| Basic Information | |
|---|---|
| Family ID | F015890 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 251 |
| Average Sequence Length | 41 residues |
| Representative Sequence | AMNRIRALTGSKFDAVVVTALESAVNAGKLRLSAVEVHV |
| Number of Associated Samples | 187 |
| Number of Associated Scaffolds | 251 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.40 % |
| % of genes near scaffold ends (potentially truncated) | 98.41 % |
| % of genes from short scaffolds (< 2000 bps) | 89.64 % |
| Associated GOLD sequencing projects | 173 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.45 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (57.769 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (27.490 % of family members) |
| Environment Ontology (ENVO) | Unclassified (28.685 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (51.394 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 26.87% β-sheet: 2.99% Coil/Unstructured: 70.15% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.45 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 251 Family Scaffolds |
|---|---|---|
| PF02881 | SRP54_N | 58.96 |
| PF02472 | ExbD | 7.17 |
| PF01872 | RibD_C | 3.59 |
| PF00383 | dCMP_cyt_deam_1 | 1.99 |
| PF07690 | MFS_1 | 1.20 |
| PF07676 | PD40 | 0.80 |
| PF07366 | SnoaL | 0.80 |
| PF01522 | Polysacc_deac_1 | 0.40 |
| PF13366 | PDDEXK_3 | 0.40 |
| PF10604 | Polyketide_cyc2 | 0.40 |
| PF02743 | dCache_1 | 0.40 |
| COG ID | Name | Functional Category | % Frequency in 251 Family Scaffolds |
|---|---|---|---|
| COG0848 | Biopolymer transport protein ExbD | Intracellular trafficking, secretion, and vesicular transport [U] | 7.17 |
| COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 3.59 |
| COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 3.59 |
| COG0726 | Peptidoglycan/xylan/chitin deacetylase, PgdA/NodB/CDA1 family | Cell wall/membrane/envelope biogenesis [M] | 0.40 |
| COG2972 | Sensor histidine kinase YesM | Signal transduction mechanisms [T] | 0.40 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 57.77 % |
| Unclassified | root | N/A | 42.23 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459005|F1BAP7Q01D2XDX | Not Available | 515 | Open in IMG/M |
| 3300000789|JGI1027J11758_12333659 | Not Available | 601 | Open in IMG/M |
| 3300000955|JGI1027J12803_108078775 | Not Available | 537 | Open in IMG/M |
| 3300001154|JGI12636J13339_1041363 | Not Available | 585 | Open in IMG/M |
| 3300001167|JGI12673J13574_1008899 | Not Available | 597 | Open in IMG/M |
| 3300001356|JGI12269J14319_10281616 | Not Available | 606 | Open in IMG/M |
| 3300001413|JGI20180J14839_1007974 | Not Available | 702 | Open in IMG/M |
| 3300001593|JGI12635J15846_10373374 | All Organisms → cellular organisms → Bacteria | 868 | Open in IMG/M |
| 3300001593|JGI12635J15846_10374009 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 867 | Open in IMG/M |
| 3300002908|JGI25382J43887_10042959 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2457 | Open in IMG/M |
| 3300002914|JGI25617J43924_10015249 | All Organisms → cellular organisms → Bacteria | 2590 | Open in IMG/M |
| 3300002914|JGI25617J43924_10346815 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 515 | Open in IMG/M |
| 3300002917|JGI25616J43925_10006974 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4892 | Open in IMG/M |
| 3300002917|JGI25616J43925_10157252 | Not Available | 905 | Open in IMG/M |
| 3300003350|JGI26347J50199_1028083 | Not Available | 631 | Open in IMG/M |
| 3300003370|JGI26337J50220_1031688 | Not Available | 604 | Open in IMG/M |
| 3300004080|Ga0062385_10239041 | All Organisms → cellular organisms → Bacteria | 1006 | Open in IMG/M |
| 3300004092|Ga0062389_100544858 | Not Available | 1316 | Open in IMG/M |
| 3300004092|Ga0062389_103139326 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Chloracidobacterium → Chloracidobacterium thermophilum | 618 | Open in IMG/M |
| 3300004152|Ga0062386_101095571 | Not Available | 661 | Open in IMG/M |
| 3300005175|Ga0066673_10255153 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1016 | Open in IMG/M |
| 3300005177|Ga0066690_10542428 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 779 | Open in IMG/M |
| 3300005187|Ga0066675_10594733 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 831 | Open in IMG/M |
| 3300005332|Ga0066388_100317504 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2203 | Open in IMG/M |
| 3300005436|Ga0070713_100715023 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 957 | Open in IMG/M |
| 3300005454|Ga0066687_10057144 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1842 | Open in IMG/M |
| 3300005471|Ga0070698_100277605 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1607 | Open in IMG/M |
| 3300005537|Ga0070730_10497619 | Not Available | 783 | Open in IMG/M |
| 3300005548|Ga0070665_101284930 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 742 | Open in IMG/M |
| 3300005574|Ga0066694_10194021 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 964 | Open in IMG/M |
| 3300005610|Ga0070763_10773269 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 566 | Open in IMG/M |
| 3300005764|Ga0066903_108248741 | Not Available | 533 | Open in IMG/M |
| 3300005764|Ga0066903_108845329 | Not Available | 511 | Open in IMG/M |
| 3300005944|Ga0066788_10126700 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
| 3300005993|Ga0080027_10023880 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2180 | Open in IMG/M |
| 3300006052|Ga0075029_100840927 | All Organisms → cellular organisms → Bacteria | 626 | Open in IMG/M |
| 3300006162|Ga0075030_100383434 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1120 | Open in IMG/M |
| 3300006162|Ga0075030_100579157 | All Organisms → cellular organisms → Bacteria | 891 | Open in IMG/M |
| 3300006176|Ga0070765_101972832 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 546 | Open in IMG/M |
| 3300006176|Ga0070765_102101466 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300006797|Ga0066659_10169678 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1569 | Open in IMG/M |
| 3300006797|Ga0066659_10884379 | Not Available | 745 | Open in IMG/M |
| 3300006800|Ga0066660_11098704 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
| 3300006893|Ga0073928_10004454 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 20726 | Open in IMG/M |
| 3300006903|Ga0075426_10524511 | Not Available | 881 | Open in IMG/M |
| 3300006954|Ga0079219_11586821 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
| 3300007255|Ga0099791_10195133 | Not Available | 953 | Open in IMG/M |
| 3300007258|Ga0099793_10004468 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4982 | Open in IMG/M |
| 3300007258|Ga0099793_10149407 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1105 | Open in IMG/M |
| 3300009038|Ga0099829_10332139 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1250 | Open in IMG/M |
| 3300009038|Ga0099829_10720868 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 828 | Open in IMG/M |
| 3300009038|Ga0099829_10804707 | Not Available | 780 | Open in IMG/M |
