgrass Rhizosphere | DVVRHLPDWEAQRSLQFLMQRVDEFVGATKQFDDITCLVVRCE* |
| Ga0137405_11300401 | 3300015053 | Vadose Zone Soil | NVRWLSSIRNLPDWDAQQTLQFLMKRVDEFVGATRQSDDITCLVFRSK* |
| Ga0137420_10011992 | 3300015054 | Vadose Zone Soil | LAAIRTLPEVTAQESLHFLMTRVDAFVGVTRQSDDITCMIFRAKRPA* |
| Ga0137420_11749843 | 3300015054 | Vadose Zone Soil | DWDAQQTLQLLMKQVDEFVGATRQSDDITCLVFRSR* |
| Ga0137412_112767092 | 3300015242 | Vadose Zone Soil | PDWDASQTLQFLMKRVDEFVGATRQSDDVTCLVFRSR* |
| Ga0137409_104797602 | 3300015245 | Vadose Zone Soil | MISSLFFGNLPNISAQQTLQFLMKRVDDFVGVTRQSDDITCLIFRSI* |
| Ga0134073_101198572 | 3300015356 | Grasslands Soil | DWSSQETLQFLMKRVDEFVGATRQSDDITCLVFRCK* |
| Ga0132258_100008631 | 3300015371 | Arabidopsis Rhizosphere | HLPDWEAQRSLQFLMQRVDEFVGATKQFDDITCLVLRCE* |
| Ga0132256_1022645141 | 3300015372 | Arabidopsis Rhizosphere | TDARWVDVVRHLPDWEAQRSLQFLMQRVDEFVGATKQFDDITCLVVRCE* |
| Ga0182036_111666042 | 3300016270 | Soil | DPRWINVIRGLPNLNAQQTLQFLMKSVEEFVGATRQSDDITCLVLRCS |
| Ga0182041_105541261 | 3300016294 | Soil | DGRWLNVIRSLPNLSAEDSLRYLMKSVEEFAGATRQSDDITCLVLRTK |
| Ga0182037_114941912 | 3300016404 | Soil | LEIRNLPDGDAQRSLEFLLQRVDEFVGATRQFDDITCLVLRCE |
| Ga0134069_13108631 | 3300017654 | Grasslands Soil | NERWLSAIRNLPDWNAQQTLEFLMKRVDEFVGATRQSDDITCMVFRSR |
| Ga0187817_108174841 | 3300017955 | Freshwater Sediment | LPKLSAQESLRTLMKSVEDFVGTTRQSDDITCLVLQTK |
| Ga0187816_102168361 | 3300017995 | Freshwater Sediment | DRWLGAIRNLPDWKAQDSMQYLMKRVDDFVGATRQSDDITCFVFRSR |
| Ga0187804_102792221 | 3300018006 | Freshwater Sediment | NLPDWKAQDSMQYLMKRVDDFVGATRQSDDITCLVFRSR |
| Ga0187804_103104212 | 3300018006 | Freshwater Sediment | DARWLNLVRNLPTIPAKESLQFLMMSVENFVGQTRQSDDITCLVLRCK |
| Ga0187889_104769852 | 3300018023 | Peatland | IRDLPNLPAQATMQYLMQQVGQFVGATRQSDDITCLVLRCK |
| Ga0187766_107853532 | 3300018058 | Tropical Peatland | LSAQGSLEYLLQSVEDFVGATRQSDDITCLVLQVQ |
| Ga0179594_100304911 | 3300020170 | Vadose Zone Soil | GEEFGNARWLSAIRDLPDWDAQQTLQFLMKRVDEFVGATRQSDDITCLVFRSK |
| Ga0179592_102307742 | 3300020199 | Vadose Zone Soil | SLQSHTAQQSMQFLMQQVDSFVGATHQFDDITCLVLRCQ |
| Ga0179592_102570411 | 3300020199 | Vadose Zone Soil | GLPNLNAQQTLQFLMKSVEDFVGATRQSDDITCLVLRCI |
| Ga0210407_104321862 | 3300020579 | Soil | RGLPNLNAQQTLQFLMKSVEDFVGATRQSDDITCLVLRCS |
| Ga0210407_105048142 | 3300020579 | Soil | RNLPDWDAQLSLQFLMQRVDEFVGATRQSDDITCLILRCE |
