| Basic Information | |
|---|---|
| Family ID | F015775 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 252 |
| Average Sequence Length | 45 residues |
| Representative Sequence | MKTKDKSRKWMWWFLGVIGALQLYFVRELLAAFALFALGFAAI |
| Number of Associated Samples | 191 |
| Number of Associated Scaffolds | 252 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 98.35 % |
| % of genes near scaffold ends (potentially truncated) | 96.03 % |
| % of genes from short scaffolds (< 2000 bps) | 90.87 % |
| Associated GOLD sequencing projects | 180 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.53 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (61.111 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (29.365 % of family members) |
| Environment Ontology (ENVO) | Unclassified (32.937 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (47.222 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 54.93% β-sheet: 0.00% Coil/Unstructured: 45.07% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.53 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 252 Family Scaffolds |
|---|---|---|
| PF04226 | Transgly_assoc | 6.35 |
| PF10101 | DUF2339 | 6.35 |
| PF01887 | SAM_HAT_N | 2.78 |
| PF04338 | DUF481 | 2.38 |
| PF14559 | TPR_19 | 1.19 |
| PF14341 | PilX_N | 0.40 |
| PF04234 | CopC | 0.40 |
| PF01609 | DDE_Tnp_1 | 0.40 |
| PF13432 | TPR_16 | 0.40 |
| PF00903 | Glyoxalase | 0.40 |
| PF13419 | HAD_2 | 0.40 |
| PF13163 | DUF3999 | 0.40 |
| PF12704 | MacB_PCD | 0.40 |
| COG ID | Name | Functional Category | % Frequency in 252 Family Scaffolds |
|---|---|---|---|
| COG2261 | Uncharacterized membrane protein YeaQ/YmgE, transglycosylase-associated protein family | General function prediction only [R] | 6.35 |
| COG1912 | Stereoselective (R,S)-S-adenosylmethionine hydrolase (adenosine-forming) | Defense mechanisms [V] | 2.78 |
| COG3137 | Putative salt-induced outer membrane protein YdiY | Cell wall/membrane/envelope biogenesis [M] | 2.38 |
| COG2372 | Copper-binding protein CopC (methionine-rich) | Inorganic ion transport and metabolism [P] | 0.40 |
| COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 0.40 |
| COG3293 | Transposase | Mobilome: prophages, transposons [X] | 0.40 |
| COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 0.40 |
| COG5421 | Transposase | Mobilome: prophages, transposons [X] | 0.40 |
| COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 0.40 |
| COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 0.40 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 61.11 % |
| Unclassified | root | N/A | 38.89 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000364|INPhiseqgaiiFebDRAFT_101363276 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1119 | Open in IMG/M |
| 3300000651|AP72_2010_repI_A10DRAFT_1021529 | Not Available | 824 | Open in IMG/M |
| 3300000651|AP72_2010_repI_A10DRAFT_1043905 | Not Available | 583 | Open in IMG/M |
| 3300001661|JGI12053J15887_10561607 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 543 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101023738 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 711 | Open in IMG/M |
| 3300002562|JGI25382J37095_10236157 | Not Available | 552 | Open in IMG/M |
| 3300002910|JGI25615J43890_1042249 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 745 | Open in IMG/M |
| 3300002914|JGI25617J43924_10238099 | Not Available | 612 | Open in IMG/M |
| 3300003218|JGI26339J46600_10162085 | Not Available | 516 | Open in IMG/M |
| 3300003350|JGI26347J50199_1023081 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 683 | Open in IMG/M |
| 3300004080|Ga0062385_10440291 | Not Available | 789 | Open in IMG/M |
| 3300004091|Ga0062387_100586296 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 796 | Open in IMG/M |
| 3300004635|Ga0062388_100650733 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 975 | Open in IMG/M |
| 3300004635|Ga0062388_101897919 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas psychrophila | 613 | Open in IMG/M |
| 3300005345|Ga0070692_11294473 | Not Available | 522 | Open in IMG/M |
| 3300005445|Ga0070708_102226476 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 506 | Open in IMG/M |
| 3300005518|Ga0070699_100588098 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1015 | Open in IMG/M |
| 3300005556|Ga0066707_10703881 | Not Available | 633 | Open in IMG/M |
| 3300005561|Ga0066699_10488268 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 881 | Open in IMG/M |
| 3300005712|Ga0070764_10303965 | Not Available | 921 | Open in IMG/M |
| 3300005764|Ga0066903_104350884 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 757 | Open in IMG/M |
| 3300005764|Ga0066903_107833147 | Not Available | 549 | Open in IMG/M |
| 3300005944|Ga0066788_10168171 | Not Available | 563 | Open in IMG/M |
| 3300006050|Ga0075028_100461793 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 736 | Open in IMG/M |
| 3300006059|Ga0075017_101114131 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 617 | Open in IMG/M |
| 3300006173|Ga0070716_100364740 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1027 | Open in IMG/M |
| 3300006176|Ga0070765_102043610 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 536 | Open in IMG/M |
| 3300006237|Ga0097621_101411106 | Not Available | 659 | Open in IMG/M |
| 3300006797|Ga0066659_10497368 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 977 | Open in IMG/M |
| 3300006804|Ga0079221_11099069 | Not Available | 608 | Open in IMG/M |
| 3300006806|Ga0079220_10251210 | All Organisms → cellular organisms → Bacteria | 1058 | Open in IMG/M |
| 3300006852|Ga0075433_10256769 | All Organisms → cellular organisms → Bacteria | 1550 | Open in IMG/M |
| 3300006893|Ga0073928_10429216 | Not Available | 961 | Open in IMG/M |
| 3300007258|Ga0099793_10152635 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1094 | Open in IMG/M |
| 3300009038|Ga0099829_10106307 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2190 | Open in IMG/M |
| 3300009038|Ga0099829_10346662 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1222 | Open in IMG/M |
| 3300009090|Ga0099827_10182777 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1735 | Open in IMG/M |
| 3300009101|Ga0105247_10494673 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 890 | Open in IMG/M |
| 3300009137|Ga0066709_101092125 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1172 | Open in IMG/M |
| 3300009143|Ga0099792_10022410 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2832 | Open in IMG/M |
| 3300009143|Ga0099792_10082963 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1645 | Open in IMG/M |
| 3300009143|Ga0099792_10952449 | Not Available | 571 | Open in IMG/M |
| 3300009143|Ga0099792_10992724 | Not Available | 560 | Open in IMG/M |
| 3300009162|Ga0075423_11849010 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 652 | Open in IMG/M |
| 3300009177|Ga0105248_12368775 | Not Available | 605 | Open in IMG/M |
| 3300009545|Ga0105237_10926060 | Not Available | 878 | Open in IMG/M |
| 3300009631|Ga0116115_1006398 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3907 | Open in IMG/M |
| 3300009638|Ga0116113_1196147 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 521 | Open in IMG/M |
