| Basic Information | |
|---|---|
| Family ID | F015842 |
| Family Type | Metagenome |
| Number of Sequences | 251 |
| Average Sequence Length | 48 residues |
| Representative Sequence | MAKEPTFLQGLVGSAIPLAVALAVILIATALVYTFWFGVDWITKYLF |
| Number of Associated Samples | 155 |
| Number of Associated Scaffolds | 251 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 38.25 % |
| % of genes from short scaffolds (< 2000 bps) | 88.05 % |
| Associated GOLD sequencing projects | 140 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.60 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (97.610 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (20.319 % of family members) |
| Environment Ontology (ENVO) | Unclassified (30.279 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (66.534 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 49.33% β-sheet: 0.00% Coil/Unstructured: 50.67% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.60 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 251 Family Scaffolds |
|---|---|---|
| PF02511 | Thy1 | 17.13 |
| PF04679 | DNA_ligase_A_C | 3.98 |
| PF13298 | LigD_N | 2.39 |
| PF13414 | TPR_11 | 1.20 |
| PF01497 | Peripla_BP_2 | 0.80 |
| PF01242 | PTPS | 0.80 |
| PF00330 | Aconitase | 0.80 |
| PF07992 | Pyr_redox_2 | 0.40 |
| PF00149 | Metallophos | 0.40 |
| PF07715 | Plug | 0.40 |
| PF03551 | PadR | 0.40 |
| PF01527 | HTH_Tnp_1 | 0.40 |
| PF12867 | DinB_2 | 0.40 |
| PF14706 | Tnp_DNA_bind | 0.40 |
| COG ID | Name | Functional Category | % Frequency in 251 Family Scaffolds |
|---|---|---|---|
| COG1351 | Thymidylate synthase ThyX, FAD-dependent family | Nucleotide transport and metabolism [F] | 17.13 |
| COG1793 | ATP-dependent DNA ligase | Replication, recombination and repair [L] | 3.98 |
| COG0614 | ABC-type Fe3+-hydroxamate transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.80 |
| COG0720 | 6-pyruvoyl-tetrahydropterin synthase | Coenzyme transport and metabolism [H] | 0.80 |
| COG4558 | ABC-type hemin transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.80 |
| COG4592 | ABC-type Fe2+-enterobactin transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.80 |
| COG4594 | ABC-type Fe3+-citrate transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.80 |
| COG4607 | ABC-type enterochelin transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.80 |
| COG1695 | DNA-binding transcriptional regulator, PadR family | Transcription [K] | 0.40 |
| COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 0.40 |
| COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 0.40 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 97.61 % |
| Unclassified | root | N/A | 2.39 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000793|AF_2010_repII_A001DRAFT_10037093 | All Organisms → cellular organisms → Bacteria | 1125 | Open in IMG/M |
| 3300000955|JGI1027J12803_102303566 | All Organisms → cellular organisms → Bacteria | 945 | Open in IMG/M |
| 3300000955|JGI1027J12803_105640381 | All Organisms → cellular organisms → Bacteria | 793 | Open in IMG/M |
| 3300000956|JGI10216J12902_123648961 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
| 3300002558|JGI25385J37094_10006768 | All Organisms → cellular organisms → Bacteria | 4045 | Open in IMG/M |
| 3300003319|soilL2_10027413 | All Organisms → cellular organisms → Bacteria | 1492 | Open in IMG/M |
| 3300003321|soilH1_10285401 | All Organisms → cellular organisms → Bacteria | 3061 | Open in IMG/M |
| 3300004114|Ga0062593_101018312 | All Organisms → cellular organisms → Bacteria | 851 | Open in IMG/M |
| 3300004114|Ga0062593_103136979 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
| 3300005093|Ga0062594_101760583 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 650 | Open in IMG/M |
| 3300005166|Ga0066674_10097926 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1360 | Open in IMG/M |
| 3300005166|Ga0066674_10193341 | All Organisms → cellular organisms → Bacteria | 968 | Open in IMG/M |
| 3300005167|Ga0066672_10304895 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1035 | Open in IMG/M |
| 3300005171|Ga0066677_10066292 | All Organisms → cellular organisms → Bacteria | 1844 | Open in IMG/M |
| 3300005172|Ga0066683_10341743 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 929 | Open in IMG/M |
| 3300005172|Ga0066683_10640762 | All Organisms → cellular organisms → Bacteria | 638 | Open in IMG/M |
| 3300005174|Ga0066680_10177575 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1340 | Open in IMG/M |
| 3300005176|Ga0066679_10119241 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1624 | Open in IMG/M |
| 3300005178|Ga0066688_10077523 | All Organisms → cellular organisms → Bacteria | 1988 | Open in IMG/M |
| 3300005178|Ga0066688_10224181 | All Organisms → cellular organisms → Bacteria | 1199 | Open in IMG/M |
| 3300005180|Ga0066685_10557832 | All Organisms → cellular organisms → Bacteria | 790 | Open in IMG/M |
| 3300005181|Ga0066678_10122851 | All Organisms → cellular organisms → Bacteria | 1597 | Open in IMG/M |
| 3300005186|Ga0066676_10268454 | All Organisms → cellular organisms → Bacteria | 1119 | Open in IMG/M |
| 3300005187|Ga0066675_10182484 | All Organisms → cellular organisms → Bacteria | 1463 | Open in IMG/M |
| 3300005187|Ga0066675_11374319 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300005295|Ga0065707_10279855 | All Organisms → cellular organisms → Bacteria | 1050 | Open in IMG/M |
| 3300005295|Ga0065707_10896885 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 568 | Open in IMG/M |
| 3300005329|Ga0070683_100820986 | All Organisms → cellular organisms → Bacteria | 891 | Open in IMG/M |
| 3300005332|Ga0066388_100102404 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3332 | Open in IMG/M |
| 3300005332|Ga0066388_100176854 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2739 | Open in IMG/M |
| 3300005332|Ga0066388_101871293 | All Organisms → cellular organisms → Bacteria | 1070 | Open in IMG/M |
| 3300005332|Ga0066388_102029826 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1032 | Open in IMG/M |
| 3300005332|Ga0066388_102228430 | All Organisms → cellular organisms → Bacteria | 989 | Open in IMG/M |
| 3300005332|Ga0066388_102644938 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 915 | Open in IMG/M |
| 3300005332|Ga0066388_102808752 | All Organisms → cellular organisms → Bacteria | 890 | Open in IMG/M |
| 3300005332|Ga0066388_102913078 | All Organisms → cellular organisms → Bacteria | 875 | Open in IMG/M |
| 3300005332|Ga0066388_103181454 | All Organisms → cellular organisms → Bacteria | 839 | Open in IMG/M |
| 3300005332|Ga0066388_103581476 | All Organisms → cellular organisms → Bacteria | 793 | Open in IMG/M |
| 3300005332|Ga0066388_105929430 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 617 | Open in IMG/M |
| 3300005332|Ga0066388_106686227 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
| 3300005333|Ga0070677_10378736 | All Organisms → cellular organisms → Bacteria | 740 | Open in IMG/M |
| 3300005340|Ga0070689_100690881 | All Organisms → cellular organisms → Bacteria | 890 | Open in IMG/M |
| 3300005340|Ga0070689_101804457 | Not Available | 558 | Open in IMG/M |
| 3300005354|Ga0070675_101359334 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 655 | Open in IMG/M |
| 3300005434|Ga0070709_11095957 | All Organisms → cellular organisms → Bacteria | 637 | Open in IMG/M |
| 3300005436|Ga0070713_100572211 | All Organisms → cellular organisms → Bacteria | 1071 | Open in IMG/M |