| 3300009088|Ga0099830_10484191 | All Organisms → cellular organisms → Bacteria | 1008 | Open in IMG/M |
| 3300009088|Ga0099830_11025416 | Not Available | 683 | Open in IMG/M |
| 3300009088|Ga0099830_11411699 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 579 | Open in IMG/M |
| 3300009089|Ga0099828_10138946 | All Organisms → cellular organisms → Bacteria | 2138 | Open in IMG/M |
| 3300009089|Ga0099828_10596434 | All Organisms → cellular organisms → Bacteria | 994 | Open in IMG/M |
| 3300010048|Ga0126373_10807999 | Not Available | 1000 | Open in IMG/M |
| 3300010048|Ga0126373_12271265 | Not Available | 603 | Open in IMG/M |
| 3300010048|Ga0126373_12527066 | Not Available | 572 | Open in IMG/M |
| 3300010048|Ga0126373_12799683 | Not Available | 544 | Open in IMG/M |
| 3300010048|Ga0126373_13297966 | Not Available | 502 | Open in IMG/M |
| 3300010159|Ga0099796_10490602 | Not Available | 549 | Open in IMG/M |
| 3300010335|Ga0134063_10451091 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 637 | Open in IMG/M |
| 3300010359|Ga0126376_11901377 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 635 | Open in IMG/M |
| 3300010360|Ga0126372_11589436 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 692 | Open in IMG/M |
| 3300010361|Ga0126378_12244148 | Not Available | 623 | Open in IMG/M |
| 3300010366|Ga0126379_13858508 | Not Available | 502 | Open in IMG/M |
| 3300011120|Ga0150983_15685834 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Occallatibacter → Occallatibacter savannae | 682 | Open in IMG/M |
| 3300011269|Ga0137392_10053060 | All Organisms → cellular organisms → Bacteria | 3058 | Open in IMG/M |
| 3300011269|Ga0137392_10083502 | All Organisms → cellular organisms → Bacteria | 2483 | Open in IMG/M |
| 3300011269|Ga0137392_10212105 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_4_57_6 | 1586 | Open in IMG/M |
| 3300011269|Ga0137392_10611353 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 904 | Open in IMG/M |
| 3300011269|Ga0137392_10829467 | All Organisms → cellular organisms → Bacteria | 763 | Open in IMG/M |
| 3300011269|Ga0137392_11098763 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 652 | Open in IMG/M |
| 3300011270|Ga0137391_10161599 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1952 | Open in IMG/M |
| 3300011270|Ga0137391_10359894 | Not Available | 1249 | Open in IMG/M |
| 3300011270|Ga0137391_10592469 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 930 | Open in IMG/M |
| 3300011270|Ga0137391_11133589 | Not Available | 630 | Open in IMG/M |
| 3300011271|Ga0137393_10119979 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2168 | Open in IMG/M |
| 3300011271|Ga0137393_10331279 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1299 | Open in IMG/M |
| 3300011271|Ga0137393_10504670 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1038 | Open in IMG/M |
| 3300011271|Ga0137393_11177872 | Not Available | 651 | Open in IMG/M |
| 3300011271|Ga0137393_11243843 | Not Available | 632 | Open in IMG/M |
| 3300012096|Ga0137389_10257684 | All Organisms → cellular organisms → Bacteria | 1468 | Open in IMG/M |
| 3300012096|Ga0137389_11007482 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_57_17 | 714 | Open in IMG/M |
| 3300012096|Ga0137389_11367605 | Not Available | 603 | Open in IMG/M |
| 3300012199|Ga0137383_10928076 | All Organisms → cellular organisms → Bacteria | 636 | Open in IMG/M |
| 3300012201|Ga0137365_10098340 | All Organisms → cellular organisms → Bacteria | 2202 | Open in IMG/M |
| 3300012201|Ga0137365_10930271 | Not Available | 633 | Open in IMG/M |
| 3300012202|Ga0137363_10012461 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5482 | Open in IMG/M |
| 3300012205|Ga0137362_10044323 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3600 | Open in IMG/M |
| 3300012205|Ga0137362_10205826 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1694 | Open in IMG/M |
| 3300012205|Ga0137362_11467440 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 569 | Open in IMG/M |
| 3300012205|Ga0137362_11608575 | Not Available | 537 | Open in IMG/M |
| 3300012211|Ga0137377_11370203 | All Organisms → cellular organisms → Bacteria | 636 | Open in IMG/M |
| 3300012349|Ga0137387_10248000 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1283 | Open in IMG/M |
| 3300012349|Ga0137387_11052114 | Not Available | 582 | Open in IMG/M |
| 3300012356|Ga0137371_10563027 | Not Available | 877 | Open in IMG/M |
| 3300012361|Ga0137360_11053329 | Not Available | 702 | Open in IMG/M |
| 3300012362|Ga0137361_10452654 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1179 | Open in IMG/M |
| 3300012363|Ga0137390_10502349 | Not Available | 1186 | Open in IMG/M |
| 3300012363|Ga0137390_11629945 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
| 3300012363|Ga0137390_11667320 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 573 | Open in IMG/M |
| 3300012582|Ga0137358_10688706 | Not Available | 684 | Open in IMG/M |
| 3300012582|Ga0137358_10896193 | Not Available | 582 | Open in IMG/M |
| 3300012683|Ga0137398_10618988 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 750 | Open in IMG/M |
| 3300012685|Ga0137397_10796790 | Not Available | 701 | Open in IMG/M |
| 3300012922|Ga0137394_11159034 | Not Available | 637 | Open in IMG/M |
| 3300012924|Ga0137413_11321270 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 579 | Open in IMG/M |
| 3300012930|Ga0137407_11205140 | Not Available | 718 | Open in IMG/M |
| 3300012930|Ga0137407_11952166 | Not Available | 560 | Open in IMG/M |
| 3300012944|Ga0137410_12023738 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300012948|Ga0126375_11713557 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
| 3300013096|Ga0157307_1179871 | Not Available | 511 | Open in IMG/M |
| 3300014154|Ga0134075_10435343 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
| 3300014501|Ga0182024_10178638 | All Organisms → cellular organisms → Bacteria | 2935 | Open in IMG/M |
| 3300014969|Ga0157376_12359453 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
| 3300015054|Ga0137420_1305122 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1121 | Open in IMG/M |
| 3300015373|Ga0132257_102265626 | Not Available | 704 | Open in IMG/M |
| 3300016294|Ga0182041_11545849 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 612 | Open in IMG/M |
| 3300016319|Ga0182033_11206588 | Not Available | 678 | Open in IMG/M |
| 3300016341|Ga0182035_11978388 | Not Available | 529 | Open in IMG/M |
| 3300016357|Ga0182032_11289986 | Not Available | 630 | Open in IMG/M |
| 3300017822|Ga0187802_10119202 | All Organisms → cellular organisms → Bacteria | 999 | Open in IMG/M |
| 3300017822|Ga0187802_10357708 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 574 | Open in IMG/M |
| 3300017973|Ga0187780_11281461 | Not Available | 538 | Open in IMG/M |
| 3300017994|Ga0187822_10391862 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
| 3300017998|Ga0187870_1258551 | Not Available | 595 | Open in IMG/M |
| 3300018006|Ga0187804_10566281 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300018012|Ga0187810_10405626 | Not Available | 573 | Open in IMG/M |