| 3300009660|Ga0105854_1386749 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 506 | Open in IMG/M |
| 3300009792|Ga0126374_10848634 | Not Available | 703 | Open in IMG/M |
| 3300010043|Ga0126380_10251558 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1224 | Open in IMG/M |
| 3300010046|Ga0126384_10624412 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 946 | Open in IMG/M |
| 3300010046|Ga0126384_12235508 | Not Available | 527 | Open in IMG/M |
| 3300010047|Ga0126382_10774290 | Not Available | 815 | Open in IMG/M |
| 3300010047|Ga0126382_11226680 | Not Available | 673 | Open in IMG/M |
| 3300010047|Ga0126382_12143196 | Not Available | 536 | Open in IMG/M |
| 3300010048|Ga0126373_10275678 | All Organisms → cellular organisms → Bacteria | 1666 | Open in IMG/M |
| 3300010326|Ga0134065_10107836 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 933 | Open in IMG/M |
| 3300010358|Ga0126370_11526321 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 636 | Open in IMG/M |
| 3300010358|Ga0126370_11679608 | Not Available | 610 | Open in IMG/M |
| 3300010359|Ga0126376_12068268 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 612 | Open in IMG/M |
| 3300010359|Ga0126376_13145402 | Not Available | 511 | Open in IMG/M |
| 3300010361|Ga0126378_11103882 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 894 | Open in IMG/M |
| 3300010366|Ga0126379_10368716 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1473 | Open in IMG/M |
| 3300010366|Ga0126379_12285604 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 641 | Open in IMG/M |
| 3300010371|Ga0134125_12992260 | Not Available | 512 | Open in IMG/M |
| 3300010376|Ga0126381_104000032 | Not Available | 574 | Open in IMG/M |
| 3300010397|Ga0134124_11975000 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 620 | Open in IMG/M |
| 3300010398|Ga0126383_10067378 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3061 | Open in IMG/M |
| 3300010937|Ga0137776_1566663 | Not Available | 542 | Open in IMG/M |
| 3300011269|Ga0137392_11506528 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 531 | Open in IMG/M |
| 3300011271|Ga0137393_10089523 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 2492 | Open in IMG/M |
| 3300011271|Ga0137393_10372816 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1221 | Open in IMG/M |
| 3300011271|Ga0137393_11659999 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 528 | Open in IMG/M |
| 3300012189|Ga0137388_11203959 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 695 | Open in IMG/M |
| 3300012198|Ga0137364_10470447 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 944 | Open in IMG/M |
| 3300012200|Ga0137382_10287327 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1145 | Open in IMG/M |
| 3300012200|Ga0137382_10755052 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 698 | Open in IMG/M |
| 3300012201|Ga0137365_11256910 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 527 | Open in IMG/M |
| 3300012202|Ga0137363_10837462 | Not Available | 781 | Open in IMG/M |
| 3300012202|Ga0137363_10898451 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 752 | Open in IMG/M |
| 3300012202|Ga0137363_10998929 | Not Available | 711 | Open in IMG/M |
| 3300012203|Ga0137399_11225456 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 632 | Open in IMG/M |
| 3300012203|Ga0137399_11501520 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 561 | Open in IMG/M |
| 3300012205|Ga0137362_10343418 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1292 | Open in IMG/M |
| 3300012205|Ga0137362_11389017 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 588 | Open in IMG/M |
| 3300012209|Ga0137379_10799974 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 848 | Open in IMG/M |
| 3300012285|Ga0137370_10212522 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1137 | Open in IMG/M |
| 3300012361|Ga0137360_10976610 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 731 | Open in IMG/M |
| 3300012362|Ga0137361_10401552 | All Organisms → cellular organisms → Bacteria | 1259 | Open in IMG/M |
| 3300012362|Ga0137361_10444767 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1190 | Open in IMG/M |
| 3300012363|Ga0137390_10223501 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1869 | Open in IMG/M |
| 3300012363|Ga0137390_11292188 | Not Available | 675 | Open in IMG/M |
| 3300012582|Ga0137358_10139168 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1651 | Open in IMG/M |
| 3300012582|Ga0137358_10352446 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 997 | Open in IMG/M |
| 3300012582|Ga0137358_10650939 | Not Available | 705 | Open in IMG/M |
| 3300012582|Ga0137358_10874066 | Not Available | 591 | Open in IMG/M |
| 3300012685|Ga0137397_10600545 | Not Available | 819 | Open in IMG/M |
| 3300012917|Ga0137395_10229853 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1298 | Open in IMG/M |
| 3300012917|Ga0137395_10911731 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 635 | Open in IMG/M |
| 3300012918|Ga0137396_10657736 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 774 | Open in IMG/M |
| 3300012923|Ga0137359_10289492 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1460 | Open in IMG/M |
| 3300012923|Ga0137359_10619570 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 948 | Open in IMG/M |
| 3300012923|Ga0137359_11153758 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 662 | Open in IMG/M |
| 3300012923|Ga0137359_11191749 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 649 | Open in IMG/M |
| 3300012923|Ga0137359_11462055 | Not Available | 571 | Open in IMG/M |
| 3300012924|Ga0137413_11364606 | Not Available | 571 | Open in IMG/M |
| 3300012925|Ga0137419_10645639 | Not Available | 854 | Open in IMG/M |
| 3300012925|Ga0137419_11023693 | Not Available | 685 | Open in IMG/M |
| 3300012925|Ga0137419_11629788 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 549 | Open in IMG/M |
| 3300012925|Ga0137419_11983061 | Not Available | 500 | Open in IMG/M |
| 3300012927|Ga0137416_11493769 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 613 | Open in IMG/M |
| 3300012927|Ga0137416_12113356 | Not Available | 517 | Open in IMG/M |
| 3300012927|Ga0137416_12160647 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 512 | Open in IMG/M |
| 3300012929|Ga0137404_10052737 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3125 | Open in IMG/M |
| 3300012929|Ga0137404_11620019 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 600 | Open in IMG/M |
| 3300012929|Ga0137404_11746526 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 578 | Open in IMG/M |
| 3300012948|Ga0126375_10544307 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 875 | Open in IMG/M |
| 3300012960|Ga0164301_10600731 | Not Available | 812 | Open in IMG/M |
| 3300012971|Ga0126369_11530296 | Not Available | 757 | Open in IMG/M |
| 3300012977|Ga0134087_10252943 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 808 | Open in IMG/M |
| 3300012986|Ga0164304_11171172 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 619 | Open in IMG/M |
| 3300013306|Ga0163162_13401366 | Not Available | 508 | Open in IMG/M |