| 3300005445|Ga0070708_100063876 | All Organisms → cellular organisms → Bacteria | 3296 | Open in IMG/M |
| 3300005445|Ga0070708_101931686 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 547 | Open in IMG/M |
| 3300005446|Ga0066686_10113759 | All Organisms → cellular organisms → Bacteria | 1756 | Open in IMG/M |
| 3300005446|Ga0066686_10550133 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 784 | Open in IMG/M |
| 3300005446|Ga0066686_10698556 | All Organisms → cellular organisms → Bacteria | 685 | Open in IMG/M |
| 3300005446|Ga0066686_10951461 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
| 3300005451|Ga0066681_10292814 | All Organisms → cellular organisms → Bacteria | 994 | Open in IMG/M |
| 3300005518|Ga0070699_101828449 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
| 3300005518|Ga0070699_102085948 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 518 | Open in IMG/M |
| 3300005531|Ga0070738_10029837 | All Organisms → cellular organisms → Bacteria | 3840 | Open in IMG/M |
| 3300005536|Ga0070697_100090802 | All Organisms → cellular organisms → Bacteria | 2525 | Open in IMG/M |
| 3300005540|Ga0066697_10645529 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 583 | Open in IMG/M |
| 3300005552|Ga0066701_10072843 | All Organisms → cellular organisms → Bacteria | 1951 | Open in IMG/M |
| 3300005554|Ga0066661_10670494 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 610 | Open in IMG/M |
| 3300005559|Ga0066700_10040422 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2804 | Open in IMG/M |
| 3300005559|Ga0066700_10636283 | All Organisms → cellular organisms → Bacteria | 740 | Open in IMG/M |
| 3300005559|Ga0066700_11001304 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 550 | Open in IMG/M |
| 3300005560|Ga0066670_11031203 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 503 | Open in IMG/M |
| 3300005561|Ga0066699_10057210 | All Organisms → cellular organisms → Bacteria | 2425 | Open in IMG/M |
| 3300005568|Ga0066703_10674714 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
| 3300005586|Ga0066691_10801717 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
| 3300005598|Ga0066706_10826829 | All Organisms → cellular organisms → Bacteria | 728 | Open in IMG/M |
| 3300005598|Ga0066706_11299991 | Not Available | 550 | Open in IMG/M |
| 3300005713|Ga0066905_100031489 | All Organisms → cellular organisms → Bacteria | 3016 | Open in IMG/M |
| 3300005713|Ga0066905_100175249 | All Organisms → cellular organisms → Bacteria | 1575 | Open in IMG/M |
| 3300005764|Ga0066903_100087887 | All Organisms → cellular organisms → Bacteria | 4107 | Open in IMG/M |
| 3300005764|Ga0066903_100962275 | All Organisms → cellular organisms → Bacteria | 1555 | Open in IMG/M |
| 3300005764|Ga0066903_102021650 | All Organisms → cellular organisms → Bacteria | 1107 | Open in IMG/M |
| 3300005764|Ga0066903_102789785 | All Organisms → cellular organisms → Bacteria | 948 | Open in IMG/M |
| 3300005764|Ga0066903_104374191 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 755 | Open in IMG/M |
| 3300005764|Ga0066903_104885742 | All Organisms → cellular organisms → Bacteria | 712 | Open in IMG/M |
| 3300005764|Ga0066903_105623736 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 660 | Open in IMG/M |
| 3300005764|Ga0066903_107267176 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
| 3300005840|Ga0068870_10625379 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 734 | Open in IMG/M |
| 3300005937|Ga0081455_10662978 | All Organisms → cellular organisms → Bacteria | 670 | Open in IMG/M |
| 3300006034|Ga0066656_10561121 | All Organisms → cellular organisms → Bacteria | 741 | Open in IMG/M |
| 3300006046|Ga0066652_100668969 | All Organisms → cellular organisms → Bacteria | 986 | Open in IMG/M |
| 3300006049|Ga0075417_10372370 | All Organisms → cellular organisms → Bacteria | 703 | Open in IMG/M |
| 3300006058|Ga0075432_10596348 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300006796|Ga0066665_10072399 | All Organisms → cellular organisms → Bacteria | 2451 | Open in IMG/M |
| 3300006796|Ga0066665_11543074 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300006797|Ga0066659_10601549 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 892 | Open in IMG/M |
| 3300006797|Ga0066659_10929697 | All Organisms → cellular organisms → Bacteria | 727 | Open in IMG/M |
| 3300006797|Ga0066659_11788456 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 520 | Open in IMG/M |
| 3300006797|Ga0066659_11818030 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300006800|Ga0066660_10280634 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1319 | Open in IMG/M |
| 3300006844|Ga0075428_100131867 | All Organisms → cellular organisms → Bacteria | 2717 | Open in IMG/M |
| 3300006844|Ga0075428_100298869 | All Organisms → cellular organisms → Bacteria | 1731 | Open in IMG/M |
| 3300006844|Ga0075428_100794421 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1006 | Open in IMG/M |
| 3300006845|Ga0075421_100006920 | All Organisms → cellular organisms → Bacteria | 13860 | Open in IMG/M |
| 3300006854|Ga0075425_100860199 | All Organisms → cellular organisms → Bacteria | 1037 | Open in IMG/M |
| 3300006871|Ga0075434_101624516 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 655 | Open in IMG/M |
| 3300006904|Ga0075424_101433396 | All Organisms → cellular organisms → Bacteria | 733 | Open in IMG/M |
| 3300009012|Ga0066710_100421683 | All Organisms → cellular organisms → Bacteria | 1994 | Open in IMG/M |
| 3300009012|Ga0066710_103511932 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 593 | Open in IMG/M |
| 3300009012|Ga0066710_104910518 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300009089|Ga0099828_11021574 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 736 | Open in IMG/M |
| 3300009094|Ga0111539_12544407 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 593 | Open in IMG/M |
| 3300009148|Ga0105243_11735774 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 654 | Open in IMG/M |
| 3300009162|Ga0075423_10284811 | All Organisms → cellular organisms → Bacteria | 1731 | Open in IMG/M |
| 3300009162|Ga0075423_10653857 | All Organisms → cellular organisms → Bacteria | 1109 | Open in IMG/M |
| 3300009176|Ga0105242_11955037 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 628 | Open in IMG/M |
| 3300009176|Ga0105242_12301204 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 585 | Open in IMG/M |
| 3300009177|Ga0105248_12665514 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 570 | Open in IMG/M |
| 3300009609|Ga0105347_1327202 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 650 | Open in IMG/M |
| 3300009609|Ga0105347_1526406 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300009792|Ga0126374_10657026 | All Organisms → cellular organisms → Bacteria | 782 | Open in IMG/M |
| 3300009792|Ga0126374_11541600 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 547 | Open in IMG/M |
| 3300010046|Ga0126384_10037558 | All Organisms → cellular organisms → Bacteria | 3263 | Open in IMG/M |
| 3300010046|Ga0126384_11243087 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 688 | Open in IMG/M |
| 3300010047|Ga0126382_10505276 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 973 | Open in IMG/M |
| 3300010047|Ga0126382_11376153 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
| 3300010304|Ga0134088_10031178 | All Organisms → cellular organisms → Bacteria | 2406 | Open in IMG/M |