| 3300018032|Ga0187788_10333556 | All Organisms → cellular organisms → Bacteria | 623 | Open in IMG/M |
| 3300018088|Ga0187771_11066151 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 685 | Open in IMG/M |
| 3300018088|Ga0187771_11615476 | Not Available | 550 | Open in IMG/M |
| 3300018090|Ga0187770_10450255 | Not Available | 1015 | Open in IMG/M |
| 3300020062|Ga0193724_1025810 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1251 | Open in IMG/M |
| 3300020140|Ga0179590_1102133 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 773 | Open in IMG/M |
| 3300020170|Ga0179594_10401727 | Not Available | 520 | Open in IMG/M |
| 3300020579|Ga0210407_11079491 | Not Available | 609 | Open in IMG/M |
| 3300020579|Ga0210407_11191783 | Not Available | 573 | Open in IMG/M |
| 3300020579|Ga0210407_11414094 | Not Available | 516 | Open in IMG/M |
| 3300020581|Ga0210399_10324161 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1286 | Open in IMG/M |
| 3300020581|Ga0210399_10334817 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1263 | Open in IMG/M |
| 3300021046|Ga0215015_10701091 | Not Available | 677 | Open in IMG/M |
| 3300021086|Ga0179596_10184282 | Not Available | 1010 | Open in IMG/M |
| 3300021088|Ga0210404_10651443 | Not Available | 600 | Open in IMG/M |
| 3300021168|Ga0210406_10703924 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales | 778 | Open in IMG/M |
| 3300021180|Ga0210396_10438663 | All Organisms → cellular organisms → Bacteria | 1146 | Open in IMG/M |
| 3300021181|Ga0210388_11261238 | All Organisms → cellular organisms → Bacteria | 625 | Open in IMG/M |
| 3300021402|Ga0210385_11525795 | Not Available | 510 | Open in IMG/M |
| 3300021404|Ga0210389_10087564 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2394 | Open in IMG/M |
| 3300021404|Ga0210389_11567531 | Not Available | 500 | Open in IMG/M |
| 3300021406|Ga0210386_10104555 | All Organisms → cellular organisms → Bacteria | 2326 | Open in IMG/M |
| 3300021406|Ga0210386_10104558 | All Organisms → cellular organisms → Bacteria | 2326 | Open in IMG/M |
| 3300021406|Ga0210386_10694978 | Not Available | 877 | Open in IMG/M |
| 3300021420|Ga0210394_10218727 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1663 | Open in IMG/M |
| 3300021420|Ga0210394_10635427 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 937 | Open in IMG/M |
| 3300021432|Ga0210384_11181596 | All Organisms → cellular organisms → Bacteria | 669 | Open in IMG/M |
| 3300021433|Ga0210391_11275342 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 567 | Open in IMG/M |
| 3300021475|Ga0210392_10407236 | Not Available | 992 | Open in IMG/M |
| 3300021475|Ga0210392_10563797 | All Organisms → cellular organisms → Bacteria | 843 | Open in IMG/M |
| 3300021475|Ga0210392_11348314 | Not Available | 533 | Open in IMG/M |
| 3300021478|Ga0210402_10123616 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2341 | Open in IMG/M |
| 3300021478|Ga0210402_10225885 | All Organisms → cellular organisms → Bacteria | 1725 | Open in IMG/M |
| 3300021478|Ga0210402_10581755 | Not Available | 1038 | Open in IMG/M |
| 3300021478|Ga0210402_11903569 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 521 | Open in IMG/M |
| 3300021479|Ga0210410_11200366 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 650 | Open in IMG/M |
| 3300021559|Ga0210409_10933038 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 742 | Open in IMG/M |
| 3300021861|Ga0213853_10733576 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 607 | Open in IMG/M |
| 3300022532|Ga0242655_10195555 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 616 | Open in IMG/M |
| 3300024178|Ga0247694_1021009 | Not Available | 734 | Open in IMG/M |
| 3300024181|Ga0247693_1028986 | Not Available | 760 | Open in IMG/M |
| 3300024283|Ga0247670_1061492 | Not Available | 680 | Open in IMG/M |
| 3300024330|Ga0137417_1130241 | All Organisms → cellular organisms → Bacteria | 687 | Open in IMG/M |
| 3300025910|Ga0207684_10863034 | Not Available | 762 | Open in IMG/M |
| 3300025922|Ga0207646_10278298 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1512 | Open in IMG/M |
| 3300025927|Ga0207687_10501082 | All Organisms → cellular organisms → Bacteria | 1013 | Open in IMG/M |
| 3300025934|Ga0207686_10340508 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1126 | Open in IMG/M |
| 3300025939|Ga0207665_11225456 | Not Available | 599 | Open in IMG/M |
| 3300026215|Ga0209849_1092457 | Not Available | 534 | Open in IMG/M |
| 3300026285|Ga0209438_1089091 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 969 | Open in IMG/M |
| 3300026291|Ga0209890_10202064 | All Organisms → cellular organisms → Bacteria | 637 | Open in IMG/M |
| 3300026295|Ga0209234_1135650 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_57_17 | 889 | Open in IMG/M |
| 3300026304|Ga0209240_1089439 | Not Available | 1121 | Open in IMG/M |
| 3300026309|Ga0209055_1113934 | All Organisms → cellular organisms → Bacteria | 1046 | Open in IMG/M |
| 3300026310|Ga0209239_1144758 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 953 | Open in IMG/M |
| 3300026322|Ga0209687_1286915 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300026377|Ga0257171_1014472 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1311 | Open in IMG/M |
| 3300026490|Ga0257153_1084643 | Not Available | 635 | Open in IMG/M |
| 3300026507|Ga0257165_1013910 | All Organisms → cellular organisms → Bacteria | 1299 | Open in IMG/M |
| 3300026551|Ga0209648_10224112 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1414 | Open in IMG/M |
| 3300026552|Ga0209577_10532591 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 761 | Open in IMG/M |
| 3300026557|Ga0179587_11124722 | Not Available | 517 | Open in IMG/M |
| 3300026895|Ga0207758_1014724 | Not Available | 770 | Open in IMG/M |
| 3300026909|Ga0207858_1017373 | All Organisms → cellular organisms → Bacteria | 695 | Open in IMG/M |
| 3300027330|Ga0207777_1053338 | Not Available | 715 | Open in IMG/M |
| 3300027512|Ga0209179_1043764 | Not Available | 947 | Open in IMG/M |
| 3300027643|Ga0209076_1151526 | Not Available | 648 | Open in IMG/M |
| 3300027645|Ga0209117_1102468 | Not Available | 781 | Open in IMG/M |
| 3300027651|Ga0209217_1113499 | Not Available | 767 | Open in IMG/M |
| 3300027678|Ga0209011_1222216 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 508 | Open in IMG/M |
| 3300027703|Ga0207862_1002214 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5880 | Open in IMG/M |
| 3300027729|Ga0209248_10019037 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2148 | Open in IMG/M |
| 3300027768|Ga0209772_10126716 | Not Available | 795 | Open in IMG/M |
| 3300027862|Ga0209701_10101584 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1796 | Open in IMG/M |
| 3300027862|Ga0209701_10293992 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_57_17 | 935 | Open in IMG/M |
| 3300027875|Ga0209283_10124559 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1700 | Open in IMG/M |
| 3300027875|Ga0209283_10480249 | All Organisms → cellular organisms → Bacteria | 802 | Open in IMG/M |