| 3300013307|Ga0157372_13253493 | Not Available | 518 | Open in IMG/M |
| 3300014155|Ga0181524_10220438 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 912 | Open in IMG/M |
| 3300014166|Ga0134079_10750452 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 503 | Open in IMG/M |
| 3300014501|Ga0182024_10138587 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3442 | Open in IMG/M |
| 3300014968|Ga0157379_10309373 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1441 | Open in IMG/M |
| 3300015241|Ga0137418_10317972 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1296 | Open in IMG/M |
| 3300015264|Ga0137403_10670400 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 898 | Open in IMG/M |
| 3300015264|Ga0137403_10805117 | All Organisms → cellular organisms → Bacteria | 794 | Open in IMG/M |
| 3300015264|Ga0137403_10826087 | Not Available | 780 | Open in IMG/M |
| 3300015371|Ga0132258_10647149 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2658 | Open in IMG/M |
| 3300015371|Ga0132258_13404446 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1092 | Open in IMG/M |
| 3300016404|Ga0182037_11834787 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 542 | Open in IMG/M |
| 3300017656|Ga0134112_10279373 | Not Available | 667 | Open in IMG/M |
| 3300017821|Ga0187812_1192076 | Not Available | 653 | Open in IMG/M |
| 3300017926|Ga0187807_1124393 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 817 | Open in IMG/M |
| 3300017959|Ga0187779_11048564 | Not Available | 568 | Open in IMG/M |
| 3300017975|Ga0187782_11124629 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 613 | Open in IMG/M |
| 3300018025|Ga0187885_10192932 | All Organisms → cellular organisms → Bacteria | 947 | Open in IMG/M |
| 3300018433|Ga0066667_10919814 | Not Available | 753 | Open in IMG/M |
| 3300020140|Ga0179590_1041773 | Not Available | 1162 | Open in IMG/M |
| 3300020579|Ga0210407_11188321 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 574 | Open in IMG/M |
| 3300020581|Ga0210399_11099053 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 636 | Open in IMG/M |
| 3300020583|Ga0210401_10632199 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 932 | Open in IMG/M |
| 3300021046|Ga0215015_11017859 | All Organisms → cellular organisms → Bacteria | 1960 | Open in IMG/M |
| 3300021046|Ga0215015_11093004 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
| 3300021086|Ga0179596_10680821 | Not Available | 521 | Open in IMG/M |
| 3300021086|Ga0179596_10682912 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 520 | Open in IMG/M |
| 3300021088|Ga0210404_10194707 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1084 | Open in IMG/M |
| 3300021170|Ga0210400_10766750 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 791 | Open in IMG/M |
| 3300021170|Ga0210400_10842097 | Not Available | 750 | Open in IMG/M |
| 3300021171|Ga0210405_11069197 | Not Available | 605 | Open in IMG/M |
| 3300021180|Ga0210396_11341741 | Not Available | 594 | Open in IMG/M |
| 3300021181|Ga0210388_11003108 | Not Available | 716 | Open in IMG/M |
| 3300021401|Ga0210393_10577218 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 918 | Open in IMG/M |
| 3300021402|Ga0210385_10468792 | Not Available | 952 | Open in IMG/M |
| 3300021404|Ga0210389_10392209 | All Organisms → cellular organisms → Bacteria | 1092 | Open in IMG/M |
| 3300021404|Ga0210389_10946288 | Not Available | 669 | Open in IMG/M |
| 3300021405|Ga0210387_11890042 | Not Available | 501 | Open in IMG/M |
| 3300021406|Ga0210386_10469669 | Not Available | 1087 | Open in IMG/M |
| 3300021406|Ga0210386_11609338 | Not Available | 539 | Open in IMG/M |
| 3300021474|Ga0210390_11122377 | Not Available | 638 | Open in IMG/M |
| 3300021478|Ga0210402_10019226 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 5860 | Open in IMG/M |
| 3300021478|Ga0210402_10362782 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1345 | Open in IMG/M |
| 3300021478|Ga0210402_11972240 | Not Available | 510 | Open in IMG/M |
| 3300021478|Ga0210402_11985937 | Not Available | 507 | Open in IMG/M |
| 3300022532|Ga0242655_10320244 | Not Available | 510 | Open in IMG/M |
| 3300022557|Ga0212123_10533560 | Not Available | 754 | Open in IMG/M |
| 3300024330|Ga0137417_1425672 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1147 | Open in IMG/M |
| 3300025469|Ga0208687_1057295 | All Organisms → cellular organisms → Bacteria | 928 | Open in IMG/M |
| 3300025914|Ga0207671_11380881 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 547 | Open in IMG/M |
| 3300025916|Ga0207663_10127017 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1756 | Open in IMG/M |
| 3300025928|Ga0207700_11332030 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 639 | Open in IMG/M |
| 3300025939|Ga0207665_11173120 | Not Available | 613 | Open in IMG/M |
| 3300026089|Ga0207648_11668403 | Not Available | 599 | Open in IMG/M |
| 3300026285|Ga0209438_1193941 | Not Available | 540 | Open in IMG/M |
| 3300026304|Ga0209240_1275047 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 518 | Open in IMG/M |
| 3300026312|Ga0209153_1034091 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1753 | Open in IMG/M |
| 3300026320|Ga0209131_1269047 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 657 | Open in IMG/M |
| 3300026322|Ga0209687_1158757 | Not Available | 725 | Open in IMG/M |
| 3300026523|Ga0209808_1175589 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 774 | Open in IMG/M |
| 3300026550|Ga0209474_10215866 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1212 | Open in IMG/M |
| 3300026551|Ga0209648_10416892 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 865 | Open in IMG/M |
| 3300027050|Ga0209325_1045097 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 534 | Open in IMG/M |
| 3300027174|Ga0207948_1040584 | Not Available | 561 | Open in IMG/M |
| 3300027516|Ga0207761_1061471 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 729 | Open in IMG/M |
| 3300027528|Ga0208985_1029965 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1058 | Open in IMG/M |
| 3300027535|Ga0209734_1112591 | Not Available | 523 | Open in IMG/M |
| 3300027545|Ga0209008_1065691 | Not Available | 820 | Open in IMG/M |
| 3300027562|Ga0209735_1150223 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 505 | Open in IMG/M |
| 3300027583|Ga0209527_1094665 | Not Available | 670 | Open in IMG/M |
| 3300027655|Ga0209388_1045346 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1268 | Open in IMG/M |
| 3300027655|Ga0209388_1081765 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 930 | Open in IMG/M |
| 3300027655|Ga0209388_1155404 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 645 | Open in IMG/M |
| 3300027671|Ga0209588_1248259 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 544 | Open in IMG/M |
| 3300027738|Ga0208989_10174360 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 717 | Open in IMG/M |
| 3300027795|Ga0209139_10156350 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 807 | Open in IMG/M |
| 3300027842|Ga0209580_10552913 | Not Available | 572 | Open in IMG/M |