| 3300010322|Ga0134084_10457470 | Not Available | 509 | Open in IMG/M |
| 3300010329|Ga0134111_10061675 | All Organisms → cellular organisms → Bacteria | 1382 | Open in IMG/M |
| 3300010329|Ga0134111_10329058 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
| 3300010336|Ga0134071_10324595 | All Organisms → cellular organisms → Bacteria | 775 | Open in IMG/M |
| 3300010337|Ga0134062_10070570 | Not Available | 1457 | Open in IMG/M |
| 3300010358|Ga0126370_11201496 | All Organisms → cellular organisms → Bacteria | 705 | Open in IMG/M |
| 3300010358|Ga0126370_12428345 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 521 | Open in IMG/M |
| 3300010359|Ga0126376_11431265 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 717 | Open in IMG/M |
| 3300010359|Ga0126376_12056467 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 614 | Open in IMG/M |
| 3300010360|Ga0126372_10346249 | All Organisms → cellular organisms → Bacteria | 1331 | Open in IMG/M |
| 3300010360|Ga0126372_10417552 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1231 | Open in IMG/M |
| 3300010360|Ga0126372_10438897 | All Organisms → cellular organisms → Bacteria | 1205 | Open in IMG/M |
| 3300010360|Ga0126372_11989065 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 628 | Open in IMG/M |
| 3300010360|Ga0126372_13210225 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 508 | Open in IMG/M |
| 3300010362|Ga0126377_13081774 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
| 3300010366|Ga0126379_12651220 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 598 | Open in IMG/M |
| 3300010366|Ga0126379_12667028 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 597 | Open in IMG/M |
| 3300010376|Ga0126381_102344117 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 766 | Open in IMG/M |
| 3300010376|Ga0126381_105023367 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 507 | Open in IMG/M |
| 3300010397|Ga0134124_10210029 | All Organisms → cellular organisms → Bacteria | 1772 | Open in IMG/M |
| 3300010397|Ga0134124_11435522 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 717 | Open in IMG/M |
| 3300010398|Ga0126383_11836281 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 694 | Open in IMG/M |
| 3300010398|Ga0126383_12196079 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 638 | Open in IMG/M |
| 3300010398|Ga0126383_13316626 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300010400|Ga0134122_11041535 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 805 | Open in IMG/M |
| 3300010401|Ga0134121_11148305 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 773 | Open in IMG/M |
| 3300010401|Ga0134121_12295639 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
| 3300010401|Ga0134121_12473826 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 561 | Open in IMG/M |
| 3300010403|Ga0134123_11064634 | All Organisms → cellular organisms → Bacteria | 829 | Open in IMG/M |
| 3300011119|Ga0105246_10534737 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1001 | Open in IMG/M |
| 3300012189|Ga0137388_10845613 | All Organisms → cellular organisms → Bacteria | 847 | Open in IMG/M |
| 3300012202|Ga0137363_10690322 | All Organisms → cellular organisms → Bacteria | 864 | Open in IMG/M |
| 3300012203|Ga0137399_10165802 | All Organisms → cellular organisms → Bacteria | 1775 | Open in IMG/M |
| 3300012206|Ga0137380_11437272 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_2_55_15 | 574 | Open in IMG/M |
| 3300012207|Ga0137381_11245404 | All Organisms → cellular organisms → Bacteria | 637 | Open in IMG/M |
| 3300012209|Ga0137379_11818942 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300012210|Ga0137378_10289753 | All Organisms → cellular organisms → Bacteria | 1523 | Open in IMG/M |
| 3300012211|Ga0137377_10343417 | All Organisms → cellular organisms → Bacteria | 1429 | Open in IMG/M |
| 3300012211|Ga0137377_11212204 | All Organisms → cellular organisms → Bacteria | 684 | Open in IMG/M |
| 3300012211|Ga0137377_11515901 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 596 | Open in IMG/M |
| 3300012285|Ga0137370_10712358 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_2_55_15 | 623 | Open in IMG/M |
| 3300012351|Ga0137386_11292663 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_2_55_15 | 506 | Open in IMG/M |
| 3300012359|Ga0137385_10342084 | All Organisms → cellular organisms → Bacteria | 1281 | Open in IMG/M |
| 3300012362|Ga0137361_10825810 | All Organisms → cellular organisms → Bacteria | 843 | Open in IMG/M |
| 3300012925|Ga0137419_11677299 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
| 3300012944|Ga0137410_10790803 | All Organisms → cellular organisms → Bacteria | 796 | Open in IMG/M |
| 3300012944|Ga0137410_11900159 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 527 | Open in IMG/M |
| 3300012948|Ga0126375_11053626 | All Organisms → cellular organisms → Bacteria | 666 | Open in IMG/M |
| 3300012948|Ga0126375_11101666 | All Organisms → cellular organisms → Bacteria | 654 | Open in IMG/M |
| 3300012948|Ga0126375_11584138 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_2_55_15 | 563 | Open in IMG/M |
| 3300012960|Ga0164301_11797775 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 515 | Open in IMG/M |
| 3300012971|Ga0126369_10008134 | All Organisms → cellular organisms → Bacteria | 7930 | Open in IMG/M |
| 3300012971|Ga0126369_10386536 | All Organisms → cellular organisms → Bacteria | 1433 | Open in IMG/M |
| 3300012971|Ga0126369_10769301 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1044 | Open in IMG/M |
| 3300012971|Ga0126369_11110762 | All Organisms → cellular organisms → Bacteria | 880 | Open in IMG/M |
| 3300012971|Ga0126369_13375299 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 523 | Open in IMG/M |
| 3300012972|Ga0134077_10358289 | All Organisms → cellular organisms → Bacteria | 623 | Open in IMG/M |
| 3300012976|Ga0134076_10323173 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
| 3300013307|Ga0157372_12555312 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
| 3300015357|Ga0134072_10270331 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 621 | Open in IMG/M |
| 3300015371|Ga0132258_10058616 | All Organisms → cellular organisms → Bacteria | 8856 | Open in IMG/M |
| 3300015371|Ga0132258_10316752 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3843 | Open in IMG/M |
| 3300015371|Ga0132258_10805117 | All Organisms → cellular organisms → Bacteria | 2369 | Open in IMG/M |
| 3300015371|Ga0132258_12626258 | All Organisms → cellular organisms → Bacteria | 1258 | Open in IMG/M |
| 3300015374|Ga0132255_100952659 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 1286 | Open in IMG/M |
| 3300015374|Ga0132255_101159875 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1163 | Open in IMG/M |
| 3300016294|Ga0182041_11995943 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
| 3300016294|Ga0182041_12141626 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 522 | Open in IMG/M |
| 3300016319|Ga0182033_11210517 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 677 | Open in IMG/M |
| 3300016319|Ga0182033_11263976 | Not Available | 662 | Open in IMG/M |
| 3300016341|Ga0182035_10753599 | All Organisms → cellular organisms → Bacteria | 851 | Open in IMG/M |
| 3300016341|Ga0182035_10831930 | All Organisms → cellular organisms → Bacteria | 811 | Open in IMG/M |