| 3300027884|Ga0209275_10173280 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli | 1154 | Open in IMG/M |
| 3300027889|Ga0209380_10219161 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1118 | Open in IMG/M |
| 3300027898|Ga0209067_10429162 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 743 | Open in IMG/M |
| 3300027903|Ga0209488_10123449 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1949 | Open in IMG/M |
| 3300027911|Ga0209698_10466625 | Not Available | 980 | Open in IMG/M |
| 3300028037|Ga0265349_1000326 | All Organisms → cellular organisms → Bacteria | 5900 | Open in IMG/M |
| 3300029636|Ga0222749_10116996 | All Organisms → cellular organisms → Bacteria | 1269 | Open in IMG/M |
| 3300030617|Ga0311356_11068271 | Not Available | 750 | Open in IMG/M |
| 3300030693|Ga0302313_10114516 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1114 | Open in IMG/M |
| 3300031057|Ga0170834_111846931 | Not Available | 667 | Open in IMG/M |
| 3300031122|Ga0170822_11349851 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
| 3300031238|Ga0265332_10157711 | Not Available | 949 | Open in IMG/M |
| 3300031564|Ga0318573_10231512 | Not Available | 983 | Open in IMG/M |
| 3300031708|Ga0310686_117415969 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2252 | Open in IMG/M |
| 3300031720|Ga0307469_11364701 | Not Available | 675 | Open in IMG/M |
| 3300031720|Ga0307469_11669582 | Not Available | 613 | Open in IMG/M |
| 3300031724|Ga0318500_10253668 | Not Available | 854 | Open in IMG/M |
| 3300031736|Ga0318501_10833318 | Not Available | 512 | Open in IMG/M |
| 3300031747|Ga0318502_10431580 | Not Available | 786 | Open in IMG/M |
| 3300031753|Ga0307477_10759442 | All Organisms → cellular organisms → Bacteria | 646 | Open in IMG/M |
| 3300031754|Ga0307475_10449295 | Not Available | 1036 | Open in IMG/M |
| 3300031754|Ga0307475_11143671 | Not Available | 608 | Open in IMG/M |
| 3300031820|Ga0307473_10295723 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1016 | Open in IMG/M |
| 3300031879|Ga0306919_10087050 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2168 | Open in IMG/M |
| 3300031890|Ga0306925_11895635 | Not Available | 567 | Open in IMG/M |
| 3300031893|Ga0318536_10376641 | All Organisms → cellular organisms → Bacteria | 718 | Open in IMG/M |
| 3300031942|Ga0310916_10144017 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1960 | Open in IMG/M |
| 3300031954|Ga0306926_11126580 | Not Available | 926 | Open in IMG/M |
| 3300031954|Ga0306926_11322125 | Not Available | 840 | Open in IMG/M |
| 3300031962|Ga0307479_10115253 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2617 | Open in IMG/M |
| 3300031962|Ga0307479_10327048 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1516 | Open in IMG/M |
| 3300031962|Ga0307479_11782057 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 568 | Open in IMG/M |
| 3300031962|Ga0307479_11996825 | Not Available | 529 | Open in IMG/M |
| 3300031981|Ga0318531_10292663 | Not Available | 736 | Open in IMG/M |
| 3300032059|Ga0318533_10425602 | Not Available | 970 | Open in IMG/M |
| 3300032076|Ga0306924_12295204 | Not Available | 547 | Open in IMG/M |
| 3300032180|Ga0307471_100077736 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2901 | Open in IMG/M |
| 3300032180|Ga0307471_102522007 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 651 | Open in IMG/M |
| 3300032205|Ga0307472_100289900 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae | 1309 | Open in IMG/M |
| 3300032261|Ga0306920_103799631 | Not Available | 552 | Open in IMG/M |
| 3300032829|Ga0335070_10832376 | Not Available | 857 | Open in IMG/M |
| 3300033289|Ga0310914_11150541 | Not Available | 677 | Open in IMG/M |
| 3300034178|Ga0364934_0134875 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 934 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 27.49% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 17.93% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 5.18% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.78% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.98% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.98% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.98% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 3.19% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.19% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.79% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 1.20% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.99% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.99% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.99% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.99% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.99% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.99% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.80% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.80% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.80% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.80% |
| Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 0.40% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.40% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.40% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.40% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.40% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.40% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.40% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.40% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.40% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.40% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.40% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.40% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.40% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.40% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.40% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.40% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.40% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.40% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459005 | Grass soil microbial communities from Rothamsted Park, UK - July 2009 direct MP BIO1O1 lysis 0-21cm | Environmental | Open in IMG/M |
| 3300000789 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001154 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 | Environmental | Open in IMG/M |
| 3300001167 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M2 | Environmental | Open in IMG/M |
| 3300001356 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 | Environmental | Open in IMG/M |
| 3300001413 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-1 shallow-072012 | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300002908 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002914 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm | Environmental | Open in IMG/M |
| 3300002917 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_100cm | Environmental | Open in IMG/M |
| 3300003350 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM3 | Environmental | Open in IMG/M |