| 3300027862|Ga0209701_10037177 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3150 | Open in IMG/M |
| 3300027862|Ga0209701_10412502 | Not Available | 750 | Open in IMG/M |
| 3300027862|Ga0209701_10739583 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 502 | Open in IMG/M |
| 3300027874|Ga0209465_10349925 | All Organisms → cellular organisms → Bacteria | 740 | Open in IMG/M |
| 3300027875|Ga0209283_10421337 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 868 | Open in IMG/M |
| 3300027879|Ga0209169_10688601 | Not Available | 530 | Open in IMG/M |
| 3300027898|Ga0209067_10419948 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 751 | Open in IMG/M |
| 3300027902|Ga0209048_10549812 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 774 | Open in IMG/M |
| (restricted) 3300027995|Ga0233418_10305275 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 555 | Open in IMG/M |
| 3300028047|Ga0209526_10080001 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2302 | Open in IMG/M |
| 3300028047|Ga0209526_10673441 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 654 | Open in IMG/M |
| 3300028047|Ga0209526_10956355 | Not Available | 516 | Open in IMG/M |
| 3300028536|Ga0137415_10532160 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 984 | Open in IMG/M |
| 3300028536|Ga0137415_11464173 | Not Available | 507 | Open in IMG/M |
| 3300028806|Ga0302221_10201394 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 872 | Open in IMG/M |
| 3300028906|Ga0308309_11156453 | All Organisms → cellular organisms → Bacteria | 668 | Open in IMG/M |
| 3300029636|Ga0222749_10356064 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 768 | Open in IMG/M |
| 3300029636|Ga0222749_10433291 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 701 | Open in IMG/M |
| 3300030053|Ga0302177_10001576 | All Organisms → cellular organisms → Bacteria | 16371 | Open in IMG/M |
| 3300030490|Ga0302184_10110650 | All Organisms → cellular organisms → Bacteria | 1230 | Open in IMG/M |
| 3300030847|Ga0075405_11044093 | All Organisms → cellular organisms → Bacteria | 832 | Open in IMG/M |
| 3300031057|Ga0170834_111510988 | Not Available | 610 | Open in IMG/M |
| 3300031231|Ga0170824_117485513 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1370 | Open in IMG/M |
| 3300031640|Ga0318555_10744942 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 529 | Open in IMG/M |
| 3300031679|Ga0318561_10451690 | Not Available | 707 | Open in IMG/M |
| 3300031708|Ga0310686_115358972 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1150 | Open in IMG/M |
| 3300031715|Ga0307476_10540749 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 863 | Open in IMG/M |
| 3300031718|Ga0307474_10076054 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2495 | Open in IMG/M |
| 3300031718|Ga0307474_11462525 | Not Available | 538 | Open in IMG/M |
| 3300031720|Ga0307469_11250213 | Not Available | 703 | Open in IMG/M |
| 3300031740|Ga0307468_102469483 | Not Available | 508 | Open in IMG/M |
| 3300031753|Ga0307477_11127015 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 511 | Open in IMG/M |
| 3300031754|Ga0307475_10023975 | All Organisms → cellular organisms → Bacteria | 4335 | Open in IMG/M |
| 3300031823|Ga0307478_10649670 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 883 | Open in IMG/M |
| 3300031912|Ga0306921_11214834 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 839 | Open in IMG/M |
| 3300031945|Ga0310913_10724736 | Not Available | 703 | Open in IMG/M |
| 3300031954|Ga0306926_12899322 | Not Available | 515 | Open in IMG/M |
| 3300032174|Ga0307470_10098767 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1665 | Open in IMG/M |
| 3300032180|Ga0307471_100628173 | All Organisms → cellular organisms → Bacteria | 1235 | Open in IMG/M |
| 3300032180|Ga0307471_100663494 | Not Available | 1206 | Open in IMG/M |
| 3300032770|Ga0335085_10898633 | Not Available | 966 | Open in IMG/M |
| 3300032770|Ga0335085_11467298 | Not Available | 712 | Open in IMG/M |
| 3300034178|Ga0364934_0325698 | Not Available | 582 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 29.37% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 12.70% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 7.94% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 5.16% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.76% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.57% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.17% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.78% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.78% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.98% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.59% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.59% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.59% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.59% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.59% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.59% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 1.19% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.19% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.79% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.79% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.79% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.79% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.79% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.79% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.79% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.79% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.79% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.79% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 0.40% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.40% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.40% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.40% |
| Sediment | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Sediment | 0.40% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.40% |
| Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 0.40% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.40% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.40% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.40% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.40% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.40% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.40% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.40% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.40% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000651 | Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A10 | Environmental | Open in IMG/M |
| 3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300002562 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002910 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm | Environmental | Open in IMG/M |
| 3300002914 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm | Environmental | Open in IMG/M |
| 3300003218 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 | Environmental | Open in IMG/M |