| 3300016422|Ga0182039_11974165 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 536 | Open in IMG/M |
| 3300016445|Ga0182038_10246758 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1433 | Open in IMG/M |
| 3300017654|Ga0134069_1049279 | All Organisms → cellular organisms → Bacteria | 1323 | Open in IMG/M |
| 3300017656|Ga0134112_10466203 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300017659|Ga0134083_10047846 | All Organisms → cellular organisms → Bacteria | 1603 | Open in IMG/M |
| 3300017659|Ga0134083_10271605 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 714 | Open in IMG/M |
| 3300018058|Ga0187766_10914081 | All Organisms → cellular organisms → Bacteria | 620 | Open in IMG/M |
| 3300018431|Ga0066655_10029091 | All Organisms → cellular organisms → Bacteria | 2672 | Open in IMG/M |
| 3300018431|Ga0066655_10395790 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 911 | Open in IMG/M |
| 3300018433|Ga0066667_10007116 | All Organisms → cellular organisms → Bacteria | 5068 | Open in IMG/M |
| 3300018433|Ga0066667_10580306 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 933 | Open in IMG/M |
| 3300018433|Ga0066667_11050104 | All Organisms → cellular organisms → Bacteria | 704 | Open in IMG/M |
| 3300018433|Ga0066667_11185332 | All Organisms → cellular organisms → Bacteria | 664 | Open in IMG/M |
| 3300018468|Ga0066662_10164882 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1698 | Open in IMG/M |
| 3300018468|Ga0066662_10229322 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1497 | Open in IMG/M |
| 3300018468|Ga0066662_11630773 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
| 3300020582|Ga0210395_10839959 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 684 | Open in IMG/M |
| 3300021168|Ga0210406_10405164 | All Organisms → cellular organisms → Bacteria | 1092 | Open in IMG/M |
| 3300021444|Ga0213878_10355381 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 634 | Open in IMG/M |
| 3300021476|Ga0187846_10301451 | All Organisms → cellular organisms → Bacteria | 663 | Open in IMG/M |
| 3300021560|Ga0126371_12189531 | All Organisms → cellular organisms → Bacteria | 667 | Open in IMG/M |
| 3300025893|Ga0207682_10439564 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 617 | Open in IMG/M |
| 3300025906|Ga0207699_10588261 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 810 | Open in IMG/M |
| 3300025908|Ga0207643_10658649 | Not Available | 676 | Open in IMG/M |
| 3300025921|Ga0207652_10520783 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1070 | Open in IMG/M |
| 3300025922|Ga0207646_10142122 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2162 | Open in IMG/M |
| 3300025922|Ga0207646_11812742 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
| 3300025926|Ga0207659_10918532 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 753 | Open in IMG/M |
| 3300026296|Ga0209235_1046300 | All Organisms → cellular organisms → Bacteria | 2124 | Open in IMG/M |
| 3300026306|Ga0209468_1016635 | All Organisms → cellular organisms → Bacteria | 2669 | Open in IMG/M |
| 3300026306|Ga0209468_1140808 | All Organisms → cellular organisms → Bacteria | 656 | Open in IMG/M |
| 3300026310|Ga0209239_1136648 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 996 | Open in IMG/M |
| 3300026323|Ga0209472_1203858 | All Organisms → cellular organisms → Bacteria | 668 | Open in IMG/M |
| 3300026329|Ga0209375_1023917 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 3442 | Open in IMG/M |
| 3300026329|Ga0209375_1281057 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_2_55_15 | 546 | Open in IMG/M |
| 3300026540|Ga0209376_1024527 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3907 | Open in IMG/M |
| 3300026547|Ga0209156_10389791 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 586 | Open in IMG/M |
| 3300026552|Ga0209577_10215239 | All Organisms → cellular organisms → Bacteria | 1467 | Open in IMG/M |
| 3300027513|Ga0208685_1094730 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 642 | Open in IMG/M |
| 3300027835|Ga0209515_10500785 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 628 | Open in IMG/M |
| 3300027869|Ga0209579_10632400 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 580 | Open in IMG/M |
| 3300027873|Ga0209814_10133207 | All Organisms → cellular organisms → Bacteria | 1062 | Open in IMG/M |
| 3300027874|Ga0209465_10506156 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 603 | Open in IMG/M |
| 3300027880|Ga0209481_10169982 | All Organisms → cellular organisms → Bacteria | 1082 | Open in IMG/M |
| 3300027909|Ga0209382_10179575 | All Organisms → cellular organisms → Bacteria | 2436 | Open in IMG/M |
| 3300027909|Ga0209382_11071798 | All Organisms → cellular organisms → Bacteria | 834 | Open in IMG/M |
| 3300027965|Ga0209062_1021943 | All Organisms → cellular organisms → Bacteria | 3841 | Open in IMG/M |
| 3300031231|Ga0170824_101449183 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 999 | Open in IMG/M |
| 3300031740|Ga0307468_101950317 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 561 | Open in IMG/M |
| 3300031890|Ga0306925_10228594 | All Organisms → cellular organisms → Bacteria | 2007 | Open in IMG/M |
| 3300031947|Ga0310909_10416079 | All Organisms → cellular organisms → Bacteria | 1129 | Open in IMG/M |
| 3300031947|Ga0310909_10534407 | All Organisms → cellular organisms → Bacteria | 982 | Open in IMG/M |
| 3300032180|Ga0307471_100494640 | All Organisms → cellular organisms → Bacteria | 1370 | Open in IMG/M |
| 3300032180|Ga0307471_101137475 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 946 | Open in IMG/M |
| 3300032180|Ga0307471_103321700 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
| 3300032180|Ga0307471_103363498 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| 3300032261|Ga0306920_100506530 | All Organisms → cellular organisms → Bacteria | 1791 | Open in IMG/M |
| 3300032261|Ga0306920_103199146 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 613 | Open in IMG/M |
| 3300032261|Ga0306920_103448163 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 586 | Open in IMG/M |
| 3300032421|Ga0310812_10066550 | All Organisms → cellular organisms → Bacteria | 1424 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 20.32% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 12.75% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 9.16% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 7.17% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 6.37% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 5.98% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 5.18% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.78% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.98% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.79% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.39% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.59% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.59% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.59% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 1.20% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.20% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.20% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.99% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.80% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.80% |
| Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 0.80% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.80% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.80% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.80% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.80% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater | 0.40% |
| Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil | 0.40% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.40% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.40% |
| Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 0.40% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.40% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.40% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.40% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000793 | Forest soil microbial communities from Amazon forest - 2010 replicate II A001 | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300002558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm | Environmental | Open in IMG/M |
| 3300003319 | Sugarcane bulk soil Sample L2 | Environmental | Open in IMG/M |
| 3300003321 | Sugarcane bulk soil Sample H1 | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
| 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
| 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
| 3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005531 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen12_06102014_R2 | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006058 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Host-Associated | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009609 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT890 | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300015357 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017654 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300017656 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015 | Environmental | Open in IMG/M |
| 3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021444 | Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R02 | Environmental | Open in IMG/M |
| 3300021476 | Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2) | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026296 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026306 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 (SPAdes) | Environmental | Open in IMG/M |
| 3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 (SPAdes) | Environmental | Open in IMG/M |
| 3300026329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 (SPAdes) | Environmental | Open in IMG/M |
| 3300026540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes) | Environmental | Open in IMG/M |
| 3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300027513 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT890 (SPAdes) | Environmental | Open in IMG/M |
| 3300027835 | Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW60B uncontaminated upgradient, 5.4 m (SPAdes) | Environmental | Open in IMG/M |
| 3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027965 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen12_06102014_R2 (SPAdes) | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032421 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NN3 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| AF_2010_repII_A001DRAFT_100370932 | 3300000793 | Forest Soil | MAKEPTFLHGLLGSAVPLAVAIAVVIIATALFYTFWFG |
| JGI1027J12803_1023035662 | 3300000955 | Soil | MAKEPTFLHGLLGSAVPLAVAIAVVIIATALFYTFWFGLDWIAIWLF* |
| JGI1027J12803_1056403813 | 3300000955 | Soil | MAKEPTFLQGLLGSALPLAVAIGVVILATLLVYTFWFGLDWIS |
| JGI10216J12902_1236489612 | 3300000956 | Soil | MAKEPTFLQGLLGSAIPLAIAIAVAIIATVLYYTFWFGFGWLGDWLF* |
| JGI25385J37094_100067684 | 3300002558 | Grasslands Soil | MVKQPTFLQGLVGSAIPLAVALAVILIATALVYTFWFGVDWITKYLF* |
| soilL2_100274132 | 3300003319 | Sugarcane Root And Bulk Soil | MAKEPTFLQGLLGSAVPLAVAVVVIVIATALYYTFWYGVDWIAAWLF* |
| soilH1_102854014 | 3300003321 | Sugarcane Root And Bulk Soil | MTKEPTFLQGLLGSAIPLAVAIVVILIGTALYYTFWFGVDWIAAWLF* |
| Ga0062593_1010183122 | 3300004114 | Soil | MAKEPTFFQGLLGSAVPLAVAIVVILIATALYYTFWFGVDWIATWLF* |
| Ga0062593_1031369791 | 3300004114 | Soil | MAKEPTFLQGLVGSAIPLVVAIAVGLIATALVYTFWFGVDWLSNWLF* |
| Ga0062594_1017605832 | 3300005093 | Soil | SIRISCMAKEPTFLQGLLGSAIPLAIAVGVALLATALYYTFWFGVDWIASWLF* |
| Ga0066674_100979261 | 3300005166 | Soil | KSGLYSFRISCMVKQPTFLQGLVGSAIPLAVALAVILIATALVYTFWFGVDWITKYLF* |
| Ga0066674_101933412 | 3300005166 | Soil | MAKEPTFLQSLVGSAIPLAVALAVILLATALVYTFWFGLDWITKYLF* |
| Ga0066672_103048951 | 3300005167 | Soil | MVKEPTFLHSLVGSAIPLAVALAVILLATALVYTFWFGVDWFTRYLF* |
| Ga0066677_100662922 | 3300005171 | Soil | MVKEPTFLQGLIGSAIPLMLALAVILIATALVYTFWFGVDWITRWLF* |
| Ga0066683_103417432 | 3300005172 | Soil | KSGLYSFRISCMVKEPTFLQGLVGSAIPLAVALAVILLATALVYTFWFGVDWITKYLF* |
| Ga0066683_106407622 | 3300005172 | Soil | MAKEPTFLQGLIGSAIPLAVALAVILLATALVYTFWFGVDWITKYLF* |
| Ga0066680_101775751 | 3300005174 | Soil | GIKSGRYSFRISCMVKEPTFLEGLLGSAIPLFVAMAVILIATALVYTFWFGVDWITKWLF |
| Ga0066679_101192412 | 3300005176 | Soil | PGEKSGRYSFRISCMVKEPTFLHSLVGSAIPLAVALAVILLATALVYTFWFGVDWFTRYLF* |
| Ga0066688_100775232 | 3300005178 | Soil | MVKEPTFLQGLAGSAIPLAIALAVILIATALVYTFWFGVDWITKYLF* |
| Ga0066688_102241812 | 3300005178 | Soil | MIKEPTFLQGLIGSAIPLMLALAVILIATALVYTFWFGVDWITRWLF* |
| Ga0066685_105578321 | 3300005180 | Soil | MTKEPTFLQGLLGSAVPLAIALAVTAIATALFYTFWFGVEWFTKWLF* |
| Ga0066678_101228512 | 3300005181 | Soil | MVKEPTFLEGLVGSAIPLFVALAVILIATALVYTFWFGVDWITKWLF* |
| Ga0066676_102684542 | 3300005186 | Soil | MVKEPTFLQGLVGSAIPLAVALAVILLATALVYTFWFGVDWITKYLF* |
| Ga0066675_101824842 | 3300005187 | Soil | MIKEPTFLHSLVGSAIPLAVALAVILLATALVYTFWFGVDWFTRFLF* |
| Ga0066675_113743191 | 3300005187 | Soil | MVKEPTFLQGLLGSAIPLLIAIVVGIIATALVYTFWFGVGWFT |
| Ga0065707_102798552 | 3300005295 | Switchgrass Rhizosphere | MAKEPTFLHGLLGSAVPLAVAIAVVIIATALIYTFWFGLDWIAKWLF* |
| Ga0065707_108968852 | 3300005295 | Switchgrass Rhizosphere | EKSGRYSFRMSCMAKEPTFLQGLLGSAIPLAVAIVVIIIATALYYTFWYGVDWIATWLF* |
| Ga0070683_1008209862 | 3300005329 | Corn Rhizosphere | MAKEPTFLQGLFGSALPLLVAVIIGAIATALYYTFWYGVGWFTKWLF* |
| Ga0066388_1001024042 | 3300005332 | Tropical Forest Soil | MAKEPTFFQGLLGSAIPLAVAIGIVIVATALVYTFWFGVDWITRWLF* |
| Ga0066388_1001768541 | 3300005332 | Tropical Forest Soil | PGEKSGRYSFRISSMAKEPTFLHGLLGSAVPLAVAIAVVIIATALVYTFWFGLDWISTWLF* |
| Ga0066388_1018712932 | 3300005332 | Tropical Forest Soil | MAKEPTFLQGLLGSAIPLGIGIAIMIIATALFYTFWFGVDWITRWLF* |
| Ga0066388_1020298261 | 3300005332 | Tropical Forest Soil | KEPTFLHGLLGSAVPLAVAIAVIIIATALFYTFWFGMDWIARWLF* |
| Ga0066388_1022284302 | 3300005332 | Tropical Forest Soil | MAKEPTFLQGLLGSAIPLAFAIGVGIIATALFYTFWFGLDWIASWLF* |
| Ga0066388_1026449382 | 3300005332 | Tropical Forest Soil | CMPKEPTFIQGLVGSAVPLAVAIGVVLLATALYYTFWYGVDWITQWLF* |
| Ga0066388_1028087522 | 3300005332 | Tropical Forest Soil | MAKEPTFLQGLLGSAIPLAIAVGVIVIATALFYTFWYGVDWIGKWFF* |
| Ga0066388_1029130782 | 3300005332 | Tropical Forest Soil | MAKEPTFLQGLLGSAVPLVVAVIVGLIATALYYTFWFGVEWISNWLF* |
| Ga0066388_1031814541 | 3300005332 | Tropical Forest Soil | MAKEPTFFQGLVGSAVPLVVAIAIALLATALFYTFWYGVGWFTDWLF* |
| Ga0066388_1035814762 | 3300005332 | Tropical Forest Soil | MAKEPTFLQGLLGSAIPLAIAIAVILIATALFYTFWFGVEWITGP* |
| Ga0066388_1059294302 | 3300005332 | Tropical Forest Soil | DQFPGEKSGRYSSRISCMAKEPTFLHGLLGSAVPLAVAIAVVILATALFYTFWFGLDWIAWLF* |
| Ga0066388_1066862271 | 3300005332 | Tropical Forest Soil | MIKEPTFLQGLLGSAIPLFVAVAVILLATALVYTFWFGVEWFTKYLF* |