| 3300003370 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM2 | Environmental | Open in IMG/M |
| 3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005944 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-048 | Environmental | Open in IMG/M |
| 3300005993 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300013096 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 | Environmental | Open in IMG/M |
| 3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300017994 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2 | Environmental | Open in IMG/M |
| 3300017998 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_150 | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300018012 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5 | Environmental | Open in IMG/M |
| 3300018032 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP10_20_MG | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300020062 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a1 | Environmental | Open in IMG/M |
| 3300020140 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021046 | Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depth | Environmental | Open in IMG/M |
| 3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021861 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022532 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300024178 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK35 | Environmental | Open in IMG/M |
| 3300024181 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK34 | Environmental | Open in IMG/M |
| 3300024283 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK11 | Environmental | Open in IMG/M |
| 3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026215 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-048 (SPAdes) | Environmental | Open in IMG/M |
| 3300026285 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026291 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049 (SPAdes) | Environmental | Open in IMG/M |
| 3300026295 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026309 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes) | Environmental | Open in IMG/M |
| 3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 (SPAdes) | Environmental | Open in IMG/M |
| 3300026377 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-B | Environmental | Open in IMG/M |
| 3300026490 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-A | Environmental | Open in IMG/M |
| 3300026507 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-12-B | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300026895 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 12 (SPAdes) | Environmental | Open in IMG/M |
| 3300026909 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 23 (SPAdes) | Environmental | Open in IMG/M |
| 3300027330 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 35 (SPAdes) | Environmental | Open in IMG/M |
| 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027643 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027645 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027651 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027678 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027703 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 81 (SPAdes) | Environmental | Open in IMG/M |
| 3300027729 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027768 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027898 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028037 | Soil microbial communities from Maridalen valley, Oslo, Norway - NSE1 | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030617 | II_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300030693 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N2_2 | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031122 | Oak Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Host-Associated | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300031981 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300034178 | Sediment microbial communities from East River floodplain, Colorado, United States - 27_j17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| E41_05791270 | 2170459005 | Grass Soil | AMELEFALTRIKALTGAKFDAVIVGALDAAITSGKLRLTAVEVQV |
| JGI1027J11758_123336591 | 3300000789 | Soil | RIKALAGSKFDAVIVAALDAAIASGKLHLAAVEVQV* |
| JGI1027J12803_1080787751 | 3300000955 | Soil | FALKRIQSLTGAKFDAVVVNALESAVTTGRLRLSAVEVQV* |
| JGI12636J13339_10413631 | 3300001154 | Forest Soil | RALTGSKFDDVVVTALESAVTAGKLRLSAVEVHV* |
| JGI12673J13574_10088991 | 3300001167 | Forest Soil | MNRIRALAGSKFDDVVVTALESAVNGGKLRLSAVEVHV* |
| JGI12269J14319_102816161 | 3300001356 | Peatlands Soil | ALGRIKALAGSKFDQAIVSALESAVQSGKIRLSAVEVHV* |
| JGI20180J14839_10079741 | 3300001413 | Arctic Peat Soil | AMDLDFALGRIKALTGSKFDQVVVTALESAVKAGKIRLTAVEVHV* |
| JGI12635J15846_103733741 | 3300001593 | Forest Soil | MDIDYALGRIKALKGTKFDEDVVSALESSINAGKLRLSAVEVQV* |
| JGI12635J15846_103740091 | 3300001593 | Forest Soil | ALGRIKALKGTKFDEEVVNALESTINTGKLRLSAVEVQV* |
| JGI25382J43887_100429591 | 3300002908 | Grasslands Soil | MELDYAMDKIRALTGSKFDAVVVTALESAVNAGKLRLSAVEVHV* |
| JGI25617J43924_100152491 | 3300002914 | Grasslands Soil | QTAMELDYAMDRIRALTGSKFDAGVVTALESTVNAGKLRLSAVEVHV* |
| JGI25617J43924_103468152 | 3300002914 | Grasslands Soil | EFALNRIKSLTGSKFDSVVVTALESAINAGKLRLSAVEVTV* |
| JGI25616J43925_100069745 | 3300002917 | Grasslands Soil | ELDYAMDRIRALTGSKFDAVVVTALESAVNAGKLRLXAVEVHV* |
| JGI25616J43925_101572522 | 3300002917 | Grasslands Soil | QSAMELDYAMDRIRALTGSKFDAVVVTALESTVNAGKLRLSAVEVHV* |
| JGI26347J50199_10280832 | 3300003350 | Bog Forest Soil | ALNRIKSLTGSKFDAVVVNALESSINTGKLRLSAVEVTV* |
| JGI26337J50220_10316882 | 3300003370 | Bog Forest Soil | TAMDIEFALNRIKSLTGSKFDAVVVNALESSINTGKLRLSAVEVTV* |
| Ga0062385_102390413 | 3300004080 | Bog Forest Soil | MDLDYALGKIKALAGSKFDTVVVNALDAAVTNGKLRLSAVEVQV* |
| Ga0062389_1005448582 | 3300004092 | Bog Forest Soil | AMDIEFALNRIKSLTGSKFDAVVVNALESAINSGKLRLSAVEVTV* |
| Ga0062389_1031393261 | 3300004092 | Bog Forest Soil | QTAMELDYAMNRIRALTGSKFDSVVVTALESAVKAGKLRLSAVEVHV* |
| Ga0062386_1010955712 | 3300004152 | Bog Forest Soil | DFALGRIKTLTGSKFDQVVVAALESAVRAGKIRLTAVEVHV* |
| Ga0066673_102551531 | 3300005175 | Soil | YQTAMELDYAMNRIRALTGSKFDDVVVTALESAVNAGKLRLSAVEVHV* |
| Ga0066690_105424282 | 3300005177 | Soil | DYAMDRIRALTGSKFDAIVVTALESAVNAGKLRLSAVEVHV* |
| Ga0066675_105947331 | 3300005187 | Soil | PYQTAMELDYAMERIRALAGTKFDPVVVTALESAVQHGKVRLSAVEVHV* |
| Ga0066388_1003175041 | 3300005332 | Tropical Forest Soil | MDLDYALKRIQSLSGSKFDAIVVSALESAVTTGKLRLSAVEVQV* |
| Ga0070713_1007150231 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | DYALGKIKALSGSKFDAVVVTALEATVMSGKLRLSAVEVQV* |
| Ga0066687_100571443 | 3300005454 | Soil | AMDLDYAMERIRALAGTKFDSVVVNALESAVQHGKLRLSAVEVHV* |
| Ga0070698_1002776053 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | PYQNAMELELALSKIKALAGAKFDAVIVGALDASITNGKLRLTAVEVQV* |
| Ga0070730_104976191 | 3300005537 | Surface Soil | LEFALQRIKSLAGAKFDAVVVTALDASVTSGKLRMSAVEVQV* |
| Ga0070665_1012849302 | 3300005548 | Switchgrass Rhizosphere | RIQSLTGAKFDAVVVAALESAVTGGKLRLSAVEVQV* |