| 3300003350 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005944 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-048 | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009631 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_100 | Environmental | Open in IMG/M |
| 3300009638 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_10 | Environmental | Open in IMG/M |
| 3300009660 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-058 | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010937 | Fumarole sediment microbial communities, Furnas, Sao Miguel, Azores. Combined Assembly of Gp0156138, Gp0156139 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014155 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_60_metaG | Environmental | Open in IMG/M |
| 3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017656 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015 | Environmental | Open in IMG/M |
| 3300017821 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_2 | Environmental | Open in IMG/M |
| 3300017926 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2 | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018025 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_100 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300020140 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021046 | Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depth | Environmental | Open in IMG/M |
| 3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300022532 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025469 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_100 (SPAdes) | Environmental | Open in IMG/M |
| 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026285 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026312 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 (SPAdes) | Environmental | Open in IMG/M |
| 3300026320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 (SPAdes) | Environmental | Open in IMG/M |
| 3300026523 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 (SPAdes) | Environmental | Open in IMG/M |
| 3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300027050 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027174 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF040 (SPAdes) | Environmental | Open in IMG/M |
| 3300027516 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 34 (SPAdes) | Environmental | Open in IMG/M |
| 3300027528 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027535 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027545 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027562 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027583 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027655 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027738 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027795 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
| 3300027898 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300027902 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - CRP12 CR (SPAdes) | Environmental | Open in IMG/M |
| 3300027995 (restricted) | Sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - Sediment_Towuti_2014_1_MG | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028806 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_1 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030053 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_2 | Environmental | Open in IMG/M |
| 3300030490 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_3 | Environmental | Open in IMG/M |
| 3300030847 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA10 SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300034178 | Sediment microbial communities from East River floodplain, Colorado, United States - 27_j17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| INPhiseqgaiiFebDRAFT_1013632761 | 3300000364 | Soil | MKNKDNSRKWMWWFLGTVVAMQLYFVRELLAVFALFILGFGLVAFLVV |
| AP72_2010_repI_A10DRAFT_10215291 | 3300000651 | Forest Soil | MKAKDNSRKWIWWFLGVIGAMQLYFVRELLAAFALFALGFAAIAAVVGAIYMLHSG |
| AP72_2010_repI_A10DRAFT_10439051 | 3300000651 | Forest Soil | MKTKDKSRRWMWWFLGVIGATQLYFVRELLAAFALFALGFGAIAALVGAVYMLHSGWA |
| JGI12053J15887_105616072 | 3300001661 | Forest Soil | MEQESGIEGMMKTKDNSRKWMWGFLAGVAALQLYVVWEILAALAIFAVGFAAIA |
| JGIcombinedJ26739_1010237382 | 3300002245 | Forest Soil | MKTQDSGRKWMWWFLGIVVALQMYFVRELLAAFAMFAAGFAA |
| JGI25382J37095_102361572 | 3300002562 | Grasslands Soil | MKNKDKSRKWMWWFLGVVAALQVYFVRELLAAFALFAMGFA |
| JGI25615J43890_10422492 | 3300002910 | Grasslands Soil | MXNXDKSRKWMWWFLGTVAALQLXFVRELLAAFALFAVAFAVIAFLGASLYMLQS |
| JGI25617J43924_102380993 | 3300002914 | Grasslands Soil | MKNKDKSRKWMWWFLGVVAALQVYFVRELLAAFALFAMGFAAVALAMGS |
| JGI26339J46600_101620852 | 3300003218 | Bog Forest Soil | VNAKDSLRKWIWWFLGGIAALQFYFVRELLAAFALFALGFV |
| JGI26347J50199_10230812 | 3300003350 | Bog Forest Soil | MKNKDSNRKWMWWFLGVVLALQLYFVRELVAAFALFALGFAAIAFVIMSLYMLQKAWE |
| Ga0062385_104402911 | 3300004080 | Bog Forest Soil | MWWFLGIVAALQLYFVRELLAAFALFALAFAVIAGLVAGVYMLQKSWEVAV |
| Ga0062387_1005862962 | 3300004091 | Bog Forest Soil | MMKNKDNSRKWMWWFLAVVVALQLYFVRELLAAFALFAIGFAAIAFLVIGVYMLQ |
| Ga0062388_1006507333 | 3300004635 | Bog Forest Soil | MTNKDKGRKWMWWFLGIVAAFQLYFVRELVAAFALFAVGFAAIAGLVAG |
| Ga0062388_1018979191 | 3300004635 | Bog Forest Soil | MKTKDNSRKWMWWFLGVVAALQLYFVWELLAAFALFAIGFAAIAF |
| Ga0070692_112944731 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | MKTKTKDNGRKWMWWFLAVVVALQMYFVKELLAAFALFAM |
| Ga0070708_1022264762 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MKTKDKSRKWMWWFLGVVVAMQMYFVRELLAAFALFALGFGVVAFVIAALYMLHQGWA |
| Ga0070699_1005880981 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MKTKDSSRKWMWWFLGVVLAMQLYFVRELLAAFALFVLGFGAIAFVLGALYM |
| Ga0066707_107038812 | 3300005556 | Soil | MKNKDKSRKWMWWFLGVVAALQVYFVRELLAAFALFAM |
| Ga0066699_104882682 | 3300005561 | Soil | MKTEDKTRKWMWMFLAALVSLQMYFVWELLAVFVLFAVGFAAI |
| Ga0070764_103039652 | 3300005712 | Soil | MENPMKKTDKSRKWMWWFLAIVGAMQLYFVRELLAAF |
| Ga0066903_1043508841 | 3300005764 | Tropical Forest Soil | MKTKDNGRKWMWWFLAVVVALQLYFVWELLAAFALFALGFAAIASVIASLFMLQK |
| Ga0066903_1078331471 | 3300005764 | Tropical Forest Soil | MKAKDKSRKWIWWLLGITGAMQLYFVRELLAAFALFALG |
| Ga0066788_101681711 | 3300005944 | Soil | MEIKDKGRKWMCWFLGTVLALQVYFVWELVAVLALFTLGFVALTAVVVGLYFV |
| Ga0075028_1004617931 | 3300006050 | Watersheds | MKNKDNSRKWMWWFLGVVVALQLYFVWELLAAFALFALGFAAVAFVVVSLYVLQ |
| Ga0075029_1002849531 | 3300006052 | Watersheds | MIKKDLGRKAIWWFLGIIAALQLYFVRELLAAFALFLLVFAVIALVI |
| Ga0075017_1011141312 | 3300006059 | Watersheds | MKNKDNSRKWMWWFLGGGAALQLYFVRELLAAFAFFAVAFAAIALV |
| Ga0070716_1003647403 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MKTKDNGRKWMWRFLAVLVALQLYFVRELLAAFALFALAFAAITF |
| Ga0070765_1020436101 | 3300006176 | Soil | MKPQDKSRKWMWSFLGLVAAFQLYFVRELLAAFALFA |
| Ga0097621_1014111062 | 3300006237 | Miscanthus Rhizosphere | MKTKDLSRKWMWWFLGVVVAMQLYFVRELLAVFALFALAFGVIAFLITAVYMLHQ |
| Ga0066659_104973681 | 3300006797 | Soil | MKTKDKSRKWMWMFLAVLVSLQTYFVWELLAVFALFAVGFAA |
| Ga0079221_110990692 | 3300006804 | Agricultural Soil | MKTKDNGRKWMWGFLGVLAALQLYFVRELLAAFALFALAFAAIAFVIVSLYMLQKGW |
| Ga0079220_102512101 | 3300006806 | Agricultural Soil | LGKVHRGSMKNKDSNRKWMWWFLGVVVALQLYFVRELLAAFALFALAFAGIALVI |