| Ga0070677_103787362 | 3300005333 | Miscanthus Rhizosphere | MAKEPTFLEGLLGSAIPLAIAIGVILIATALVYTFWFGVGWIANWLF* |
| Ga0070689_1006908812 | 3300005340 | Switchgrass Rhizosphere | MAKEPTFLEGLLGSAIPLAIAIGVILIATALVYTFWFGVGWIADWLF* |
| Ga0070689_1018044572 | 3300005340 | Switchgrass Rhizosphere | SCMAKEPTFLQGLVGSAIPLVVAIAVGLIATALVYTFWFGVDWLSNWLF* |
| Ga0070675_1013593342 | 3300005354 | Miscanthus Rhizosphere | MTKEPTFLQGLLGSAIPLAIAVGVALLATALYYTFWFGVDWIASWLF* |
| Ga0070709_110959572 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MAKEPTFFQGLVGSAVPLVVAIAVILLATALYYTFWFGVDWITQWLF* |
| Ga0070713_1005722112 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MAKEPTFLQGLLGSAVPLVVAVIIGLIATALYYTFWFGVEWISNWFF* |
| Ga0070708_1000638762 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MTKEPTFLQGLIGSAIPLMLALAVILIATALVYTFWFGVDWITRWLF* |
| Ga0070708_1019316862 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | DQLPGEKSGRYSFRIVCMAKEPTFLHGLLGSAIPLVIAIALMIIATAVLYTFWFGVDWFTRWLF* |
| Ga0066686_101137591 | 3300005446 | Soil | MAKEPTFFQGLLGSAIPLGIAIAVMIIATALFYTFWFGLDWLTRWLF* |
| Ga0066686_105501331 | 3300005446 | Soil | KSGRYSFRISCMVKEPTFLHSLVGSAIPLAVALAVILLATALVYTFWFGVDWFTRYLF* |
| Ga0066686_106985561 | 3300005446 | Soil | MVKQPTFLQGLVGSAIPLAVALAVILLATALVYTFWFGVDWFT |
| Ga0066686_109514611 | 3300005446 | Soil | KSGRYSFRISSMVKQPTFLQGLVGSAIPLAVALAVILLATALVYTFWFGVDWFTRYLF* |
| Ga0066681_102928142 | 3300005451 | Soil | MVKEPTFLQGLIGSAIPLAVALAVILIATALVYTFWFGVEWITKWLF* |
| Ga0070699_1018284492 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MIKEPTFLQGLIGSAIPLAVAIAIILIATALVYTFWFGVEWITKWLF* |
| Ga0070699_1020859482 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | CMAKEPTFLQGLVGSAIPLAVAIGVGILATALVYTFWFGVGWFTKWLF* |
| Ga0070738_100298372 | 3300005531 | Surface Soil | MPKEPTFVQGLFGSAVPLIVAIVVGLVATALYYTFWFGVDWISNWLF* |
| Ga0070697_1000908022 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MSKEPTFLQGLIGSAIPLMLALAVILIATALVYTFWFGVDWITRWLF* |
| Ga0066697_106455292 | 3300005540 | Soil | YSFRISCMAKEPTFLQGLIGSAIPLAVALAVILLATALVYTFWFGVDWFTRYLF* |
| Ga0066701_100728432 | 3300005552 | Soil | MVKEPTFLEGLLGSAIPLFVAMAVILIATALVYTFWFGVDWITKWLF* |
| Ga0066661_106704942 | 3300005554 | Soil | SCMVKEPTFLHSLVGSAIPLAVALAVILLATALVYTFWFGVDWFARYLF* |
| Ga0066700_100404221 | 3300005559 | Soil | GVKSGRYSFRISCMVKEPTFLHSLVGSAIPLAVALAVILLATALVYTFWFGVDWFTRYLF |
| Ga0066700_106362832 | 3300005559 | Soil | MAKEPTFLQGLLGSAIPLVIAAAIVVIATALVYTFWFGVGWFTQYLF* |
| Ga0066700_110013042 | 3300005559 | Soil | KEPTFLQGLIGSAIPLMLALAVILIATALVYTFWFGVDWITRWLF* |
| Ga0066670_110312031 | 3300005560 | Soil | ISCMVKEPTFLQGLAGSAIPLAIALAVILIATALVYTFWFGVDWITKYLF* |
| Ga0066699_100572102 | 3300005561 | Soil | MVKQPTFLQGLVASAIPLAVALAVMLLATALVYTFWFGVDWFTKYLF* |
| Ga0066703_106747142 | 3300005568 | Soil | MVKQPTFLQGLVGSAIPLAVALAVILIATALIYTFWFGVDWITKYLF* |
| Ga0066691_108017172 | 3300005586 | Soil | MVKEPTFLHSLVGSAIPLAVALAVILLATALVYTFWFGVDWFARYLF* |
| Ga0066706_108268292 | 3300005598 | Soil | MIKEPTFLQGLIGSAIPLMLALAVILIATALVYTFWFGVDWITRWL |
| Ga0066706_112999912 | 3300005598 | Soil | MAKEPTFLQGLVGSAIPLAVALAVILLATALVYTFWFGLDWITKYLF* |
| Ga0066905_1000314892 | 3300005713 | Tropical Forest Soil | MAKEPTFLHGLLGSAIPLAVAIAVIIIVTALFYTFWFGIDWIATWLF* |
| Ga0066905_1001752492 | 3300005713 | Tropical Forest Soil | MAKEPTFLHGLLGSAVPLAVAIAVVIIATALFYTFWFGLDWIAWLF* |
| Ga0066903_1000878872 | 3300005764 | Tropical Forest Soil | MAKEPTFLQGLLGSALPLAVAIGVVILATLLVYTFWFGLDWISH* |
| Ga0066903_1009622752 | 3300005764 | Tropical Forest Soil | MAKEPTFLHGLLGSAVPLAVAIAVVIIATALFYTFWFGLDWISTWLF* |
| Ga0066903_1020216502 | 3300005764 | Tropical Forest Soil | MAKEPTFLHGLLGSAVPLAVAIAVVIIATALVYTFWFGLDWISTWLF* |
| Ga0066903_1027897852 | 3300005764 | Tropical Forest Soil | MAKEPTFLQGLVGSAIPLAVAIGVGVLATALFYTFWFGLDWITAWLF* |
| Ga0066903_1043741911 | 3300005764 | Tropical Forest Soil | GSAIPLFVAIAVILIATALVYTFWFGVSWFTNLLF* |
| Ga0066903_1048857421 | 3300005764 | Tropical Forest Soil | MTKEPTFLQGLFGSAIPLLVAIVIGIIATALYYTFWFGVGWITDWF* |
| Ga0066903_1056237361 | 3300005764 | Tropical Forest Soil | GEKSGRYSSRISCMAKEPTFLQGLLGSAVPLVVAVIVGLIATALYYTFWFGVEWISNWLF |
| Ga0066903_1072671762 | 3300005764 | Tropical Forest Soil | MAKEPTFLQGLLGSAIPLAIAVGVILIATALFYTFWFGVEWLVGH* |
| Ga0068870_106253792 | 3300005840 | Miscanthus Rhizosphere | MAKEPTFLQGLLGSAIPLAIAVGVALLATALYYTFWFGVDWIASWLF* |
| Ga0081455_106629781 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MAKEPTFLQGLLGSAHPLAIAIGVAIIATALYYTFWFGWE |
| Ga0066656_105611212 | 3300006034 | Soil | MAKEPTFLQSLVGSAIPLAVALAVILLATALVYTFWFGVDWITKYLF* |
| Ga0066652_1006689692 | 3300006046 | Soil | MTKEPTFLQGLLGSAVPLAIALAVMAIATALFYTFWFGVEWFTKWLF* |
| Ga0075417_103723702 | 3300006049 | Populus Rhizosphere | MAKEPTFFHGLLGSAVPLAVAIAVVIIATALFYTFWFGLGWIAWLF* |
| Ga0075432_105963481 | 3300006058 | Populus Rhizosphere | MAKEPTFLQGLLGSAVPLAVAIAVVIIATALFYTFWFGLDWISTWLF* |
| Ga0066665_100723992 | 3300006796 | Soil | MVKEPTFLQGLIGSAIPLAVALGVILIATALVYTFWFGVEWITKWLF* |
| Ga0066665_115430742 | 3300006796 | Soil | MAKEPTFFQGLLGSALPLGIAIAVMIIATALFYTFWFGLDWLTRWLF* |
| Ga0066659_106015491 | 3300006797 | Soil | QPTFLQALIGSAIPLAVALAVILIATALVYTFWFGVEWITKWLF* |
| Ga0066659_109296972 | 3300006797 | Soil | MAKEPTFLEGLVGSAIPLAVAIGIVMIATALVYTFWFGVGWITDWFFEMLSSSCFCA |
| Ga0066659_117884562 | 3300006797 | Soil | QGLIGSAIPLMLALAVILIATALVYTFWFGVDWITRWLF* |
| Ga0066659_118180301 | 3300006797 | Soil | MAKEPTFVQGLLGSALPLAIAAAVALIATALVYTFWFGVGWIANWLF* |
| Ga0066660_102806342 | 3300006800 | Soil | MVKEPTFLEGLLGSAIPLFVAIAVILIATALVYTFWFGVDWITKWLF* |
| Ga0075428_1001318672 | 3300006844 | Populus Rhizosphere | MAKEPTFLQGLLGSAVPLAVAIAVVIIATALFYTFWFGLEWIARWLF* |
| Ga0075428_1002988692 | 3300006844 | Populus Rhizosphere | MAKQPTFLQGLLGSAIPLAIAIGVALIATALYYTFWFGVDWIAEWLF* |
| Ga0075428_1007944212 | 3300006844 | Populus Rhizosphere | SCMAKEPTFLQGLLGSAIPLAIAVAVAIIATALYYTFWFGIDWIASWLF* |
| Ga0075421_10000692010 | 3300006845 | Populus Rhizosphere | MAKEPTFLQGLLGSAIPLAIAVAVAIIATALYYTFWFGIDWIASWLF* |
| Ga0075425_1008601992 | 3300006854 | Populus Rhizosphere | MAKEPTFLEGLIGSAIPLMVALAVIVIATALVYTFWFGVDWITRWLF* |
| Ga0075434_1016245162 | 3300006871 | Populus Rhizosphere | PGEKSGRYSFRISCMAKEPTFLEGLIGSAIPLMVALAVIVIATALVYTFWFGVDWITRWLF* |
| Ga0075424_1014333962 | 3300006904 | Populus Rhizosphere | MAKEPTFFQGLLGSAIPLAIAVAVILIATALFYTFWFGVEWIVGP* |
| Ga0066710_1004216832 | 3300009012 | Grasslands Soil | MIKEPTFLQGLIGSAIPLMLALAVILIATALVYTFWFGVDWITRWLF |
| Ga0066710_1035119322 | 3300009012 | Grasslands Soil | MVKQPTFLQGLVGSAIPLAVALAVILLATALVYTFWFGVDWFTKYLF |
| Ga0066710_1049105182 | 3300009012 | Grasslands Soil | MVKEPTFLQGLLGSAIPLAIAVGVALLATALYYTFWFGVDWIASWLF |
| Ga0099828_110215742 | 3300009089 | Vadose Zone Soil | MDKQPTFLQGLVGSAIPLFVAMAVILIATALVYTFWFGVDWITNFLF* |
| Ga0111539_125444072 | 3300009094 | Populus Rhizosphere | MAKEPTFLQGLLGSAVPLVVAIAIAIIATALFYTFWYGFDWLANWLF* |
| Ga0105243_117357742 | 3300009148 | Miscanthus Rhizosphere | MAKEPTFLQGLVGSAIPLAIAIAVGIIATALVYTFWFGVDWITDWLF* |
| Ga0075423_102848112 | 3300009162 | Populus Rhizosphere | MAKEPTFLQGLLGSAVPLAVAIAVVIIATALFYTFWFGLGWIAWLF* |
| Ga0075423_106538572 | 3300009162 | Populus Rhizosphere | MAKEPTFLQGLLGSAIPLAFAIGVGIIATALFYTFWFGLDWIAAWLF* |
| Ga0105242_119550372 | 3300009176 | Miscanthus Rhizosphere | KEPTFLQGLLGSAVPLVVAIAIAIIATALFYTFWYGFDWLANWLF* |
| Ga0105242_123012042 | 3300009176 | Miscanthus Rhizosphere | ISCMAKEPTFLEGLLGSAIPLAIAIGVILIATALVYTFWFGVGWIADWLF* |