| Ga0210407_108508303 | 3300020579 | Soil | ERWISAIRNLPDWDAQQTLQYLMKQVDEFVGATRQSDDITCLVFRSK |
| Ga0210407_109571792 | 3300020579 | Soil | EEFVNRRWLTAIRGLPAYTAQESLQHLMKGVDEFVGATRQSDDITCMIFRSR |
| Ga0210403_100560351 | 3300020580 | Soil | ESGQECGDGRWLAAIRGLPEISAQESLQFLMTTVDAFVGATRQSDDITCMIFRAKST |
| Ga0210403_101327743 | 3300020580 | Soil | NRWLNIIRGLPNLDAQQTLQFLMKSVQDFVGATRQSDDITCLVLRCN |
| Ga0210403_105846191 | 3300020580 | Soil | LPDWNAQESLQFLMKRVDDFVGFTRQSDDITCLVFRAVA |
| Ga0210399_114261742 | 3300020581 | Soil | WRAAIRNLPEISAQESLQFLMTTVDAFVGATRQSDDITCMIFRAKRSQ |
| Ga0210395_106077111 | 3300020582 | Soil | LPDWNAAESLQFLMKRVDDFVGLTRQSDDITCLVIRTK |
| Ga0210401_111676421 | 3300020583 | Soil | NLNAQQTLQFLMKSVEDFVGATRQSDDITCLVLRCS |
| Ga0210404_101196082 | 3300021088 | Soil | DWDAQQTLQFLMKRVDEFAGATRQSDDITCLVFRSR |
| Ga0210406_101293981 | 3300021168 | Soil | ERWLSAIRNLPDWNAQETLNYLMKKVDEYVGATRQSDDITCLVFRSR |
| Ga0210406_110901702 | 3300021168 | Soil | LEAIGALPATGAAAALQHLMSRVDVFVGATRQSDDITCMVFRST |
| Ga0210400_107217201 | 3300021170 | Soil | PNLNAQQTLQFLMKSVEDFVGATRQSDDITCLVLRCN |
| Ga0210405_104650191 | 3300021171 | Soil | DWDAQQTLQFLMKRVDEFTGATRQSDDITCLVFRCK |
| Ga0210393_104689871 | 3300021401 | Soil | DAIRALPDWGAQESLQFLMKRVDDFVGLTRQSDDITCLVVRAK |
| Ga0210397_104012572 | 3300021403 | Soil | NVIRSMPVVPASETLKYLMASVSDFVGATHQSDDITCLVLRCK |
| Ga0210397_111717552 | 3300021403 | Soil | IRALPDVTAQQSLQFLMTRVDAFVGVTRQSDDITCMIFRCNRA |
| Ga0210386_113081591 | 3300021406 | Soil | AIRNLPEISAQESLQFLMTTVDAFVGATRQSDDITCMIFRAKRTA |
| Ga0210384_111766171 | 3300021432 | Soil | AAIRALPNGTAQESLHYLMRNVDQFVGATRQADDITCMIFRRG |
| Ga0210390_100510241 | 3300021474 | Soil | IEAIRALPDWGAAESLQFLMKRVDDFVGLTRQSDDITCLVFRTK |
| Ga0210392_100142844 | 3300021475 | Soil | WLNIIRGLPNLNAQQTLQFLMKSVEDFVGATRQSDDITCLVLRCN |
| Ga0210402_100298024 | 3300021478 | Soil | EEFSDNRWLNIIRGLPTLNAQQTLQYLMKSVEDFVGATRQSDDITCLVLRCS |
| Ga0210402_115346432 | 3300021478 | Soil | LPDWKAAESLQFLMKRVDEFVGMTRQSDDITCLVFRTN |
| Ga0210409_105580433 | 3300021559 | Soil | AVRNLPDWDAQQTLQFLMKRVDEFTGATRQSDDITCLVFRCK |
| Ga0210409_113685541 | 3300021559 | Soil | AQESLQFLMTTVDAFVGATRQSDDITCMIFRAKRPE |
| Ga0126371_107063391 | 3300021560 | Tropical Forest Soil | LPAVTAQESFQYLMRRVDEFVGATRQSDDITCMVLRSK |
| Ga0126371_118569222 | 3300021560 | Tropical Forest Soil | AGEEFSDPRWIHAIRSLPNLPAQGTLETLMKYVHDFAGATRQSDDITCLVLQIK |