| Ga0075433_102567693 | 3300006852 | Populus Rhizosphere | MKTKDKSRKWVWWFLAVIGAMQLYLVRELLAAFALFALGFAAI |
| Ga0073928_104292162 | 3300006893 | Iron-Sulfur Acid Spring | MWWFLGVVLALQLYFVRELLTAFALFPFGFAAIAFVVMSLYMLQKVWEAGVQ |
| Ga0099793_101526351 | 3300007258 | Vadose Zone Soil | MNTKDESRKWMWMFLVALVSLQMYFVWELLAVFALFA |
| Ga0099829_101063071 | 3300009038 | Vadose Zone Soil | MKTKDSGRKWMWWFLGALVALQLYFVRELLAAFALFALGFAAIAFVIMSLYM |
| Ga0099829_103466621 | 3300009038 | Vadose Zone Soil | MWWFLAVLAALQFYLVRELLAAFALFAVGFAAMAVVVAGIYTARMTWEIAV |
| Ga0099827_101827771 | 3300009090 | Vadose Zone Soil | MKTKDRSRKWMWVFLVALFSLQTYFAWELLAVFALFALGFAAI |
| Ga0105247_104946732 | 3300009101 | Switchgrass Rhizosphere | MKTKDKSRKWMWWFLAVIGAMQLYFVRELLAAFALFALGFGAIALVIGAVYTLH |
| Ga0066709_1010921251 | 3300009137 | Grasslands Soil | MKTKDKSRKWMWMFLAVLVSLQTYFVWELLAVFALFAVGFAAIAF |
| Ga0099792_100224101 | 3300009143 | Vadose Zone Soil | MKTKDESRKWMWMFLAALVSLQMYFVWELLAVFVLFA |
| Ga0099792_100829632 | 3300009143 | Vadose Zone Soil | MKKTKDNGRKWMWRFLGVLAALQLYFVRELLAAFALFALAFAAIAFVIVSLYML |
| Ga0099792_109524491 | 3300009143 | Vadose Zone Soil | MKTKDNGRKWMWRFLGVLAALQLYFVRELLAAFALFALAFAAIAFVIVSL |
| Ga0099792_109927241 | 3300009143 | Vadose Zone Soil | MTNKDNGRKWMWRFLGVLAALQLYFVRELLAAFALFALAFAAIACAIISLYMLQK |
| Ga0075423_118490101 | 3300009162 | Populus Rhizosphere | MKTKDKSRKWMWWFLAVIGAMQLYFVRELLAAFALFA |
| Ga0105248_123687751 | 3300009177 | Switchgrass Rhizosphere | MKTKDKSRKWMWWFLGMLGAMQLYFVRELLAAFALFALGFAAIAAVLGTIYM |
| Ga0105237_109260601 | 3300009545 | Corn Rhizosphere | MKTKDKSRKWMWWFLGVIGAMQLYFVRELLAAFALFALGFGAIAV |
| Ga0116115_10063981 | 3300009631 | Peatland | MKKDASRKWMWWFLIALAAVQIYFVRELLAVFALFSLGFAA |
| Ga0116113_11961471 | 3300009638 | Peatland | MENKDKGRKWMWWFLGIVAALQLYFVRELLAAFALFAVGFA |
| Ga0105854_13867491 | 3300009660 | Permafrost Soil | MEIKDKGRKWMWWFLGTVLALQVYFVWELVAVLALFTLGFVALTAVVVGLYFV |
| Ga0126374_108486342 | 3300009792 | Tropical Forest Soil | MKTKDKSRKWMWWFLGIIGAMQLYFVRELLAAFALFALGFAAV |
| Ga0126380_102515582 | 3300010043 | Tropical Forest Soil | MENPSMKKTDKSRKWMWWFLAIVAAMQLYFVQELLAAFALFA |
| Ga0126384_106244122 | 3300010046 | Tropical Forest Soil | MKTKTKDNGRKWMWWFLAVVVALQMYFVKELLAAFALFALGFVAIAAVVVAG |
| Ga0126384_122355081 | 3300010046 | Tropical Forest Soil | MNTKDKGRKWMWWFLGVLGAIQLYFVRELLAAFALFALVFGTIA |
| Ga0126382_107742901 | 3300010047 | Tropical Forest Soil | MKTKDKSRKWMWWFLGVMGATQLYFVRELLAAFALFAL |
| Ga0126382_112266801 | 3300010047 | Tropical Forest Soil | MKTKDKSRKWMWWFLGVIGAMQLYFVRELLAAFAL |
| Ga0126382_121431961 | 3300010047 | Tropical Forest Soil | MKTKDKSRKWMWWFLGVIGALQLYFVRELLAAFALFALGFAAI |
| Ga0126373_102756781 | 3300010048 | Tropical Forest Soil | MSKDKGRKWIWWFLGIIAAMQLYFVRELLAAFAIF |
| Ga0134065_101078362 | 3300010326 | Grasslands Soil | MKTEDESRKWMWMFLATLVLLQMYFVWELLAVFLLFAVGFA |
| Ga0126370_115263213 | 3300010358 | Tropical Forest Soil | MKTKDKGRKWMWMFLGTVAAAQIYFVQELLAALALFALGFAAI |
| Ga0126370_116796081 | 3300010358 | Tropical Forest Soil | MKNKAKAQDNGRKWMWYFLAVVVLLQMYFVKELLAAFALFAMGF |
| Ga0126376_120682681 | 3300010359 | Tropical Forest Soil | MWWLLGLVAALQLYFVRELLAAFALFALTFAVIGGFIGGLYLLQKAWSS |
| Ga0126376_131454021 | 3300010359 | Tropical Forest Soil | MKTKDKSRKWMWWFLGVIGATQLYFVRELLAAFALLALGLGAIAPFDAA |
| Ga0126378_111038821 | 3300010361 | Tropical Forest Soil | MKNKDKSRKWMWWLLGSIAALQAYFVRELLAAFALFA |
| Ga0126378_118902951 | 3300010361 | Tropical Forest Soil | MSKRDKSRKWIWIFLGTIAAMQLYFVRELLAAFAIFLLGFSVIALAIS |
| Ga0126379_103687161 | 3300010366 | Tropical Forest Soil | MKTKDKSRKWMWWFLGVIGATQLYFVRELLAAFALFALG |
| Ga0126379_122856041 | 3300010366 | Tropical Forest Soil | MKTKDSSRKWMWWFLGIIVAMQIYFVRELVAAFALFALGFGVIAFVVGPLYMLHHG |
| Ga0134125_129922602 | 3300010371 | Terrestrial Soil | MKTKTKDNGRKWMWWFLAVVVALQMYFVKELLAAFALFALGFA |
| Ga0126381_1040000321 | 3300010376 | Tropical Forest Soil | MSKRDKGRKWIWIFLAVIAAMQLYVVRELLAAFAI |
| Ga0134124_119750001 | 3300010397 | Terrestrial Soil | MKTKDKSRKWMWWFLAVIGAMQLYFVRELLAAFALFALGFGAIA |
| Ga0126383_100673781 | 3300010398 | Tropical Forest Soil | MWWLLGLVAALQLYFVRELLAAFALFALAFAVIGGFIGGLYLLQKAWSSAVVRVADS |
| Ga0137776_15666631 | 3300010937 | Sediment | MTKKDASRKWMWWVLGAVVALQLYFVRELIAAFALFALGFGVIAFLVASVYMLQK |
| Ga0137392_115065281 | 3300011269 | Vadose Zone Soil | MKTKDKSRKWMWGFLAGIASLQLYFVWELLAAFALFALGFAAITLVTGCIYM |
| Ga0137393_100895233 | 3300011271 | Vadose Zone Soil | MKNADKSRKWMWWFLGTVAALQLYFVRELLAAFALFAVAFAVIAFLGASLY |
| Ga0137393_103728161 | 3300011271 | Vadose Zone Soil | MKTKDSGRKWMWWFLGALVALQLYFVRELLAAFALFALGFAAIAFVIVSL |
| Ga0137393_116599991 | 3300011271 | Vadose Zone Soil | MKTKDKSRKWMWMFLAALVSLQMYFVWELLAVFALFALGFAAI |
| Ga0137389_116444631 | 3300012096 | Vadose Zone Soil | MGNGNRGKMQTKDKSRKWMWGFLGLVVALQMYFVWELLAVFAL |
| Ga0137388_112039591 | 3300012189 | Vadose Zone Soil | MKTKDESRKWMWMFLAVLVSLQMYFVWELLAVFALFAVGFA |
| Ga0137364_104704471 | 3300012198 | Vadose Zone Soil | MKTEDESRKWMWMFLATLVLLQMYFVWELLAVFLLF |
| Ga0137382_102873272 | 3300012200 | Vadose Zone Soil | MKTEDKSRKWMWMFLATLVLLQMYFVWELLAVFLLFAVGFAAIAFV |
| Ga0137382_107550521 | 3300012200 | Vadose Zone Soil | MKTKDESRKWMWMFLAALVSLQMYFVWELLAVFALFAV |
| Ga0137365_112569101 | 3300012201 | Vadose Zone Soil | MKTKDKSRKWMWMFLGALVSLQMYFVWELLAVFALFALGF |
| Ga0137363_108374621 | 3300012202 | Vadose Zone Soil | MKTKDNGRKWMWWFLGVLAALQLYFVRELLAAFALFALAFAAIAFVIVS |
| Ga0137363_108984511 | 3300012202 | Vadose Zone Soil | MKTKDKSRKWMWMFLAALVSLQMYFVWELLAVFALFALG |
| Ga0137363_109989292 | 3300012202 | Vadose Zone Soil | MKNKDKSRKWMWGFLGMVLAMQMYFVRELLAAFALFALGFAAIASVVAAV |
| Ga0137399_112254561 | 3300012203 | Vadose Zone Soil | MKTKDKSRKWMWMFLAVLVSLQMYFVWELLAVFALFAVGFAAIAF |
| Ga0137399_115015201 | 3300012203 | Vadose Zone Soil | MKTKDSSRKWMWWFLAVVLAMQLYFVRELLAAFALFVLGFAAIAF |
| Ga0137362_103434181 | 3300012205 | Vadose Zone Soil | MKTNDSSRKWMWWFLGVVLAMQLYFVRELLAAFALFVLGFGAIAFVLGAVYMLHQ |
| Ga0137362_113890171 | 3300012205 | Vadose Zone Soil | MKTKDSSRKWMWWFLAVVLAMQLYFVRELLAAFALF |
| Ga0137379_107999741 | 3300012209 | Vadose Zone Soil | MGARKKMRIKDKSRKWMWIFLAALVSLQMYFVWELLAVFALFAVGFAAI |
| Ga0137370_102125221 | 3300012285 | Vadose Zone Soil | MKTMDKSRKWMWMFLAALVSLQMYFVWELLAVFALFAVGFAA |
| Ga0137360_109766101 | 3300012361 | Vadose Zone Soil | MGAGKMKTKDKSRKWMWMFLAALVSLQMYFVWELLAVFALF |
| Ga0137361_104015521 | 3300012362 | Vadose Zone Soil | MKTKDNGRKWMWWFLGVLVALQLYFVRELLAAFALFALAFAAIAFVIVS |
| Ga0137361_104447671 | 3300012362 | Vadose Zone Soil | MKTKDSSRKWMWWFLAVVLAMQLYFVRELLAAFAL |
| Ga0137390_102235013 | 3300012363 | Vadose Zone Soil | MKTKDNSRKWMWMFLAALDLLQTYFVWELLAVFALFAAGFAVLAFVVG |
| Ga0137390_112921881 | 3300012363 | Vadose Zone Soil | MGTEDRMKTKDSGRKWMWWFLGVLAALQLYFVRELLAAFALFALAFAAIAFVIVSLYMLQKGW |
| Ga0137358_101391681 | 3300012582 | Vadose Zone Soil | MKTKDSSRKWMWWFLAVVLAMQLYFVRELLAAFALFVLGFGAIGFVLGALYLLHHGW |
| Ga0137358_103524461 | 3300012582 | Vadose Zone Soil | MNIQDQSRKWIWWFLGIIAAMQLYFVRELLAAFAIFILGFA |
| Ga0137358_106509391 | 3300012582 | Vadose Zone Soil | MNIQDQSRKWIWWFLGIIAAMQLYFVRELLAAFAIFI |
| Ga0137358_108740661 | 3300012582 | Vadose Zone Soil | MKTKDNGRKWMWRFLAVLAALQLYFVRELLAAFALFALAFAAI |