| Ga0066694_101940213 | 3300005574 | Soil | RPYQTAMELDYAMNRIRALTGSKFDDVVVTALESAVNAGKLRLSAVEVHV* |
| Ga0070763_107732692 | 3300005610 | Soil | RALTGSKFDAVVVTALESAVTAGKLRLSAVEVHV* |
| Ga0066903_1082487411 | 3300005764 | Tropical Forest Soil | RIQALTGAKFDAVVVAALESAVTTGKLRLSAVEVQV* |
| Ga0066903_1088453291 | 3300005764 | Tropical Forest Soil | KALTGTKFDSAVVTALENTIQKGKLRLAAVEVQV* |
| Ga0066788_101267002 | 3300005944 | Soil | KIKALAGSKFDTVVVNALDAAVTNGKLRLSAVEVQV* |
| Ga0080027_100238801 | 3300005993 | Prmafrost Soil | MELDFALGRIKALAGSKFDQAVVTALEAAVLAGKIRLSAVEVHV* |
| Ga0075029_1008409272 | 3300006052 | Watersheds | MDLDYALGRIKALAGSKFDESIVAALDSAIKAGKLRLTAVEVHV* |
| Ga0075030_1003834341 | 3300006162 | Watersheds | LKRIRSLTGSKFDDVVVTALESAVTKGKLRLTAVEVHV* |
| Ga0075030_1005791573 | 3300006162 | Watersheds | LGRIKALAGSKFDESIVAALDSAVKAGKLRLTAVEVHV* |
| Ga0070765_1019728322 | 3300006176 | Soil | YALSRIRSLTGAKFDGVVVNALESAITAGKLRLSAVEVHV* |
| Ga0070765_1021014662 | 3300006176 | Soil | ALGKIKALAGSKFDTVVVNALDSAVTNGKLRLSAVEVQV* |
| Ga0066659_101696783 | 3300006797 | Soil | IRALAGTKFDPVVVTALESAVQHGKVRLSAVEVHV* |
| Ga0066659_108843792 | 3300006797 | Soil | LDVAMGRIKALSGTKFDSVVINALEAAVNSGKIRLSAVEVQV* |
| Ga0066660_110987041 | 3300006800 | Soil | YQTAMELDYAMDRIRALTGSKFDAIVVTALESAVNAGKLRLSAVEVHV* |
| Ga0073928_100044541 | 3300006893 | Iron-Sulfur Acid Spring | ALGKIKALAGSKFDTVVVNALDSVVTNGKLRLSAVEVQV* |
| Ga0075426_105245112 | 3300006903 | Populus Rhizosphere | RIQSLTGAKFDAVVVGALEAAVTTGKLRLSAVEVQV* |
| Ga0079219_115868211 | 3300006954 | Agricultural Soil | MERIRALAGSKFDPVVVTALESAVQHGKIRLSAVEVHV* |
| Ga0099791_101951331 | 3300007255 | Vadose Zone Soil | KIKALAGSKFDAVVVNALEAAVTAGRVRLSAVEVQV* |
| Ga0099793_100044686 | 3300007258 | Vadose Zone Soil | AMELDYAMNRIRALTGSKFDDVVVTALESAVNAGKLRLSAVEVHV* |
| Ga0099793_101494071 | 3300007258 | Vadose Zone Soil | IRALTGSKFDAVVVTALESAVNAGKLRLSAVEVHV* |
| Ga0099829_103321392 | 3300009038 | Vadose Zone Soil | YALGKIKALAGSKFDAVVVNALEAAVTAGRVRLSAVEVHV* |
| Ga0099829_107208683 | 3300009038 | Vadose Zone Soil | DYAMNRIRALTGSKFDDVVVTALESAVNAGKLRLSAVEVHV* |
| Ga0099829_108047072 | 3300009038 | Vadose Zone Soil | GKIKALAGSKFDAVVVNALEAAVTAGRVRLSAVEVQV* |
| Ga0099830_104841911 | 3300009088 | Vadose Zone Soil | RPYQTAMELDYAMNRIRALTGSKFDTVVVTALESAVNAGKLRLSAVEVHV* |
| Ga0099830_110254161 | 3300009088 | Vadose Zone Soil | RIRALTGSKFDDVVVTALESAVNAGKLRLSAVEVHV* |
| Ga0099830_114116992 | 3300009088 | Vadose Zone Soil | LGKIKALAGSKFDAVVVNALDAAVNAGRLRLSAVEVQV* |
| Ga0099828_101389464 | 3300009089 | Vadose Zone Soil | PYQTAMELDYAMNRIRALTGSKFDAVVVTALEAAVNAGKLRLSAVEVHV* |
| Ga0099828_105964341 | 3300009089 | Vadose Zone Soil | TAMELDYAMNRIRALTGSKFDDVVVTALESAVNAGKLRLSAVEVHV* |
| Ga0126373_108079993 | 3300010048 | Tropical Forest Soil | KALTGSKFDEAIVNALESAVKAGKLRLTAVEVQV* |
| Ga0126373_122712651 | 3300010048 | Tropical Forest Soil | DLDFALQKIKTLTGSKFDGVVVNALEAAITAGRLRLSAIEVQV* |
| Ga0126373_125270662 | 3300010048 | Tropical Forest Soil | LGRIKALTGSKFDQAVVNALESAVKSGKIRLSAIEVHV* |
| Ga0126373_127996832 | 3300010048 | Tropical Forest Soil | LEYALGRIKALAGSKFDEAIVNALESAVKAGKLRLTAVEVQV* |
| Ga0126373_132979662 | 3300010048 | Tropical Forest Soil | LGRIKALTGSKFDQAVVNALESAVKSGRIRLSAIEVHV* |
| Ga0099796_104906021 | 3300010159 | Vadose Zone Soil | AMGRIRALAGSKFDPAIVTALDAAVTAGRLRLSAVEVQV* |
| Ga0134063_104510912 | 3300010335 | Grasslands Soil | RNLTGTKFDAVVVNALESAVQHGKLRLSAVEVHV* |
| Ga0126376_119013771 | 3300010359 | Tropical Forest Soil | AMDLDYALGRIKALAGSKFDGVVVNALDSAIASGKIRLSAVEVQV* |
| Ga0126372_115894362 | 3300010360 | Tropical Forest Soil | DLDYALTKIKALTGSKFDTVVVTALEASVTAGKLRLSAVEVQV* |
| Ga0126378_122441482 | 3300010361 | Tropical Forest Soil | ALKRIQSLGGSKFDAVVIAALESAVTTGKLRLSAVEVQV* |
| Ga0126379_138585081 | 3300010366 | Tropical Forest Soil | GRIKALTGSKFDEAIVNALESAVKAGKLRLTAVEVQV* |
| Ga0150983_156858342 | 3300011120 | Forest Soil | FALNRIKSLTGSKFDAVVVNALESAINSGKLRLSAVEVTV* |
| Ga0137392_100530601 | 3300011269 | Vadose Zone Soil | RALTGSKFDAVVVTALESAVNAGKLRLSAVEVHV* |
| Ga0137392_100835021 | 3300011269 | Vadose Zone Soil | YQSAMEIDYALGKIRALVGTKFDPDVVDALELVVKAGKLRLAAVEVPV* |
| Ga0137392_102121051 | 3300011269 | Vadose Zone Soil | RPYQTAMELDYAMNRIRALTGSKFDAVVVTALEAAVNAGKLRLSAVEVHV* |
| Ga0137392_106113531 | 3300011269 | Vadose Zone Soil | PYQTAMELDYAMNRIRALTGSKFDDVVVTALESAVNAGKLRLSAVEVHV* |
| Ga0137392_108294672 | 3300011269 | Vadose Zone Soil | YAMDRIRALAGSKFDAVVVNALESAVNAGKLRLSAVEVHV* |
| Ga0137392_110987631 | 3300011269 | Vadose Zone Soil | DLDYAMERIRALTGSKFDAVVVNALESAVQHGKLRLSAVEVHV* |
| Ga0137391_101615993 | 3300011270 | Vadose Zone Soil | SAMELDYAMDRIRALTGSKFDAVVVTALESAVNAGKLRLSAVEVHV* |
| Ga0137391_103598943 | 3300011270 | Vadose Zone Soil | LEYALGKIKALAGSKFDAVVVNALEAAVTAGRVRLSAVEVQV* |
| Ga0137391_105924693 | 3300011270 | Vadose Zone Soil | GDLTGAKFGSLVVTALESAVNAGKLRLSAVEVHV* |
| Ga0137391_111335891 | 3300011270 | Vadose Zone Soil | LEYALGKIKALAGSKFDAVVVNALEAAVTAGRVRLSAVEVHV* |
| Ga0137393_101199791 | 3300011271 | Vadose Zone Soil | EYALGKIKALAGSKFDAVVVNALDAAVNAGRLRLSAVEVQV* |
| Ga0137393_103312793 | 3300011271 | Vadose Zone Soil | ALKRIKALTGAKFDAVVVTALESVVNAGKLRLSAVEVHV* |
| Ga0137393_105046702 | 3300011271 | Vadose Zone Soil | QTAMELDYAMNRIRALTGSKFDTVVVTALESAVNAGKLRLSAVEVHV* |
| Ga0137393_111778723 | 3300011271 | Vadose Zone Soil | DYAMNRIRALTGSKFDTVVVTALESAVNGGKLRLSAVEVHV* |
| Ga0137393_112438431 | 3300011271 | Vadose Zone Soil | IRALTGSKFDAVVVTALESAVTAGKLRLSAVEVHV* |
| Ga0137389_102576842 | 3300012096 | Vadose Zone Soil | DYALGKIRALVGTKFDPDVVDALELVVKAGKLRLAAVEVPV* |
| Ga0137389_110074821 | 3300012096 | Vadose Zone Soil | MELDYAMNRIRALTGSKFDDVVVTALESAVNAGKLRLSAVEVHV* |
| Ga0137389_113676051 | 3300012096 | Vadose Zone Soil | SAMELDYAMDRIRALTGSKFDAVVVTALESAVNAGTLRLSAVEVHV* |
| Ga0137383_109280761 | 3300012199 | Vadose Zone Soil | SAMDLDYAMDRIRALAGSKFDAVVVNALESAVNAGKLRLSAVEVHV* |
| Ga0137365_100983401 | 3300012201 | Vadose Zone Soil | MELDYAMNRIRALTGSKFDTVVVTALESAVNAGKLRLSAVEVHV* |
| Ga0137365_109302712 | 3300012201 | Vadose Zone Soil | AMELESALTRIKALTGAKFDAVIVTALDAAVTSGKLRLTAVEVQV* |
| Ga0137363_100124616 | 3300012202 | Vadose Zone Soil | ALTRIKALTGAKFDAVIVSALDAAITSGKLRLTAVEVQV* |
| Ga0137362_100443235 | 3300012205 | Vadose Zone Soil | MNRIRALTGSKFDDVVVTALESAVNAGKLRLSAVEVHV* |
| Ga0137362_102058261 | 3300012205 | Vadose Zone Soil | RIRALTGSKFDAMVVTALESAVNAGKLRLSAVEVHV* |
| Ga0137362_114674401 | 3300012205 | Vadose Zone Soil | TKIKALAGSKFDTVVVNALDAAVNAGRLRLSAVEVQV* |
| Ga0137362_116085751 | 3300012205 | Vadose Zone Soil | EYALDRIRALTGSKFDAVVVTALDSAVKHGKLRLSAVEVHV* |
| Ga0137377_113702031 | 3300012211 | Vadose Zone Soil | DLDYAMDRIRALAGSKFDAVVVNALESVVNAGKLRLSAVEVHV* |
| Ga0137387_102480002 | 3300012349 | Vadose Zone Soil | MTRIRALTGSKFDTVVVTALESAVNAGKLRLSAVEVHV* |
| Ga0137387_110521141 | 3300012349 | Vadose Zone Soil | IRALTGSKFDAIVVTALESAVNAGKLRLSAVEVHV* |
| Ga0137371_105630271 | 3300012356 | Vadose Zone Soil | TAMELESALTRIKALTGAKFDAVIVTALDAAVTSGKLRLTAVEVQV* |
| Ga0137360_110533292 | 3300012361 | Vadose Zone Soil | SAMDLDYALGKIKALAGSKFDAVVVNALDATVMAGKLRLSAVEVQV* |