| Ga0179589_101408802 | 3300024288 | Vadose Zone Soil | NLNAQQTLQFLMKSVEDFVGATRQSDDITCLVLRCI |
| Ga0208038_10865372 | 3300025446 | Peatland | GEDRWLEAIRALPNWNAQDSLQFLMKLADDYVGVTRQFDDITCLVLRGK |
| Ga0208848_10485011 | 3300025509 | Arctic Peat Soil | EFGNERWFNVIRALPMFNAQDSLQFLMKPVDQFVGATHQSDDITYLILRCK |
| Ga0207692_108239772 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | AAIRNLPDWDAQLSLQFLMQRVDEFVGATRQSDDITCLVLRCE |
| Ga0207685_104528172 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | KSLQGQNAQQSMQFLMQQVDSFVGATHQFDDITCLVLRCQ |
| Ga0207694_118986662 | 3300025924 | Corn Rhizosphere | RWLNAIRNLPAGTAGQSLQFLMRQVDDFVGATRQSDDITCLVFQRK |
| Ga0207668_113255231 | 3300025972 | Switchgrass Rhizosphere | LPQGSAQHSLEYLMWQLDVFVGATRQSDDITCLVFRCK |
| Ga0209240_10067161 | 3300026304 | Grasslands Soil | SLQSQTAQQSMQFLMQQVDSFVGATHQFDDITCLVLRCQ |
| Ga0209153_12858421 | 3300026312 | Soil | FTDARWIAAIRSLPEFDAQTSLHLLMQRVDEFVGTTRQSDDITCLVLCRE |
| Ga0209472_10177623 | 3300026323 | Soil | SLPDWDASQTLQFLMKRVDEFVGATRQSDDITCLVFRSR |
| Ga0209472_11479571 | 3300026323 | Soil | RWLNAMRNLPDWDAQQTLQFLMKRVDEFVGATRQSDDITCLVFRSRAETL |
| Ga0257147_10610102 | 3300026475 | Soil | EFTDAQWIAAIHALPDWDAPRSLQFLLQRVDEFVGVTKQFDDITCLVLRCE |
| Ga0257158_10336351 | 3300026515 | Soil | DAIRALPEWNAQQSLQFLMKRVDDYVGFTRQSDDITCLVFRTK |
| Ga0209160_10978232 | 3300026532 | Soil | AIRSLPDWDASQTLQFLMKRVDEFVGATRQSDDITCLVFRTR |
| Ga0209648_100654861 | 3300026551 | Grasslands Soil | NLPDWDAQQSLKFLMKRVDEFVGATRESDDITCLVFRSR |
| Ga0179587_100345921 | 3300026557 | Vadose Zone Soil | EFGNARWLSAIRNLPDWDAQQTLQFLMKRVDEFVGATRQSDDITCLVFRSK |
| Ga0179587_107676782 | 3300026557 | Vadose Zone Soil | SDNRWLNIIRGLPNLNAQQTLQFLMKSVEDFVGATRQSDDITCLVLRCI |
| Ga0207817_10035381 | 3300026979 | Tropical Forest Soil | SLPNLSAADSLRYLMKSVEQFVGATRQSDDITCLVLRTK |
| Ga0209219_10816301 | 3300027565 | Forest Soil | IRSLPDVTAQQSLQVLMTRVDAFAGVTRQSDDITCMIFRCNRA |
| Ga0208982_10413382 | 3300027574 | Forest Soil | EEYGNGRWLNAIRNLPPGAASQSLQFLMRGVDEFVGATHQSDDITCLVFQCK |
| Ga0208324_11298401 | 3300027604 | Peatlands Soil | NLPAQATMQYLMQQVEQFVGATRQSDDITCLVLRCK |
| Ga0209076_10260111 | 3300027643 | Vadose Zone Soil | WDAQQTLQFLMKRVDEFVGATRQSDDITCLVFRSK |
| Ga0209076_10704391 | 3300027643 | Vadose Zone Soil | LPDWDAQQTLQHLMKKVDEFVRATRQSDDITCLVFRSR |
| Ga0209118_11395641 | 3300027674 | Forest Soil | ISAQESLQFLMTRVDAFAGATRQSDDITCMIFRCQRTA |