| Ga0137397_106005451 | 3300012685 | Vadose Zone Soil | MKTKDNGRKWMWRFLAVLAALQLYFVRELLAAFALFALAFAAIAFVIVSL |
| Ga0137395_102298531 | 3300012917 | Vadose Zone Soil | MKTKDSSRKWMWWFLAVVLAMQLYVVRELLAAFAVFVLGFGA |
| Ga0137395_109117312 | 3300012917 | Vadose Zone Soil | MGHGNRGKMKTKDKSRKWMWGFLAAVVALQVYFVWELLAVFALFAVGFAAIAAVV |
| Ga0137396_106577361 | 3300012918 | Vadose Zone Soil | MKTEDKSRKWMWMFLAALVSLQMYFVWELLAVLALFAV |
| Ga0137359_102894921 | 3300012923 | Vadose Zone Soil | MKTQDQGRKWMWGLLGAIALFQMYFVRELLAAFALFA |
| Ga0137359_106195701 | 3300012923 | Vadose Zone Soil | MKTKDSSRKWMWWFLAVVLAMQLYFVRELLAAFALFVL |
| Ga0137359_111537581 | 3300012923 | Vadose Zone Soil | MKNKDKSRKWMWWFLGVVLAMQLYFVRELFAAFALFALGFAAVAFVVAA |
| Ga0137359_111917492 | 3300012923 | Vadose Zone Soil | MKNKDKSRKWMWWFLGVVLAMQLYFVRELFAAFALFALGFGAITFVVAALYMLH |
| Ga0137359_114620551 | 3300012923 | Vadose Zone Soil | MKTKDKSRKWMWGFLGIVLAMQMYFVRELLAAFALFALGFAAIASVVAALYMLHHGWAVA |
| Ga0137413_113646062 | 3300012924 | Vadose Zone Soil | MKTKDQSRKWMWGFLGIVLAMQMYFVRELLAAFALFTLGFAAIASVVAAL |
| Ga0137419_106456391 | 3300012925 | Vadose Zone Soil | MKTKDKSRKWMWGFLGMVLAMQMYFVRELLAAFALFALGFAAIASVVAAVYMLHHGW |
| Ga0137419_110236931 | 3300012925 | Vadose Zone Soil | MKTKDNGRKWMWRFLAVLAALQLYFVRELLAAFALFALAFASIAFVIVSLY |
| Ga0137419_116297882 | 3300012925 | Vadose Zone Soil | MNTKDESRKWMWMFLVALVSLQMYFVWELLAVFALF |
| Ga0137419_119830611 | 3300012925 | Vadose Zone Soil | MKTKDNGRKWMWRFLAVLAALQLYFVRELLAAFALFALAFA |
| Ga0137416_114937692 | 3300012927 | Vadose Zone Soil | MKTKDSSRKWMWWFLAVVLAMQLYFVRELLAAFALFVLGFAAIAFVLGA |
| Ga0137416_121133561 | 3300012927 | Vadose Zone Soil | MGKRAEMKTKDNGRKWMWWFLGVLAALQLYFVRELLAAFALFAMAFAAIAFVVVSLYMLQ |
| Ga0137416_121606471 | 3300012927 | Vadose Zone Soil | MKTKDERRKWMWTFLAALVSLQMYFVWELLAVFALFAVGF |
| Ga0137404_100527371 | 3300012929 | Vadose Zone Soil | MKTKDNGRKWMWRFLAVLAALQLYFVRELLAAFALFALAFAAIAFV |
| Ga0137404_116200191 | 3300012929 | Vadose Zone Soil | MGNGNRGKMKTKDKSRKWMWGFLGLVVALQMYFVWELLAVFALFAVGFAAI |
| Ga0137404_117465261 | 3300012929 | Vadose Zone Soil | MKNKDKSRKWMWWFLGVVLAMQLYFVRELFAAFALFALGFGAI |
| Ga0126375_105443071 | 3300012948 | Tropical Forest Soil | MKNKDKSRKWMWWLLASIAALQAYFVRELLAAFALFALGFAGVAAV |
| Ga0164301_106007311 | 3300012960 | Soil | MKTKDLSRKWMWWFLGVVVAMQLYFVRELLAVFAL |
| Ga0126369_115302962 | 3300012971 | Tropical Forest Soil | MKVKDKSRKWIWWFLGVIGATQLYFVRELLAAFALF |
| Ga0134087_102529432 | 3300012977 | Grasslands Soil | MKTKDKSRKWMWTFLAVLVSLQMYFVWELLAVFVLFA |
| Ga0164304_111711721 | 3300012986 | Soil | MGNGNRGKMKTKDKSRKWMWGFLAGVVALQMYFVWELLAVFALFAVGFAAIAAVA |
| Ga0163162_134013661 | 3300013306 | Switchgrass Rhizosphere | MKTKDKSRKWMWWFLGMLGAMQLYFVRELLAAFALFALGF |
| Ga0157372_132534931 | 3300013307 | Corn Rhizosphere | MKTKTKDNGRKWMWWFLAVVVALQMYFVKELLAAFALFAMGFA |
| Ga0181524_102204381 | 3300014155 | Bog | VNAKDSFRKWIWWFLGGIVALQFYFVRELLAAFALFALGFV |
| Ga0134079_107504521 | 3300014166 | Grasslands Soil | MKTEDKSRKWMWMFLATLVLLQMYFVWELLAVFLLFAV |
| Ga0182024_101385873 | 3300014501 | Permafrost | MKNEDNGRKWLWWFLGMMGALQLYFVRELLAAFALFAA |
| Ga0157379_103093731 | 3300014968 | Switchgrass Rhizosphere | MKKTDKSRKWMWWFLAIVGASQLYFVQELLAAFALFAA |
| Ga0137418_103179721 | 3300015241 | Vadose Zone Soil | MKTNDKSRKWMWGFLGIVLAMQMYFVRELLAAFALFALGFA |
| Ga0137403_106704001 | 3300015264 | Vadose Zone Soil | MKTKDNSRKWMWGFLGLVVALQMYFVWELLAVFALFAVGFAAIAAVVGSLYML |
| Ga0137403_108051171 | 3300015264 | Vadose Zone Soil | MKTKDKSRKWMWMFLAALVSLQMYFVWELLAVLALFAV |
| Ga0137403_108260871 | 3300015264 | Vadose Zone Soil | MKNKDNSRKLMWWFLGVGGALQLYFDRELLAAFALFAAVFVVLG |
| Ga0132258_106471493 | 3300015371 | Arabidopsis Rhizosphere | MKNKAKAKDNGRKWMWWFLAVVILLQMYFVKELLAAFALFAMGFAAIGFVVA |
| Ga0132258_134044462 | 3300015371 | Arabidopsis Rhizosphere | MKTKDKSRKWVWWFLAVIGAMQLYFVRELLAAFALFAL |
| Ga0182037_118347871 | 3300016404 | Soil | MKTRDKSRKWMWWFLAVIGAVQLYFVRELLAAFALFALGF |
| Ga0182038_103124081 | 3300016445 | Soil | MSKRDKGRKWIWYFLGTIAALQLYFVRELLAAFAIFMLGFAVIG |
| Ga0134112_102793731 | 3300017656 | Grasslands Soil | MKNKDKSRKWMWWFLGVVAALQVYFVRELLAAFALFAMGFAAVALAMGSL |
| Ga0187812_11920761 | 3300017821 | Freshwater Sediment | VKVKDNLRKWIWWFLGGIAALQLYFVRELLAAFALFALAFI |
| Ga0187807_11243931 | 3300017926 | Freshwater Sediment | MTKIKDNGRKWMWMFLAALALLQVYFVQELLAAFALFALGF |
| Ga0187779_110485641 | 3300017959 | Tropical Peatland | MKTTDKGRKWMWGFLGALALLQTYFAWEVLAAFALFAVVFAAI |
| Ga0187782_111246291 | 3300017975 | Tropical Peatland | VGKVDRGTMKIKDSNRKWMWWFLGAVLALQLYFVRELLAAFALFAFGFAAIALLFVGLYMAQ |
| Ga0187885_101929321 | 3300018025 | Peatland | VNDKDNFRKWIWWFLGGIAALQFYFVRELLAAFALFALGF |
| Ga0066667_109198141 | 3300018433 | Grasslands Soil | MNTKTKDNGRKWMWWFLAVVAALQMYLVKELLAAFALFAVGFAAI |
| Ga0179590_10417731 | 3300020140 | Vadose Zone Soil | MKTKDNGRKWMWRFLAVLAALQLYFVRELLAAFALFALAFAAIAFVIVSLYMLQKSW |
| Ga0210407_111883211 | 3300020579 | Soil | MKTKDKSRKWMWGFLAAVVALQAYFVWEILAAFALFLVGFAAIA |
| Ga0210399_110990532 | 3300020581 | Soil | MANKAKDNWRKWMWMFLGIIAALQLYFVRELLAAFALFALGFAGI |
| Ga0210401_106321992 | 3300020583 | Soil | MKIKDSKRKWMWWFLGVVLAPQLYFVRELLAAFALFALGFAAIAFVVVSLYMLQKV |
| Ga0215015_110178594 | 3300021046 | Soil | MSKPDKGRNWIWWFLGTIAAMQLYFVRELLAAFAIFIPVSYTH |
| Ga0215015_110930041 | 3300021046 | Soil | MKIEDKGRKWMWCFLGVLGASQLYFVQELTAAFALFAIGFAALAFVLGLSLIHI |
| Ga0179596_106808211 | 3300021086 | Vadose Zone Soil | MKTKDNGRKWMWRFLGVAGAFQLYFVRELVAAFALFAAVFAVFG |
| Ga0179596_106829121 | 3300021086 | Vadose Zone Soil | MKTKDSSRKWMWWFLAVVLAMQLYFVRELLAAFALFVLGFG |
| Ga0210404_101947071 | 3300021088 | Soil | MGTEDRMKTKDSGRKWMWWFLGVLVALQLYFVRELLAAFALFALGFAAIAFVIVSLY |
| Ga0210400_107667501 | 3300021170 | Soil | MKTKDNGRKWMWWFLGVLAALQLYFVRELLAAFVLFAMGFAAIAFVVVSLYMLQKG |
| Ga0210400_108420971 | 3300021170 | Soil | MKTKDNGRKWMWWFLGVLAALQLYFVRELLAAFALFAMGFAAIAFVVVSLYMLQKG |
| Ga0210405_110691971 | 3300021171 | Soil | MKIKDNGRTWMWWFLGVAGALQLYFVKELVAAFALFAAVFAVFGV |
| Ga0210396_113417411 | 3300021180 | Soil | MENPMKKTDKSRKWMWWFLAIVGAMQLYFVRELLAA |
| Ga0210388_110031081 | 3300021181 | Soil | MKTKDNSRTWMWWFLGVGGALQLYFVRELLAALALFAAVF |
| Ga0210393_105772182 | 3300021401 | Soil | MKNKDSKRKWMWWFLGIVLALQLYFVRELVAAFALFALGFAAIAFVVMSLYMLQK |
| Ga0210385_104687922 | 3300021402 | Soil | MENPMKKTDKSRKWMWWFLAIVGAMQLYFVRELLAAFALFAAVFAVIG |
| Ga0210389_103922093 | 3300021404 | Soil | MKNKDSKRKWMWWFLGIVVAYPLYFVRELLAAFALV |
| Ga0210389_109462881 | 3300021404 | Soil | MKNKDNSRKWMWWFLAIVGAMQLYFVQELLAAFALFAAVFAVIG |
| Ga0210387_118900421 | 3300021405 | Soil | MKTKDNGRKWMWRFLGVLVALQLYFVRELLAAFALFALAFAAIAFVVVSLYM |
| Ga0210386_104696692 | 3300021406 | Soil | MENPMKKTDKSRKWMWWFLAIVGAMQLYFVRELLAAFALFAAVF |
| Ga0210386_116093381 | 3300021406 | Soil | MSKQDKGRKWIWWFLGVIAAMQLYFVRELLAAFAIFI |
| Ga0210383_101734581 | 3300021407 | Soil | MGSKDKGRKWLWWFLGVIAALQLYWVRELLAAFAIFALGFAVIAALIGSLYM |
| Ga0210394_117493411 | 3300021420 | Soil | MSKQDKGRKWIWWFLGTIAAMQLYFVRELLAAFAIFILGFAVIGIC |
| Ga0210390_111223771 | 3300021474 | Soil | MKTKDNSRTWMWWFLGVGGALQLYFVRELLAAFALFAAVFAVFGVV |
| Ga0210402_100192261 | 3300021478 | Soil | MKTKDKSRKWMWWFLGVVVAMQMYFVRELLAAFALFALGFGVVAFVIGALYMLQQ |
| Ga0210402_103627822 | 3300021478 | Soil | MKTKDNGRKWMWGFLGVLVALQLYFVRELLAAFALFALA |