| Ga0137361_104526541 | 3300012362 | Vadose Zone Soil | KIKALAGSKFDTVVVNALDAAVNAGRLRLSAVEVQV* |
| Ga0137390_105023492 | 3300012363 | Vadose Zone Soil | EYALDRIRALTGSKFDAVIVTALESAVNAGKLRLSAVEVHV* |
| Ga0137390_116299451 | 3300012363 | Vadose Zone Soil | PYQTAMELDYAMNRIRALTGSKFDTVVVTALESAVNGGKLRLSAVEVHV* |
| Ga0137390_116673202 | 3300012363 | Vadose Zone Soil | LDRIRALTGSKFDAVVVTALDSAVQHGKLRLSAVEVHV* |
| Ga0137358_106887062 | 3300012582 | Vadose Zone Soil | IKALAGSKFDAVIVAALESAVNGGKLHVAAVEVQV* |
| Ga0137358_108961931 | 3300012582 | Vadose Zone Soil | IRALAGSKFDDVVVTALEATVTAGKLRLSAVEVHV* |
| Ga0137398_106189882 | 3300012683 | Vadose Zone Soil | KALAGSKFDAVVVNALDATVMAGKLRLSAVEVQV* |
| Ga0137397_107967901 | 3300012685 | Vadose Zone Soil | LDFALARIKALAGTKFDAVIVAALESAVSSGKLHVAAVEVQV* |
| Ga0137394_111590342 | 3300012922 | Vadose Zone Soil | MDLDYALGKIKALAGSKFDAVVVNALDATVMAGKLRLSAVEVQV* |
| Ga0137413_113212703 | 3300012924 | Vadose Zone Soil | YALGKIKALSGSKFDAVVVNALDATVMAGKLRLSAVEVQV* |
| Ga0137407_112051401 | 3300012930 | Vadose Zone Soil | KALSGSKFDTVVVTALEATVMAGKLRLSAVEVQV* |
| Ga0137407_119521661 | 3300012930 | Vadose Zone Soil | LESALTRIKALTGAKFDAVIVAALDAAVTSGKLRLTAVEVQV* |
| Ga0137410_120237381 | 3300012944 | Vadose Zone Soil | LEYALDRIRALTGSKFDAVVVTALDSAVQHGKLRLSAVEVHV* |
| Ga0126375_117135571 | 3300012948 | Tropical Forest Soil | LNRIKSLTGSKFDGAVVTALDAAIQTGKLRLSAVEVHV* |
| Ga0157307_11798711 | 3300013096 | Soil | NAMDLDFALKRIQSLTGAKFDAVVVAALESAVTGGKLRLSAVEVQV* |
| Ga0134075_104353431 | 3300014154 | Grasslands Soil | LDYAMDRIRALAGSKFDAVVVNALESAVNAGKLRLSAVEVHV* |
| Ga0182024_101786381 | 3300014501 | Permafrost | KALSGSKFDTVVVNALDAAVTNGKLRLSAVEVQV* |
| Ga0157376_123594532 | 3300014969 | Miscanthus Rhizosphere | LDYALDKIKNLAGAKFDAVVVNALESAVTSGKLRLSAVEVQV* |
| Ga0137420_13051221 | 3300015054 | Vadose Zone Soil | RDGPHSLEYAMDRIRALTGSKFDAVVVTALESAVNAGKLRLSAVEVHV* |
| Ga0132257_1022656261 | 3300015373 | Arabidopsis Rhizosphere | AMDLDFALKRIQSLTGAKFDAVVVAALESAVTGGKLRLSAVEVQV* |
| Ga0182041_115458491 | 3300016294 | Soil | RIQSLTGAKFDAVVVSALESAINGGKLRLSAVEVQV |
| Ga0182033_112065882 | 3300016319 | Soil | GRIKALAGSKFDPEVVNALESAVRAGKVRLSAVEVQV |
| Ga0182035_119783881 | 3300016341 | Soil | RIKALAGSKFDETIVSALESAVKAGKLRLTAVEVHV |
| Ga0182032_112899862 | 3300016357 | Soil | LDYALGRVKALAGSKFDQAVVDALESAVNAGKIRLSAVEVHV |
| Ga0187802_101192021 | 3300017822 | Freshwater Sediment | IRSLTGTKFDAVVVNALESAVNAGKLRLSAVEVHV |
| Ga0187802_103577081 | 3300017822 | Freshwater Sediment | LERIRSLTGTKFDAVVVNALESAVNAGKLRLSAVEVHV |
| Ga0187780_112814611 | 3300017973 | Tropical Peatland | MDLPYALGRIKALAGSKFDQAVVNALEVAVNSGKIRLSAVEVHV |
| Ga0187822_103918622 | 3300017994 | Freshwater Sediment | DRIRALAGTKFDPVVVTALDSAVQHGKLRLSAVEVHV |
| Ga0187870_12585512 | 3300017998 | Peatland | IKALAGSKFDQAIVNALESAVKSGKIRLSAVEVHV |
| Ga0187804_105662812 | 3300018006 | Freshwater Sediment | AMDLDYALGRIKALTGSKFDQAIVNALESAVKSGKIRLSAVEVHV |
| Ga0187810_104056261 | 3300018012 | Freshwater Sediment | RVKALAGSKFDQAVVNALESAVKSGKIRLSAVEVHV |
| Ga0187788_103335561 | 3300018032 | Tropical Peatland | DYALGRIKALTGSKFDQTVVNALESAIKSGKIRLSAVEVNV |
| Ga0187771_110661511 | 3300018088 | Tropical Peatland | ERIRSLTGSKFDAVVVNALESAVQHGKLRLSAVEVHV |
| Ga0187771_116154761 | 3300018088 | Tropical Peatland | IKALTGSKFDQTVVTALESAVRLGKIRLTAVEVNV |
| Ga0187770_104502551 | 3300018090 | Tropical Peatland | SAMDLDYALGRIKALAGSKFDQAIVNALESAVKSGKIRLSAVEVQV |
| Ga0193724_10258102 | 3300020062 | Soil | LEFALTRIKALTGAKFDAVIVGALDAAITSGKLRLTAVEVQV |
| Ga0179590_11021333 | 3300020140 | Vadose Zone Soil | DYALGRIKALAGSKFDESIVIALESVVKAGKLRLTAVEVQV |
| Ga0179594_104017272 | 3300020170 | Vadose Zone Soil | RIKALTGAKFDAVIVGALDAAITSGKLRLTAVEVQV |
| Ga0210407_110794912 | 3300020579 | Soil | AMNRIRALTGSKFDAVVVTALESAVNAGKLRLSAVEVHV |
| Ga0210407_111917831 | 3300020579 | Soil | LGRIKALAGSKFDETIVIALESAVKAGKLRLTAVEVQV |
| Ga0210407_114140941 | 3300020579 | Soil | ALNRIKSLTGSKFDAVVVAALESTITTGKLRLSAVEVTV |
| Ga0210399_103241612 | 3300020581 | Soil | SAMDLDYALGKIKALAGSKFDTIVVNALEATVMAGKLRLSAVEVQV |
| Ga0210399_103348172 | 3300020581 | Soil | IKALAGSKFDEVVVVALESAVKAGKLRLTAVEVQV |
| Ga0215015_107010911 | 3300021046 | Soil | DYALGKIKALTGTKFDTIVVNALESAITAGKLRLSAVEVQV |
| Ga0179596_101842821 | 3300021086 | Vadose Zone Soil | DYALGKIKALSGSKFDAVVVNALDATVMAGKLRLSAVEVQV |
| Ga0210404_106514432 | 3300021088 | Soil | RIRALTGSKFDAVVVTALESAVNAGKLRLSAVEVHV |
| Ga0210406_107039241 | 3300021168 | Soil | YQTAMELEFALTRIKALTGAKFDAVIVGALDAAITSGKLRLTAVEVQV |
| Ga0210396_104386631 | 3300021180 | Soil | PYQTAMDLDYALGRIKALAGSKFDEAIVEALESAVKTGKLRLTAVEVQV |
| Ga0210388_112612381 | 3300021181 | Soil | KIKALAGSKFDTVVVNALDAAVTNGKLRLSAVEVQV |
| Ga0210385_115257951 | 3300021402 | Soil | GRIKALAGSKFDESIVIALESAVKSGKLRLTAVEVQV |
| Ga0210389_100875644 | 3300021404 | Soil | RIKSLTGSKFDAVVVNALESSINSGKLRLSAVEVTV |
| Ga0210389_115675311 | 3300021404 | Soil | MELDYAMNRIRALTGSKFDAVVVTALESAVNAGKLRLSAVEVHV |
| Ga0210386_101045554 | 3300021406 | Soil | IKALTGSKFDQSVVNALESAVKAGKLRLSAVEVHV |
| Ga0210386_101045581 | 3300021406 | Soil | DIEFALNRIKSLTGSKFDAVVVNALESSINSGKLRLSAVEVTV |
| Ga0210386_106949782 | 3300021406 | Soil | IEFALNRIKSLTGSKFDTVVVNALESAINSGKLRLSAVEVTV |
| Ga0210394_102187273 | 3300021420 | Soil | PYQTAMELDYAMDRIRALTGSKFDAVVVTALESAVTAGKLRLSAVEVHV |
| Ga0210394_106354272 | 3300021420 | Soil | RIKSLTGSKFDAVVVAALESTIQAGKLRLSAVEVTV |
| Ga0210384_111815961 | 3300021432 | Soil | SAMELDYAMDRIRALTGSKFDSVVVTALESAVTAGKLRLSAVEVHV |
| Ga0210391_112753422 | 3300021433 | Soil | QSAMDIEFALNRIKSLTGSKFDAVVVNALESSINSGKLRLSAVEVTV |
| Ga0210392_104072362 | 3300021475 | Soil | IKSLTGSKFDAVVVNALESCINSGKLRLSAVEVTV |
| Ga0210392_105637973 | 3300021475 | Soil | MGRIRSLTGAKFDAVVVNALESAVNSGKLRLSAVEVHV |
| Ga0210392_113483141 | 3300021475 | Soil | GRIKALAGSKFDEAIVIALESAVKSGKLRLTAVEVQV |
| Ga0210402_101236161 | 3300021478 | Soil | KIKALAGTKFDTVVVNALDAAITAGRLRLSAVEVQV |
| Ga0210402_102258853 | 3300021478 | Soil | YALGRIKALAGSKFDEAIVIALESAVKSGKLRLTAVEVQV |
| Ga0210402_105817551 | 3300021478 | Soil | LDYAMNRIRALTGSKFDDVVVTALEAAVTAGKLRLSAVEVHV |
| Ga0210402_119035691 | 3300021478 | Soil | MELDYAMDRIRALTGSKFDAVVVTALESAVTAGKLRLSAVEVHV |
| Ga0210410_112003662 | 3300021479 | Soil | DLDYALGRIKSLTGAKFDGVVVTALESAINAGKLRLSAVEVHV |
| Ga0210409_109330382 | 3300021559 | Soil | IEFALNRIKSLTGSKFDAAVVSALESAIQHGKLRLSAVEVHV |
| Ga0213853_107335761 | 3300021861 | Watersheds | PYQSALDLDFALKRIRSLTGSKFDDVVVTALESAVTKGKLRLTAVEVHV |
| Ga0242655_101955551 | 3300022532 | Soil | LNRIKSLTGSKFDAAVVSALESAIQHGKLRLSAVEVHV |
| Ga0247694_10210091 | 3300024178 | Soil | MDIEFALNRIKSLTGSKFDAVVVNALEAAIIAGKLRLSAVEVTV |
| Ga0247693_10289861 | 3300024181 | Soil | IKALSGSKFDDAIVIALESAIKAGKLRLTAVEVQV |
| Ga0247670_10614921 | 3300024283 | Soil | GRIRALAGSKFDPAIVTALDAAVTAGRLRLSAVEVQV |
| Ga0137417_11302411 | 3300024330 | Vadose Zone Soil | RIRALTGSKFDAVVVTALEAAVNAGKLRLSAVEVHV |
| Ga0207684_108630341 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | YALGKIKDLTGAKFDTVVVNALDATITAGKLRLSAVEVQV |
| Ga0207646_102782981 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | LELALSKIKALAGAKFDAVIVGALDASITNGKLRLTAVEVQV |