| Ga0105248_126655142 | 3300009177 | Switchgrass Rhizosphere | GLLGSALPLAVAIAVLIIATALVYTFWFGLSWLSH* |
| Ga0105347_13272022 | 3300009609 | Soil | MAKKPKFLEGLFGSAIPLAIAVIVALIATALYYLFWFGWSK* |
| Ga0105347_15264062 | 3300009609 | Soil | MAKKPTFLQGLLGSAIPIAIAIAVALIATALFYSFWFGIDWISNWLF* |
| Ga0126374_106570262 | 3300009792 | Tropical Forest Soil | MAKEPTFFQGLLGSAVPLVVAVIIGLIATALYYTFWFGVE |
| Ga0126374_115416002 | 3300009792 | Tropical Forest Soil | MAKEPTFIQGLVGSAVPLAVAIGVVLLATALYYTFWYGVDWITRWLF* |
| Ga0126384_100375582 | 3300010046 | Tropical Forest Soil | MAKEPTFLHGLLGSAIPLAVAIAVVIIATALFYTFWFGLDWISTWLF* |
| Ga0126384_112430872 | 3300010046 | Tropical Forest Soil | MAKEPTFLQGLLGSAIPLLVAIAAILIATALYYTFWFGVGWFTEYLF* |
| Ga0126382_105052762 | 3300010047 | Tropical Forest Soil | MAKEPTFLQGLVGSAIPLAVALAVILLATALVYTFWFGVEWITKYLF* |
| Ga0126382_113761532 | 3300010047 | Tropical Forest Soil | MAKEPTFLHGLLGSAVPLAVAIAVVIIATALFYTFWFGLEWISTWLF* |
| Ga0134088_100311783 | 3300010304 | Grasslands Soil | MVKQPTFLQGLVGSAIPLAVALAVILLATALVYTFWFGVDWFTKYLF* |
| Ga0134084_104574701 | 3300010322 | Grasslands Soil | QRAGVKSGLYSFRISCMAKEPTFLQSLVGSAIPLAVALAVILLATALVYTFWFGLDWITKFLF* |
| Ga0134111_100616751 | 3300010329 | Grasslands Soil | MAKEPTFLQSLVGSAIPLAVALAVILLATALVYTFW |
| Ga0134111_103290582 | 3300010329 | Grasslands Soil | MAKEPTFLQGLVGSAIPLAIAIAVGIIATALVYTFWFGVDWITNWLF* |
| Ga0134071_103245951 | 3300010336 | Grasslands Soil | MVKQPTFLQGLVGSAIPLAVALAVILLATALVYTFWFGVD |
| Ga0134062_100705702 | 3300010337 | Grasslands Soil | YSFRISCMVKEPTFLQGLVGSAIPLAVALAVILLATALVYTFWFGVDWITKYLF* |
| Ga0126370_112014962 | 3300010358 | Tropical Forest Soil | MAKEPTFIQGLVGTAVPLAVAIGVVLLATALYYTFWYGVDWITRWLF* |
| Ga0126370_124283452 | 3300010358 | Tropical Forest Soil | MVKEPTFLEGLVGSFIPLAIALAVIVIASALVYTFWFGVDWITKYLF* |
| Ga0126376_114312652 | 3300010359 | Tropical Forest Soil | MAKETMFLHGLLGSAVPEAVAIAVVIIATALFYTFWFGLDWIAWLF* |
| Ga0126376_120564672 | 3300010359 | Tropical Forest Soil | MAKEPTFLQGLVGSAIPLAVAIGVGVLATALFYTFWYGLDWITAWLF* |
| Ga0126372_103462492 | 3300010360 | Tropical Forest Soil | MAKEPTFIQGLVGSAVPLVVAIAVILLATALYYTFWYGVDWITQWLF* |
| Ga0126372_104175521 | 3300010360 | Tropical Forest Soil | RVDQLPGEKSGRYSSRISCMAKEPTFFQGLLGSAVPLVVAVIVGLIATALYYTFWFGVEWISNWLF* |
| Ga0126372_104388972 | 3300010360 | Tropical Forest Soil | MAKEPTFLQGLLESTVPLVVAVILGLIATALYYTFWFGVEWISNWLF* |
| Ga0126372_119890652 | 3300010360 | Tropical Forest Soil | GEKSGRYSSRISCMAKEPTFIQGLVGSAVPLVVAIAVILVATALYYTFWYGVDWITRWLF |
| Ga0126372_132102251 | 3300010360 | Tropical Forest Soil | SFRISSMAKEPTFLHGLLGSAVPLAVAIAVVIIATALVYTFWFGLDWIAWLF* |
| Ga0126377_130817742 | 3300010362 | Tropical Forest Soil | MAKEPTFFQGLLGSAIPLAIAIAVMIIATALFYTFWFGVEWLANWLF* |
| Ga0126379_126512202 | 3300010366 | Tropical Forest Soil | MAKEPTFIQGLVGSAVPLAVAIGVILLATALYYTFWYGVDWITRWLF* |
| Ga0126379_126670281 | 3300010366 | Tropical Forest Soil | MDKEPTFLQGLLGSAVPLVVAVIVGLIATALYYTFWFGVEWISNWLF* |
| Ga0126381_1023441172 | 3300010376 | Tropical Forest Soil | MPKEPTFLQGLFGSAIPLAIAIIIGILAMALYYTFWFGVDWLSNWF* |
| Ga0126381_1050233672 | 3300010376 | Tropical Forest Soil | MAKEPTFLQGLLGSAIPLIVAVVVGLVATAVYYTFWFGVEWLTKWLF* |
| Ga0134124_102100292 | 3300010397 | Terrestrial Soil | MAKEPTFLQGLLGSALPLAVAIGVVIIATALVYTFWFGLDWLSH* |
| Ga0134124_114355222 | 3300010397 | Terrestrial Soil | SCMAKEPTFFQGLLGSAVPLAVAIVVILIATALYYTFWFGVDWIATWLF* |
| Ga0126383_118362812 | 3300010398 | Tropical Forest Soil | RYSFRISCMVKQPTFFQGLVGSAIPLFVAIAVILIATALVYTFWFGVSWFTNLLF* |
| Ga0126383_121960791 | 3300010398 | Tropical Forest Soil | FFQGLLGSAIPLAIAIAVILIATALFYTFWFGVEWITGP* |
| Ga0126383_133166262 | 3300010398 | Tropical Forest Soil | MAKEPTFLQGLLGSAIPLIVAVVVGLVATALYYTFWFGVEWLTKWLF* |
| Ga0134122_110415352 | 3300010400 | Terrestrial Soil | TFLQGLVGSAIPLLVAIAVMAIATALVYTFWFGVGWISEILF* |
| Ga0134121_111483051 | 3300010401 | Terrestrial Soil | RGLLGSAVPLVVAIGIAILATALFYTFWYGVDWVANWLF* |
| Ga0134121_122956392 | 3300010401 | Terrestrial Soil | MAKEPTFLEGLLGSAIPLAIAIAVILIATALVYTFWFGVGWIADWLF* |
| Ga0134121_124738262 | 3300010401 | Terrestrial Soil | FRISCMAKEPTFLQGLLGSAIPLVIAIAVMLIATALVYTFWFGVGWFTQYLF* |
| Ga0134123_110646342 | 3300010403 | Terrestrial Soil | MAKEPTFLQGLLGSAIPLAVAIVVIIIATALYYTFWYGVDWITVWLF* |
| Ga0105246_105347372 | 3300011119 | Miscanthus Rhizosphere | MAKEPTFLQGLLGSAIPLAIAIAVVIFATALVYTFWFGVGWFTQWLF* |
| Ga0137388_108456131 | 3300012189 | Vadose Zone Soil | MVKQPTFLQGLVGSAIPLFVAIAVVLIATALVYTFWFGLDWITNF |
| Ga0137363_106903221 | 3300012202 | Vadose Zone Soil | MVKEPTFLEGLVGSAIPLFVALAVILIATALVYTFWFGVDWITKWL |
| Ga0137399_101658022 | 3300012203 | Vadose Zone Soil | MVKEPTFLEGLIGSAIPLFVALAVILVATALVYTFWFGVDWITKWLF* |
| Ga0137380_114372722 | 3300012206 | Vadose Zone Soil | SFRISCMVKQPTFLQGLVGSAIPLAVALAVILIATALIYTFWFGVDWITKYLF* |
| Ga0137381_112454042 | 3300012207 | Vadose Zone Soil | MVKQPTFLQGLVGSAIPLFVAVAVILLATALVYTFWFGVDWITNLLF* |
| Ga0137379_118189421 | 3300012209 | Vadose Zone Soil | MVKQPTFLQGLIGSAIPLAVALAVILIATALVYTFWFG |
| Ga0137378_102897532 | 3300012210 | Vadose Zone Soil | SAIPLAVALAVILLATALVYTFWLGVDWITKYLF* |
| Ga0137377_103434173 | 3300012211 | Vadose Zone Soil | MVKEPTFLQGLVGSAIPLAVALAVILIATALIYTFWFGVDWITKYLF* |
| Ga0137377_112122042 | 3300012211 | Vadose Zone Soil | MVKQPTFFQGLVGSAIPLFVAVAVILLATALVYTFWFGVDWITNVLF* |
| Ga0137377_115159012 | 3300012211 | Vadose Zone Soil | TFLQGLVGSAIPMAIAIAVVAIATALVYTFWFGVGWITDWLF* |
| Ga0137370_107123582 | 3300012285 | Vadose Zone Soil | MVKQPTFLQGLGGSAIPLAVALAGILIATALVYTFWFGVDWITKYLF* |
| Ga0137386_112926631 | 3300012351 | Vadose Zone Soil | ISCMVKQPTFLQGLVGSAIPLAVALAVILIATALIYTFWFGVDWITKYLF* |
| Ga0137385_103420841 | 3300012359 | Vadose Zone Soil | MTKEPTFLQGLLGSAVPLAIALAVMAIATALLYTFWFGVEWFTKWL |
| Ga0137361_108258102 | 3300012362 | Vadose Zone Soil | MTKEPTFLQGLLGSAVPLAIALAVMAIATALFYTFWSVFEWFTKWLF* |
| Ga0137419_116772991 | 3300012925 | Vadose Zone Soil | MVKEPTFLEGLIGSAIPLFVALAVILVATALVYTFWF |
| Ga0137410_107908031 | 3300012944 | Vadose Zone Soil | VKEPTFLEGLVGSAIPLFVALAVILIATALVYTFWFGVDWIT |
| Ga0137410_119001591 | 3300012944 | Vadose Zone Soil | SDQLPGEKSGRYSFRISCMVKEPTFLQGLIGSAIPLAVALAVILIATALVYTFWFGVEWITKWLF* |
| Ga0126375_110536262 | 3300012948 | Tropical Forest Soil | MAKEPTFLQGLVGSAIPLAAALAVILLATALVYTFWFGVDW |
| Ga0126375_111016661 | 3300012948 | Tropical Forest Soil | MAKEPTFLQGLLGSAVPLAIALAVILIATALFYTFWFGVDWISN |
| Ga0126375_115841382 | 3300012948 | Tropical Forest Soil | GRYSFRISCVVKEPTFLQGLVGSFIPVAVALAVIIIATALVYTFWFGVEWITKYLF* |
| Ga0164301_117977752 | 3300012960 | Soil | MAKEPTFLQGLLGSAIPLAIAIGVILIATALVYTFWFGVGWIANWLF* |
| Ga0126369_100081342 | 3300012971 | Tropical Forest Soil | MAKEPTFLHGLLGSAVPLAVAIAVVIIATALFYTFWFGLGWIAWLF* |
| Ga0126369_103865362 | 3300012971 | Tropical Forest Soil | MAKEPTFFQGLLGSAVPLVVAVIIGLIATALYYTFWFGVEWISNWLF* |
| Ga0126369_107693012 | 3300012971 | Tropical Forest Soil | MAKEPTFIQGLVGSAVPLAVAIGVILIATALYYTFWYGVDWITQWLF* |
| Ga0126369_111107623 | 3300012971 | Tropical Forest Soil | MAKEPTFFQGLLGSAVPLVVAVIIGLIATALYYTFWFGVEWISN |
| Ga0126369_133752992 | 3300012971 | Tropical Forest Soil | TFLQGLVGSAIPVFIAVAVILLATALVYTFWFGVSWFTNFLF* |
| Ga0134077_103582892 | 3300012972 | Grasslands Soil | MVKQPTFLQGLVGSAIPLAVALAVILLATALVYTFWFGVDWFTRYLF* |
| Ga0134076_103231731 | 3300012976 | Grasslands Soil | MAKEPTFLQSLVGSAIPLAVALAVILLATALVYTFWFGVDWFTKYLF* |
| Ga0157372_125553121 | 3300013307 | Corn Rhizosphere | MAKEPTFLQGLLGSAIPLAVAIVVIIIATALYYTFWYGVDWIATWLF* |
| Ga0134072_102703312 | 3300015357 | Grasslands Soil | YSFRISCMVKEPTFLEGLVGSAIPLFVALAVILIATALVYTFWFGVDWITKWLF* |