| Ga0208989_102961811 | 3300027738 | Forest Soil | GGDRWSSVIRALPMLNAQESLQFLMKPVDEFVGATRQSDDITYLVFRSK |
| Ga0209656_103919111 | 3300027812 | Bog Forest Soil | VSAEESLRGLMRQVDAFVGTTRQSDDITCLIFRASRQ |
| Ga0209580_103595481 | 3300027842 | Surface Soil | GAIRELPDWSAQETLQFLMKRVDEFVGATRQADDITCLVFRSK |
| Ga0209180_103673532 | 3300027846 | Vadose Zone Soil | IRNLPEWNAQQTLEFLMKRVDEFVGATRQSDDITCMVFRSK |
| Ga0209693_105023071 | 3300027855 | Soil | PDSNAQQTLEFLMKRVDEFVGATRQSDDITCLVFRSR |
| Ga0209283_102292481 | 3300027875 | Vadose Zone Soil | GNERWLSAIRNLPDWDAQQTLQFLMKRVDEFVGATRQSDDITCLVFRSR |
| Ga0209275_103604032 | 3300027884 | Soil | NERWLDAIRALPDWGAAESLQFLIKRVDDFVGLTRQSDDITCLVFRTK |
| Ga0209526_109236661 | 3300028047 | Forest Soil | GDARWLEAIRSLPDVTAQQSLQVLMTRVDAFAGVTRQSDDITCMIFRCNRT |
| Ga0255358_10666702 | 3300028069 | Soil | RWLHLIRDLPNLPAQATMQYLMQQVGLFVGATRQSDDITCLVLRCK |
| Ga0137415_105465742 | 3300028536 | Vadose Zone Soil | AIRNLPDWDAQQTLQFLMKRVDEFVGATRQSDDITCLVFRSR |
| Ga0137415_108542871 | 3300028536 | Vadose Zone Soil | LPDWDAPRSLQFLLQRVDEFVGVTKQFDDITCLVLRCE |
| Ga0302232_102186622 | 3300028789 | Palsa | VTAEKTLQLLMQNVDGFVGATRQSDDITCLVFRSSRS |
| Ga0302218_100895871 | 3300028863 | Palsa | FAAIRALPIGTAQEQLAYLMKGVDDFVGATRQSDDITYMVFRCT |
| Ga0222749_101520412 | 3300029636 | Soil | WEAQASLQFLIKRVDDFVGLTRQSDDITCLVFRTK |
| Ga0316363_103469142 | 3300030659 | Peatlands Soil | WLHLIRDLPDLSAQATLQYLMQQVGQFVGATRQSDDITCLVLRCK |
| Ga0302313_103512882 | 3300030693 | Palsa | IRALPEVTAEKTLQLLMQNVDGFVGATRQSDDITCLVFRSSRS |
| Ga0170823_168552221 | 3300031128 | Forest Soil | FGNERWLSAIRGLPDWDAEQTLQFLMSRVDEFVGATRQSDDITCLVLCCS |
| Ga0170824_1022574362 | 3300031231 | Forest Soil | RNLPDWDGPQSLQFLMHRVDEFVGATRQSDDITCLVLRCE |
| Ga0302325_120468172 | 3300031234 | Palsa | AEETLRLLMRQVDGFVGATRQSDDITCLIFRTSRP |
| Ga0170818_1063779961 | 3300031474 | Forest Soil | NLNAQQTLQFLMKSVEDFVGATRQSDDITCLVLRCL |
| Ga0318516_103050611 | 3300031543 | Soil | DWNGHLCLKYLMERVDQFVGATRQADDITCMVFRSK |
| Ga0318560_102209532 | 3300031682 | Soil | FSDGRWLNAIRSLPNLSAEDSLGYLMKSVEDFVGATRQSDDITCLVLRMK |
| Ga0307474_116303001 | 3300031718 | Hardwood Forest Soil | WLAAIRALPEVTAQESLHFLMTRVDAFVGVTRQSDDITCMIFRAKRPA |
| Ga0307469_112223981 | 3300031720 | Hardwood Forest Soil | AIRNLPDWDAQLSLQFLMQRVDEFVGTTRQSDDITCLVLRCE |