| Ga0207687_105010822 | 3300025927 | Miscanthus Rhizosphere | YALDKIKNLAGAKFDAVVVNALESAVTSGKLRLSAVEVQV |
| Ga0207686_103405082 | 3300025934 | Miscanthus Rhizosphere | ALKRIQSLTGAKFDAVVVAALESAVTGGKLRLSAVEVQV |
| Ga0207665_112254562 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | KIKALSGSKFDAVVVTALEATVMSGKLRLSAVEVQV |
| Ga0209849_10924571 | 3300026215 | Soil | GKIKALAGSKFDTVVVNALDAAVTNGKLRLSAVEVQV |
| Ga0209438_10890912 | 3300026285 | Grasslands Soil | YALGKIKALAGSKFDAVVVNALDATVMAGKLRLSAVEVQV |
| Ga0209890_102020641 | 3300026291 | Soil | LGKIKALAGSKFDTVVVNALDAAVTNGKLRLSAVEVHV |
| Ga0209234_11356501 | 3300026295 | Grasslands Soil | RPYQTAMELDYAMDRIRALTGSKFDAIVVTALESAVNAGKLRLSAVEVHV |
| Ga0209240_10894391 | 3300026304 | Grasslands Soil | YALGKIKALAGSKFDAVVVNALEAAVTAGRVRLSAVEVQV |
| Ga0209055_11139343 | 3300026309 | Soil | IRALTGSKFDAIVVTALESAVNAGKLRLSAVEVHV |
| Ga0209239_11447581 | 3300026310 | Grasslands Soil | IRALAGTKFDSVVVNALESAVQHGKLRLSAVEVHV |
| Ga0209687_12869151 | 3300026322 | Soil | AMDLDYAMERIRALAGTKFDSVVVNALESAVQHGKLRLSAVEVHV |
| Ga0257171_10144723 | 3300026377 | Soil | DLDYALDRIRALTGSKFDAVVVTALDSAVQHGKLRLSAVEVHV |
| Ga0257153_10846432 | 3300026490 | Soil | YQTAMELEFALTRIKALTGAKFDAVIVSALDAAITSGKLRLTAVEVQV |
| Ga0257165_10139101 | 3300026507 | Soil | EFALTRIKALTGAKFDAVIVGALDAAITSGKLRLTAVEVQV |
| Ga0209648_102241123 | 3300026551 | Grasslands Soil | LGKIKALAGSKFDAVVVNALEAAVTAGRVRLSAVEVQV |
| Ga0209577_105325912 | 3300026552 | Soil | MDLDFALERIRNLTGTKFDAVVVNALESAVQHGKLRLSAVEVHV |
| Ga0179587_111247221 | 3300026557 | Vadose Zone Soil | RIKALTGSKFDPIVVNALEVAITAGRLLLSAVEVQV |
| Ga0207758_10147242 | 3300026895 | Tropical Forest Soil | GRVKALAGSKFDPAVVDALESAVNAGKIRLSAVEVHV |
| Ga0207858_10173731 | 3300026909 | Tropical Forest Soil | ELDYALGRIKALTGSKFDQTVVNALESAVTSGKIRLSAVEVHV |
| Ga0207777_10533381 | 3300027330 | Tropical Forest Soil | LGRIKALTGSKFDQAVVNALESAVNSGKIRLSAVEVHV |
| Ga0209179_10437641 | 3300027512 | Vadose Zone Soil | MNRIRALTGSKFDAVVVTALEAAVNAGKLRLSAVEVHV |
| Ga0209076_11515262 | 3300027643 | Vadose Zone Soil | IRALTGSKFDAVVVTALESAVNAGKLRLSAVEVHV |
| Ga0209117_11024682 | 3300027645 | Forest Soil | IKALTGAKFDAVIVGALDAAITSGKLRLTAVEVQV |
| Ga0209217_11134992 | 3300027651 | Forest Soil | IKTLAGTKFDPAIVAALESTVKAGKLRLTAVEVTV |
| Ga0209011_12222161 | 3300027678 | Forest Soil | IRTLTGSKFDAVVVAALDSAVEHGKLRLSAVEVHV |
| Ga0207862_10022141 | 3300027703 | Tropical Forest Soil | LDYALGRVKALAGSKFDQAIVDALEAAVNAGKIRLSAVEVHV |
| Ga0209248_100190371 | 3300027729 | Bog Forest Soil | WPYQNAMDLDFALARIKSLGGTKFDVVIVNALESTINAGKLRLSAVEVHV |
| Ga0209772_101267161 | 3300027768 | Bog Forest Soil | ALNRIKSLTGSKFDAVVVNALESAINAGKLRLSAVEVTV |
| Ga0209701_101015844 | 3300027862 | Vadose Zone Soil | ELDYAMNRIRALTGSKFDAVVVTALEAAVNAGKLRLSAVEVHV |
| Ga0209701_102939922 | 3300027862 | Vadose Zone Soil | ELDYAMNRIRALTGSKFDAVVVTALEAAVNAGKVRLSAVEVHV |
| Ga0209283_101245591 | 3300027875 | Vadose Zone Soil | PYQTAMELDYAMNRIRALTGSKFDAVVVTALEAAVNAGKLRLSAVEVHV |
| Ga0209283_104802491 | 3300027875 | Vadose Zone Soil | RPYQTAMELDYAMNRIRALTGSKFDTVVVTALESAVNAGKLRLSAVEVHV |
| Ga0209275_101732803 | 3300027884 | Soil | DYALGRIKALAGSKFDETIVIALESAVKAGKLRLTAVEVQV |
| Ga0209380_102191611 | 3300027889 | Soil | SAMDIEYALGRIKALTGSKFDQSVVNALESAVKAGKLRLSAVEVHV |
| Ga0209067_104291621 | 3300027898 | Watersheds | ALDLDFALKRIRSLTGSKFDDVVVTALESAVTKGKLRLTAVEVHV |
| Ga0209488_101234491 | 3300027903 | Vadose Zone Soil | RPYQTAMELDYAMNRIRALTGSKFDDVVVTALESAVNAGKLRLSAVEVHV |
| Ga0209698_104666251 | 3300027911 | Watersheds | LGRIKALAGSKFDESIVAALDSAVKAGKLRLTAVEVHV |
| Ga0265349_10003266 | 3300028037 | Soil | MDIEFALNRIKSLTGSKFDAVVVTALESAINAGKLRLSAVEVTV |
| Ga0222749_101169961 | 3300029636 | Soil | GKIKALAGSKFDTVVVNALDAAVTTGKLRLSAVEVQV |
| Ga0311356_110682712 | 3300030617 | Palsa | AMDLDFALNKIKALGGTKFDVVIVNALESTINAGKLRLSAVEVHV |
| Ga0302313_101145161 | 3300030693 | Palsa | FALGRIKALAGTKFDGVIVNALEAAVTAGRLRLSAVEVQV |
| Ga0170834_1118469312 | 3300031057 | Forest Soil | LERIKALKGTKFDPEVVNALESTIGTGKLRLSAVEVQV |
| Ga0170822_113498511 | 3300031122 | Forest Soil | PYQTAMDLDYALGRIKALAGSKFDEAIVIALESAVKAGKLRLTAVEVQV |
| Ga0265332_101577112 | 3300031238 | Rhizosphere | ELDFALGRIKALTGSKFDQTVVTALESAVKSGKIRLTSVEVHV |
| Ga0318573_102315121 | 3300031564 | Soil | YALGRVKALAGSKFDQAVVDALESAVNAGKIRLSALEIHV |
| Ga0310686_1174159691 | 3300031708 | Soil | IKSLTGSKFDAVVVNALESAINAGKLRLSAVEVTV |
| Ga0307469_113647011 | 3300031720 | Hardwood Forest Soil | ELALSKIKALAGAKFDAVIVGALDASITNGKLRLTAVEVQV |
| Ga0307469_116695822 | 3300031720 | Hardwood Forest Soil | DYALGRIKALAGSKFDEAIVVALESAVKAGKLRLTAVEVQV |
| Ga0318500_102536681 | 3300031724 | Soil | EYALGRIKALTGSKFDQAVVNALESAVKSGRIRLSAIEVHV |
| Ga0318501_108333182 | 3300031736 | Soil | DLDYALGRVKALAGSKFDPAVVDALESAVNAGRIRLSAVEVHV |
| Ga0318502_104315801 | 3300031747 | Soil | RVKALAGSKFDPAVVDALESAVNAGKIRLSAVEVHV |
| Ga0307477_107594423 | 3300031753 | Hardwood Forest Soil | TAMELDYAMNRIRALTGSKFDDVVVTALEAAVNGGKLRLSAVEVHV |
| Ga0307475_104492951 | 3300031754 | Hardwood Forest Soil | FALTKIKALTGAKFDAVIVAALDAAITSGKLRLTAVEVQV |
| Ga0307475_111436711 | 3300031754 | Hardwood Forest Soil | EYALGKIKALAGSKFDAVVVNALEAAVTAGRVRLSAVEVQV |
| Ga0307473_102957231 | 3300031820 | Hardwood Forest Soil | YAMNRIRALTGSKFDDVVVTALESAVNAGKLRLSAVEVHV |
| Ga0306919_100870501 | 3300031879 | Soil | GRVKALAGSKFDQAVVDALEAVVNAGKIRLSAVEVHV |
| Ga0306925_118956351 | 3300031890 | Soil | LGRIKALTGSKFDAIVVNALDSAIAAGRLRLSAVEVQV |
| Ga0318536_103766412 | 3300031893 | Soil | DYALGRVKALAGSKFDQAVVDALESAVNAGKIRLSALEIHV |
| Ga0310916_101440173 | 3300031942 | Soil | LGRVKALAGSKFDQAVVDALESAVNAGKIRLSALEIHV |
| Ga0306926_111265802 | 3300031954 | Soil | AMNLEYALGRIKALTGSKFDQNVVNALELAVTAGKLRLSAVEVHV |
| Ga0306926_113221251 | 3300031954 | Soil | YALGRVKALAGSKFDPAVVDALESAVNAGKIRLSAVEVHV |
| Ga0307479_101152534 | 3300031962 | Hardwood Forest Soil | RIRALTGSKFDAIVVTALESAVNAGKLRLSAVEVHV |
| Ga0307479_103270481 | 3300031962 | Hardwood Forest Soil | MELDYAMNRIRALTGSKFDDVVVTALESAVNAGKLRLSAVEVHV |
| Ga0307479_117820572 | 3300031962 | Hardwood Forest Soil | RIRALTGSKFDDVVVTALESAVNAGKLRLSAVEVHV |
| Ga0307479_119968252 | 3300031962 | Hardwood Forest Soil | YAMGKIKALTGTKFDAVVVNALDAAVTSGKLRLSAVEVQV |
| Ga0318531_102926631 | 3300031981 | Soil | ALGRIKALTGSKFDQAVVNALESAVKSGRIRLSAIEVHV |
| Ga0318533_104256021 | 3300032059 | Soil | RVKALAGSKFDQAVVDALESAVNAGKIRLSALEIHV |
| Ga0306924_122952042 | 3300032076 | Soil | IQALSGAKFDAVVVSALEAAVTGGKLRLSAVEVQV |
| Ga0307471_1000777364 | 3300032180 | Hardwood Forest Soil | QTAMELDYAMGRIRALAGSKFDPAIVAALDVAVTAGKLKLSAVEVQV |
| Ga0307471_1025220071 | 3300032180 | Hardwood Forest Soil | DRIRALTGSKFDAVVVTALDSAVQHGKLRLSAVEVHV |
| Ga0307472_1002899001 | 3300032205 | Hardwood Forest Soil | SAMDLTYALDRIRALTGSKFDSVVVTALESAVSAGKLRLSAVEVHV |
| Ga0306920_1037996311 | 3300032261 | Soil | DFALGRIKALTGSKFDAVVVNALDSAIAAGRLRLSAVEVQV |
| Ga0335070_108323761 | 3300032829 | Soil | LGRIKALAGSKFDESIVAALESAVKAGKLRLTAVEVHV |
| Ga0310914_111505411 | 3300033289 | Soil | LGRVKALAGSKFDPAVVDALESAVNAGKIRLSAVEVHV |
| Ga0364934_0134875_31_165 | 3300034178 | Sediment | MDLDFALERIKQLGGTKFDPVVVGALEGIIQKGKLRLSAVEVQV |
| ⦗Top⦘ |