| Ga0132258_100586162 | 3300015371 | Arabidopsis Rhizosphere | MAKEPTFLQGLLGSAIPLLVAIAAILIATALYYTFWFGVGWFTKYLF* |
| Ga0132258_103167524 | 3300015371 | Arabidopsis Rhizosphere | MAKEPTFLQGLLGSAVPLAIAVAVILIATALVYTFWFGVEWLVGH* |
| Ga0132258_108051172 | 3300015371 | Arabidopsis Rhizosphere | MAKEPTFLQGLLGSAIPLAVAIVVIIIATALYYTFWYGVDWIAAWLF* |
| Ga0132258_126262581 | 3300015371 | Arabidopsis Rhizosphere | MAKEPTFLQGLVGSAIPLVVAIAVGLIATALVYTFWFGVD |
| Ga0132255_1009526591 | 3300015374 | Arabidopsis Rhizosphere | GRYSSKISCMAKEPTFLQGLVGSAIPLVVAIAVGLIATALVYTFWFGVDWLSNWLF* |
| Ga0132255_1011598752 | 3300015374 | Arabidopsis Rhizosphere | AKEPTFLQGLLGSAIPLLVAIAAILIATALYYTFWFGVGWFTKYLF* |
| Ga0182041_119959431 | 3300016294 | Soil | MAKEPTFLQGLVGSAIPLIVAVIVGIVATALYYTFWFGLDWLTNWLF |
| Ga0182041_121416261 | 3300016294 | Soil | MAKEPTFFQGLLGSAVPLVVAVIIGLIATALYYTFWFGVEWISNWLF |
| Ga0182033_112105172 | 3300016319 | Soil | QGLVGSAVPLVVAIAVIMLATALYYTFWYGVDWITQWLF |
| Ga0182033_112639761 | 3300016319 | Soil | ISCMAKEPTFLQGLLGSAIPLIAAVVVGIVATALYYTFWFGVEWLTKWLF |
| Ga0182035_107535991 | 3300016341 | Soil | MAKEPTFLQGLLGSALPLAVAIGVVILATLLVYTFWFGLD |
| Ga0182035_108319301 | 3300016341 | Soil | MAKEPTFLQGLLGSAIPLIIAVVVGIVATALYYTFWFGVEWLTKWLF |
| Ga0182039_119741652 | 3300016422 | Soil | MAKEPTFLQGLLGSAVTLVVAVIVGLIATALYYTFWFGVEWISNWLF |
| Ga0182038_102467582 | 3300016445 | Soil | QGLVGSAIPLIVAVIVGIVATALYYTFWFGLDWLNKWLF |
| Ga0134069_10492791 | 3300017654 | Grasslands Soil | MAKEPTFLQSLVGSAIPLAVALAVILLATALVYTFWFGVDWITKYLF |
| Ga0134112_104662031 | 3300017656 | Grasslands Soil | MAKEPTFLQSLVGSAIPLAVALAVILLATALVYTFWFGVNWFTRYLF |
| Ga0134083_100478461 | 3300017659 | Grasslands Soil | MAKEPTFLQSLVGSAIPLAVALAVILLATALVYTFWFGLDWITKYL |
| Ga0134083_102716051 | 3300017659 | Grasslands Soil | RYSFIISSMVKQPTFLQGLVGSAIPLAVALAVILLATALVYTFWFGVDWFTRYLF |
| Ga0187766_109140812 | 3300018058 | Tropical Peatland | MAKEPTFLQGLLGSAIPLIIAIVVGLVATALYYTFWFGLDWITNWLF |
| Ga0066655_100290914 | 3300018431 | Grasslands Soil | MAKEPTFLQSLVGSAIPLAVALAVILLATALVYTFWFGLDWITKYLF |
| Ga0066655_103957902 | 3300018431 | Grasslands Soil | KEPTFLHSLVGSAIPLAVALAVILLATALVYTFWFGVDWFTRYLF |
| Ga0066667_100071162 | 3300018433 | Grasslands Soil | MVKEPTFLHSLVGSAIPLAVALAVILLATALVYTFWFGVDWFTRYLF |
| Ga0066667_105803062 | 3300018433 | Grasslands Soil | MTKEPTFLQGLLGSAVPLAIALAVMAIATALFYTFWFGVEWFTKWLF |
| Ga0066667_110501041 | 3300018433 | Grasslands Soil | MVKEPTFLQGLAGSAIPLAIALAVILIATALVYTFWFGVDWITKYLF |
| Ga0066667_111853322 | 3300018433 | Grasslands Soil | MAKEPTFFQGLLGSAIPLGIAIAVMIIATALFYTFWFGLDWLTRWLF |
| Ga0066662_101648822 | 3300018468 | Grasslands Soil | FRISCMVKEPTFLEGLLGSAIPLFVAMAVILIATALVYTFWFGVDWITKWLF |
| Ga0066662_102293222 | 3300018468 | Grasslands Soil | SLWGLVGSAIPLSVALAVILIATALVYTFWFGVDWITKYLF |
| Ga0066662_116307732 | 3300018468 | Grasslands Soil | MDKQPTLLQGLVGSAIPLLVAMAVILLATALVYTFWFGLDWITKFLF |
| Ga0210395_108399592 | 3300020582 | Soil | MAKEPTFFQGLLGSAVPLIVAVIIGIIATALYYTFWFGVEWISNWLF |
| Ga0210406_104051642 | 3300021168 | Soil | MAKEPTFLQGLLGSAVPLVVAVIIGLIATALYYTFWFGVEWISKWLF |
| Ga0213878_103553812 | 3300021444 | Bulk Soil | MAKEPTFLQGLVGSAIPLFVAVVFILIATALVYTFWFGVDWFTKWLF |
| Ga0187846_103014512 | 3300021476 | Biofilm | MVKQPTFLQGLIGSAIPLFVAMAVILLATALVYTFWFGVDWITN |
| Ga0126371_121895312 | 3300021560 | Tropical Forest Soil | MAKEPTFLQGLLGSAVPLVVAVIVGLIATALYYTFWFGVEWISNWLF |
| Ga0207682_104395643 | 3300025893 | Miscanthus Rhizosphere | MAKEPTFLEGLLGSAIPLAIAIGVILIATALVYTFWFGVGWIANWLF |
| Ga0207699_105882612 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MAKEPTFFQGLVGSAVPLVVAIAVILLATALYYTFWFGVDWITQWLF |
| Ga0207643_106586492 | 3300025908 | Miscanthus Rhizosphere | MAKEPTFLQGLLGSAIPLAIAVGVALLATALYYTFWFGVDWIASWLF |
| Ga0207652_105207832 | 3300025921 | Corn Rhizosphere | MAKEPTFLQGLFGSALPLLVAVIIGAIATALYYTFWYGVGWFTKWLF |
| Ga0207646_101421222 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MTKEPTFLQGLIGSAIPLMLALAVILIATALVYTFWFGVDWITRWLF |
| Ga0207646_118127422 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MIKEPTFLQGLIGSAIPLAVAIAIILIATALVYTFWFGVEWITKWLF |
| Ga0207659_109185322 | 3300025926 | Miscanthus Rhizosphere | MTKEPTFLQGLLGSAIPLAIAVGVALLATALYYTFWFGVDWIASWLF |
| Ga0209235_10463002 | 3300026296 | Grasslands Soil | MVKQPTFLQGLVGSAIPLAVALAVILIATALVYTFWFGVDWITKYLF |
| Ga0209468_10166352 | 3300026306 | Soil | MVKEPTFLQGLVGSAIPLAVALAVILLATALVYTFWFGVDWITKYLF |
| Ga0209468_11408081 | 3300026306 | Soil | MAKEPTFLQGLIGSAIPLAVALAVILLATALVYTFWFGVDWITKYLF |
| Ga0209239_11366482 | 3300026310 | Grasslands Soil | GRYSFRISCMVKEPTFLHSLVGSAIPLAVALAVILLATALVYTFWFGVDWFTRYLF |
| Ga0209472_12038581 | 3300026323 | Soil | MVKEPTFLQGLIGSAIPLAVALAVILIATALVYTFWFGVEWITKWLF |
| Ga0209375_10239174 | 3300026329 | Soil | CMAKEPTFLQSLVGSAIPLAVALAVILLATALVYTFWFGLDWITKYLF |
| Ga0209375_12810572 | 3300026329 | Soil | GSAIPLAVALAVILIATALVYTFWFGVDWITKYLF |
| Ga0209376_10245271 | 3300026540 | Soil | KSGRYSFRISCMVKEPTFLHSLVGSAIPLAVALAVILLATALVYTFWFGVDWFTRYLF |
| Ga0209156_103897912 | 3300026547 | Soil | SRSDQLEGVKSGRYSFRISCMIKEPTFLHSLVGSAIPLAVALAVILLATALVYTFWFGVDWFTRFLF |
| Ga0209577_102152392 | 3300026552 | Soil | MVKEPTFLEGLLGSAIPLFVAMAVILIATALVYTFWFGVDWITKWLF |
| Ga0208685_10947302 | 3300027513 | Soil | MAKKPKFLEGLFGSAIPLAIAVIVALIATALYYLFWFGWSK |
| Ga0209515_105007852 | 3300027835 | Groundwater | MVKEPTFLQGLVGSAIPLAVAIAVMAIATALVYTFWFGVGWITNWLF |
| Ga0209579_106324002 | 3300027869 | Surface Soil | KQPTFLQGLVGSAIPLLVAVAVILIATALVYTFWFGVGWITNLLF |
| Ga0209814_101332072 | 3300027873 | Populus Rhizosphere | MAKEPTFLQGLLGSAVPLAVAIAVVIIATALFYTFWFGLGWIAWLF |
| Ga0209465_105061562 | 3300027874 | Tropical Forest Soil | HGLLGSAVPLAVAIAVVIIATALFYTFWFGLDWIAWLF |
| Ga0209481_101699822 | 3300027880 | Populus Rhizosphere | MAKEPTFLQGLLGSAVPLAVAIAVVIIATALFYTFWFGLEWIARWLF |
| Ga0209382_101795751 | 3300027909 | Populus Rhizosphere | MAKEPTFLQGLLGSAIPLAIAVAVAIIATALYYTFWFGIDWIASWLF |
| Ga0209382_110717982 | 3300027909 | Populus Rhizosphere | MAKEPTFFHGLLGSAVPLAVAIAVVIIATALFYTFWFGLGWIAWLF |
| Ga0209062_10219436 | 3300027965 | Surface Soil | MPKEPTFVQGLFGSAVPLIVAIVVGLVATALYYTFWFGVDWISNWLF |
| Ga0170824_1014491831 | 3300031231 | Forest Soil | VGSAVPLAVAIAVILLATALYYTFWFGVEWISRWLF |
| Ga0307468_1019503172 | 3300031740 | Hardwood Forest Soil | GEKSGRYSSRISCMAKEPTFLEGLLGSAIPLAIAIGVILIATALVYTFWFGVGWIADWLF |
| Ga0306925_102285941 | 3300031890 | Soil | MAKEPTFFQGLVGSAIPLIVAVIVGIVATALYYTFWFGLDWLNKWLF |
| Ga0310909_104160792 | 3300031947 | Soil | MAKEPTFLQGLLGSALPLAVAIGVVILATLLVYTFWFGLDWISH |
| Ga0310909_105344072 | 3300031947 | Soil | MAKEPTFLQGLVGSAIPLIVAVIVGIVATALYYTFWFGLDWLTKWLF |
| Ga0307471_1004946401 | 3300032180 | Hardwood Forest Soil | MAKEPTFLQGLVGSAIPLAVALAVILIATALVYTFWFGVDWITKYLF |
| Ga0307471_1011374752 | 3300032180 | Hardwood Forest Soil | YSFRISCMIKEPTFLQGLIGSAIPLMLALAVILIATALVYTFWFGVDWITRWLF |
| Ga0307471_1033217002 | 3300032180 | Hardwood Forest Soil | MVKEPTFLQSLVGSAIPLAVALAVILIATALVYTFWFGVDWITKYLF |
| Ga0307471_1033634981 | 3300032180 | Hardwood Forest Soil | MGKEPTFLQGLVGSAIPLAVAIGVAIIATALYYTFWFGVGWFTQWLF |
| Ga0306920_1005065302 | 3300032261 | Soil | MIKEPTFLQGLLGSAIPLFVAVAVILLATALVYTFWFGVEWFTKYLF |
| Ga0306920_1031991462 | 3300032261 | Soil | RSDHWPGEKSGRYSFTISCMAKEPTFLQGLLGSALPLAVAIGVVILATLLVYTFWFGLDWISH |
| Ga0306920_1034481632 | 3300032261 | Soil | PGEKSGLYSSTISCMAKEPTFFQGLVGSAIPLIVAVIVGIVATALYYTFWFGLDWLTKWL |
| Ga0310812_100665502 | 3300032421 | Soil | MAKEPTFLQGLLGSALPLAVAIGVVIIATALVYTFWFGLGWLSH |
| ⦗Top⦘ |