| Ga0318500_101487032 | 3300031724 | Soil | IRSLPNLSAEDSLRYLMKSVEQFVGATRQSDDITCLVLRTK |
| Ga0307468_1015281772 | 3300031740 | Hardwood Forest Soil | LRNLNAQQTLQFLMKSVDDFVGVTRQSDDITCLVLRCS |
| Ga0306918_102220422 | 3300031744 | Soil | RWLNVIRSLPNLSAEDSLRYLMKSVEQFVGATRQSDDITCLVLRTK |
| Ga0307477_102309712 | 3300031753 | Hardwood Forest Soil | ISSMPELTAQESLQFLMKRVDDFAGATRQSDDITCLVFRCI |
| Ga0307475_102138361 | 3300031754 | Hardwood Forest Soil | AQESLQFLMTTVDAFVGVTRQSDDITCMIFRAKRTA |
| Ga0307475_105719062 | 3300031754 | Hardwood Forest Soil | SDNRWLNIIRGLPNINAQQTLQFLMKSVEDFVGATRQSDDITCLVLRCS |
| Ga0307475_105794352 | 3300031754 | Hardwood Forest Soil | SNGEEFKDARWLAAISNLPDWNAQQSLQFLLQRVDEFVGATRQSDDITCLILRCE |
| Ga0307475_108583112 | 3300031754 | Hardwood Forest Soil | PDWDAQQTLQYLMKQVDEFVGATRQSDDITCLVFRSK |
| Ga0307475_109933562 | 3300031754 | Hardwood Forest Soil | PNLNAQQTLQFLMKSVEDFVGATRQSDDITCLVLRCL |
| Ga0307475_111992702 | 3300031754 | Hardwood Forest Soil | MKSLQGPSSQQTMQFLMQQVDSFVGATRQFDDITCLLLRCC |
| Ga0307475_115437151 | 3300031754 | Hardwood Forest Soil | FNDQYEEFGNDRWSSVIRALPLMNAQESLQFLMKPVDEFVGATRQSDDITYLVFRNK |
| Ga0318546_107793521 | 3300031771 | Soil | LPDWNAQRSLQFLMQRVDEFVGATKQSDDITCLVLRCE |
| Ga0318547_101313921 | 3300031781 | Soil | LPDWDAQRSLQFLMQRVDEFVGATKQSDDITCLVLRCE |
| Ga0318547_104249032 | 3300031781 | Soil | EFSDPRWIHAIRSLPNLPAQGTLETLMKYVHDFAGATRQSDDITCLVLQIK |
| Ga0307473_105896511 | 3300031820 | Hardwood Forest Soil | NERWLSAIRSLPDWDASQTLQFLMSRVDEFVGATRQSDDITCLVFRSR |
| Ga0307473_109754012 | 3300031820 | Hardwood Forest Soil | DWDAQRSLQFLMQRVDEFVGNTRQSDDITCLILRCE |
| Ga0307478_108819192 | 3300031823 | Hardwood Forest Soil | IRSLPEISAQESLQFLMTTVDAFVGVTRQSDDITCMIFRAKRS |
| Ga0307478_110716523 | 3300031823 | Hardwood Forest Soil | NRWLNIIRGLPNLNAQQTLQFLMKSVEDFVGPTRQSDDITCLVLRCI |
| Ga0307478_114752001 | 3300031823 | Hardwood Forest Soil | GRWLAAIRGLPEISAQESLQFLMTTVDAFVGATRQSDDITCMIFRAKSA |
| Ga0306919_105138482 | 3300031879 | Soil | WLNVIRSLPNLSAVDSLGYLLKSVENFVGATRQSDDITCLVLRTR |
| Ga0306919_113544111 | 3300031879 | Soil | DPRWLNAIRNLPDWDAQRSLNFLIERVDEFVGATRQSDDITCLLLRL |
| Ga0318536_105134022 | 3300031893 | Soil | EEFGNERWLQTIRGLPDWNGHLCLKYLMERVDQFVGATRQADDITCMVFRSK |
| Ga0318551_104735711 | 3300031896 | Soil | LNTIRALPRLSAQGALEYLMKSVEDFVGATRQSDDITCLVLQVE |
| Ga0306921_104856911 | 3300031912 | Soil | RWLNVIRSLPNLSAEDSLRYLMKSVEEFVGATRQSDDITCLVLRTK |
| Ga0306921_126496711 | 3300031912 | Soil | WLNTILSFPPLSAQDTLHRLMKSVEDFVGNTRQSDDITCLILQSK |
| Ga0310912_107217032 | 3300031941 | Soil | FTDGRWLNVIRSLPNLSAEDSLRYLMKSVEEFAGATRQSDDITCLVLRTK |
| Ga0310912_114464161 | 3300031941 | Soil | PRWINVIRGLPNLNAQQTLQFLMKSVEEFVGATRQSDDITCLVLRCS |
| Ga0310916_107500632 | 3300031942 | Soil | NVIRSLPNLSAEDSLRYLMKSVEEFVGATRQSDDITCLVLRTK |
| Ga0306926_124619702 | 3300031954 | Soil | DWDAQRSLNFLIERVDEFVGATRQSDDITCLLLRL |
| Ga0307479_106419002 | 3300031962 | Hardwood Forest Soil | IRSLPDWDASQTLQFLMKRVDEFVGATRQSDDITCLVFRSR |
| Ga0306922_100471201 | 3300032001 | Soil | FSDPRWIHAIRSLPNLPAQGTLETLMKYVHDFAGATRQSDDITCLVLQIK |
| Ga0318559_104067202 | 3300032039 | Soil | FNGKGQEFTDARLVDEVRRLPDWDAQRSLQFLMQRVDEFVGATKQSDDITCLVLRCE |
| Ga0318549_102353442 | 3300032041 | Soil | IRSLPNLPAQSTLETLMKYVHDFAGATRQSDDITCLVLQIK |
| Ga0318545_100097681 | 3300032042 | Soil | TIRGLPDWNGHLCLKYLMERVDQFVGATRQADDITCMVFRSK |
| Ga0306924_113612341 | 3300032076 | Soil | EAIRALPDRSATESLQFLMRSVDDFVRATRQSDDITCLILRCK |
| Ga0318518_105109201 | 3300032090 | Soil | PNLSAVDSLGYLLKSVENFVGATRQSDDITCLVLRTR |
| Ga0311301_127988551 | 3300032160 | Peatlands Soil | PKLSAQDTLRYLMKSVEDFVGATRQSDDITCLVLLTR |
| Ga0307470_108352921 | 3300032174 | Hardwood Forest Soil | IAAVRDLPDWDAQRSLQFLMQRVDEFVGTTRQSDDITCLVLRCE |
| Ga0307471_1004783351 | 3300032180 | Hardwood Forest Soil | SAQESLQFLMTGVDAFVGATRQSDDITCMIFRANRS |
| Ga0307471_1032484642 | 3300032180 | Hardwood Forest Soil | RNLPDWDAQQTLQFLMKRVDEFVGATRQSDDITCLVFRSK |
| Ga0307472_1004942002 | 3300032205 | Hardwood Forest Soil | IAAIRNLPDWDAQRSLQFLLQRVDEFAGATRQFDDITCLVLRCE |
| Ga0306920_1020175981 | 3300032261 | Soil | SLPNLSAVDSLGYLLKSVENFVGATRQSDDITCLVLRTR |
| Ga0335082_104562902 | 3300032782 | Soil | YSDARWLDVIRSLPKLSAQGALQYLMKSVEDFVGATRQSDDITCLVLHVQ |
| Ga0335078_124235351 | 3300032805 | Soil | PLNAQQSLNYLMKSVEDFVGATRQSDDITCLVLRCS |
| Ga0335070_104648351 | 3300032829 | Soil | SDARWLNVVRGLPPLNAQQSLNYLMKSVEDFVGATRQSDDITCLVLRCS |
| Ga0335072_110714362 | 3300032898 | Soil | VPAMQSMMYLMHQVDQFVGTTRQADDITCLVFRSI |
| Ga0335073_103276053 | 3300033134 | Soil | VIRGVPKLSAQETLRYMMKSVEEFVGATRQSDDITCLVLQVS |
| Ga0310914_104209501 | 3300033289 | Soil | WLNTIRALPRLSAQGALEYLMKSVEDFVGATRQSDDITCLVLQVE |
| Ga0310810_111297032 | 3300033412 | Soil | RWLNAIRALPDWGAQESLEFLMKPVDAFVGFTRQSDDITCLVFRCK |
| ⦗Top⦘ |