| Ga0210402_119722401 | 3300021478 | Soil | MKTKDNGRKWMWRFLGVLVALQLYFVRELLAAFALFALAFA |
| Ga0210402_119859371 | 3300021478 | Soil | MGSKDKGRKWLWWFLGVIAALQLYWVRELLAAFAIFALGFAVI |
| Ga0210410_104305031 | 3300021479 | Soil | MSKQDKGRKWIWWFLGIIAAMQLYFVRELLAAFAIFILGFAVIG |
| Ga0210409_106517852 | 3300021559 | Soil | MSKQDMGRKWIWWFLGTIAAMQLYFVRELLAAFAIFILGFAVIGV |
| Ga0242655_103202441 | 3300022532 | Soil | MASKDKSRKWMWWFLGIVVAMQLYFVRELLAAFALFVLAFAVIGSV |
| Ga0212123_105335601 | 3300022557 | Iron-Sulfur Acid Spring | MENKDKGRKWMWWFLGIVAALQLYFVRELLAAFALFAVGFAVIAGLI |
| Ga0137417_14256722 | 3300024330 | Vadose Zone Soil | MKSTDKSRKWMWMFLAALVSLQMYFVWELLAVLALFAVG |
| Ga0208687_10572952 | 3300025469 | Peatland | VNDKDSFRKWIWWFLGGIAALQFYFVRELLAAFALFALGFVVIGLCL |
| Ga0207671_113808811 | 3300025914 | Corn Rhizosphere | MKTKDKSRKWMWWFLAVIGAMQLYFVRELLAAFALFALGFG |
| Ga0207663_101270172 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MKNKDNSRKWMWWFLGTVVAMQLYFVRELLAVFALFI |
| Ga0207700_113320301 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MKTKDSSRKWMWWFLGVVLAMQLYFVRELLAAFALFVLGFGAIALVLGVL |
| Ga0207665_111731201 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MGNGNRGQMKNRDNGRKWMWWFLGVLAALQLYFVRELLAAFALFAVGFAALASVVISVY |
| Ga0207648_116684031 | 3300026089 | Miscanthus Rhizosphere | MKTKTKDNGRKWMWWFLAVVVALQMYFVKELLAALALFAMGFAAMAFVVAS |
| Ga0209438_11939411 | 3300026285 | Grasslands Soil | MKTKDNGRKWMWRFLAVLAALQLYFVRELLAAFALFALAFAAIAFVIVS |
| Ga0209240_12750471 | 3300026304 | Grasslands Soil | MKTKDSSRKWMWWFLGVVLAMQLYFVRELLAAFALFV |
| Ga0209153_10340911 | 3300026312 | Soil | MKNKDNSRKWMWWFLGIILAMQLYFVRELLAVFALFILGF |
| Ga0209131_12690471 | 3300026320 | Grasslands Soil | MKTKDKSRKWMWWFLGVVVAMQMNFVRELLAAFALFALGFGVV |
| Ga0209687_11587571 | 3300026322 | Soil | MKNKDNSRKWMWWFLGIVLAMQLYFVRELLAVFALFILGFG |
| Ga0209808_11755892 | 3300026523 | Soil | MKTKDKSRKWMWMFLAVLVSLQIYFVWELLAVFALFAIGFAAIAFVVGSV |
| Ga0209474_102158661 | 3300026550 | Soil | MKTKDKSRKWMWMFLAVLVSLQTYFVWELLAVFALFA |
| Ga0209648_104168922 | 3300026551 | Grasslands Soil | MWWFLGVVLALQLYFVRELLAAFALFALGFAAIAFVVVSLYMLQK |
| Ga0209325_10450971 | 3300027050 | Forest Soil | MKTKDSSRKWMWWFLAVVLAMQLYFVRELLAAFALFVLGFGAIA |
| Ga0207948_10405841 | 3300027174 | Forest Soil | MSKQDKGRKWIWWFLGTIAAMQLYFVRELLAAFAIFIL |
| Ga0207761_10614711 | 3300027516 | Tropical Forest Soil | MKTKDMFRKWMWLGLGTVAAMQLYFVRELLAVFALFVLGFAAIAALIMSL |
| Ga0208985_10299651 | 3300027528 | Forest Soil | MKNKDNGRKWLWWFLGIMGALQLYFVRELLAAFALFAAVFAVFGLAI |
| Ga0209734_11125911 | 3300027535 | Forest Soil | MKTKDKSRKWMWMFLAALVSLQMYFVWELLAVFALFAV |
| Ga0209008_10656911 | 3300027545 | Forest Soil | MENPMKKTDKSRKWMWWFLAIVGAMQLYFVRELLAAFALFAAVFAV |
| Ga0209735_11502231 | 3300027562 | Forest Soil | MWWFLAVVLALQLYFVRELLAAFALFALGFAAIAFVVMSLYML |
| Ga0209527_10946651 | 3300027583 | Forest Soil | MKTKDNGRKWMWWFLGVLVALQLYFVRELLAAFALFAMAFAAVAFVIMSLY |
| Ga0209388_10453462 | 3300027655 | Vadose Zone Soil | MKTKDKSRKWMWMFLAVMVSLQVYFVWELLAAFAL |
| Ga0209388_10817652 | 3300027655 | Vadose Zone Soil | MKTEDKSRKWMWMFLAVLVSLQMYFVWELVAVFALFAVGFA |
| Ga0209388_11554041 | 3300027655 | Vadose Zone Soil | MGNGNRGKMKTKDKSRKWMWAFLGLVVALQMYFVWELLAVFALFAVGFAAL |
| Ga0209588_12482591 | 3300027671 | Vadose Zone Soil | MGNGNRGKMKTKDKSRKWMWGFLGLVVALQMYFVWELLAVFALFAVGFAAIA |
| Ga0208989_101743601 | 3300027738 | Forest Soil | MKTKDKSRKWMWIFLAALVSLQMYFVWELLAVFALF |
| Ga0209139_101563501 | 3300027795 | Bog Forest Soil | MMKNKDNSRKWMWWFLAVVVALQLYFVRELLAAFALFAIGFAAIAFLVIGVYML |
| Ga0209580_105529131 | 3300027842 | Surface Soil | MKNRDNRRKWMWWFLGVLGALQLYFVRELLAAFALFA |
| Ga0209701_100371773 | 3300027862 | Vadose Zone Soil | MKTKDKSRKWMWGFLAGIASLQLYFVWELLAAFALFALGFAAIALVTGCVYML |
| Ga0209701_104125022 | 3300027862 | Vadose Zone Soil | MGDTGYMKTKDKSRKWMWMFLAALVSLQMYFVWELLAVFALFAV |
| Ga0209701_107395833 | 3300027862 | Vadose Zone Soil | MRNEDKSRKWMWWFLGTVAALQLYFVRELLAAFALFAVAFAVIAF |
| Ga0209465_103499252 | 3300027874 | Tropical Forest Soil | MSKRDKGRKWIWYFLGTVAALRLYFVRELLAAFAI |
| Ga0209283_104213371 | 3300027875 | Vadose Zone Soil | MKTEDKSRKWMWMFLAALVSLQVYFVWELLAVFVLFAVGFAAISFV |
| Ga0209169_106886011 | 3300027879 | Soil | MSKQDKGRKWIWWFLGTIAAMQLYFVRELLAAFAIF |
| Ga0209067_104199482 | 3300027898 | Watersheds | MGIVEAGKMKNKDKSRKWMWWILGIIAAMQIYFVQELVAAFVLFALGFAGIALVIGSLYMLHKTW |
| Ga0209048_105498121 | 3300027902 | Freshwater Lake Sediment | MKTKDTFRKWMWMLLGLVSALQLYFVRELLAAFALFILGFAVIAAMIMSLYLLQKSWES |
| (restricted) Ga0233418_103052751 | 3300027995 | Sediment | VGTEVSRKWIWAALAVAAVALQAYFVRELLAALILFAAVFAVL |
| Ga0209526_100800011 | 3300028047 | Forest Soil | MKTKDIGRKWMWWFLAVMFALQLYFVRELLAAFALFAMG |
| Ga0209526_106734411 | 3300028047 | Forest Soil | MKTKDESRKWMWGFLGVVVALQMYFVWEILAAFALFAVGFAAIAT |
| Ga0209526_109563551 | 3300028047 | Forest Soil | MKTKDNSRKWLWWFLGVAGALQLYFVRELLAAFALFAAVFA |
| Ga0137415_105321601 | 3300028536 | Vadose Zone Soil | MKTKDKSRKWMWMFLAVLVSLQTYFVWELLAVFALFAVGF |
| Ga0137415_114641731 | 3300028536 | Vadose Zone Soil | MKKTKDNGRKWMWRFLGVLVALQLYFVRELLAAFALFAMAFAAIAFV |
| Ga0302221_102013941 | 3300028806 | Palsa | MQTKDKGRKWMWWFLGLVVAFQLYFVRELLAAFALFAVGFAAIA |
| Ga0308309_111564532 | 3300028906 | Soil | MGSKDTGRKWLWWFLGVIAALQLYWVRELLAAFAIFAFGFA |
| Ga0222749_103560641 | 3300029636 | Soil | MGIAETGKMKNKDKSRKWMWWFLGIIAALQVYFVQELLAAFVLFALGFAAIALVIGSLYMLH |
| Ga0222749_104332911 | 3300029636 | Soil | MKNKDKSRKWMWWFLAVVVALQLYFVRELLAAFALFAVAFAAIAFVIAGL |
| Ga0302177_100015761 | 3300030053 | Palsa | METKDKSRKWMWWFLAAVLAVQVYFVWELVAALALFALGFGALTA |
| Ga0302184_101106501 | 3300030490 | Palsa | MQNKDKSRKWMWWFLGIVVALQLYFVRELLAAFALFALAFAAIAGLIAGLY |
| Ga0075405_110440931 | 3300030847 | Soil | MSKQDKGRKWIWWFLGIIAAMQLYFVRELLAAFAIFIL |
| Ga0170834_1115109881 | 3300031057 | Forest Soil | MKTKDSSRKWMWWFLGVVLAMQLYFVRELLAAFAL |
| Ga0170824_1174855131 | 3300031231 | Forest Soil | MKTKDKSRKWMWGFLGIVLAMQMYFVRELLAAFALFALGFAAI |
| Ga0318555_107449421 | 3300031640 | Soil | MKAKDHRRKWMWWFLGVVLAMQLYFVRELLAAFALFVLGFAVLA |
| Ga0318561_104516902 | 3300031679 | Soil | MKTKDKSRRWMWWFLGAIAATQLYFVRELLAAFALFALGFGAIAALV |
| Ga0310686_1153589721 | 3300031708 | Soil | MKTKDSNRKWMWWFLGVVIALQLYFVRELVAAFALFALGFAAIAFVVMS |
| Ga0307476_105407492 | 3300031715 | Hardwood Forest Soil | MKTKDNSRTWMWWFLGVGGALQLYFVRELLAALALF |
| Ga0307474_100760541 | 3300031718 | Hardwood Forest Soil | MKPQDKSRKWMWSFLGLVAAFQLYFVRELLAAFALF |
| Ga0307474_114625251 | 3300031718 | Hardwood Forest Soil | MKTKDNGRKWMWRFLGVLVALQLYFVRELLAAFALFALAFGAVAF |
| Ga0307469_112502132 | 3300031720 | Hardwood Forest Soil | MKSKDKSRKWMWWFLGSVIALQLYFVRELVAAFVLFALVFVVI |
| Ga0307468_1024694832 | 3300031740 | Hardwood Forest Soil | MKSKDKSRKWMWWFLGSVIALQLYFVRELVAAFVLFALVFVVIGGFVAGLYA |
| Ga0307477_111270151 | 3300031753 | Hardwood Forest Soil | LVDEGNMKIKDNSRKWMWWFLGAVVALQFFYVRELLAAFALFALGFA |
| Ga0307475_100239751 | 3300031754 | Hardwood Forest Soil | MKTKDKSRKWMWMFLAALVLLQTYFVWELLAVFAL |
| Ga0307478_106496702 | 3300031823 | Hardwood Forest Soil | MKTKDNSRTWMWWFLGVGGALQLYFVRELLAALALFAAVFAV |
| Ga0307478_112428091 | 3300031823 | Hardwood Forest Soil | MWSFLGLVAAFQLYFVRELLAAFALFAVGFAAIALLVASVYMMQKFWEV |
| Ga0306921_112148342 | 3300031912 | Soil | MKTRDKSRKWMWWFLAVIGAVQLYFVRELLAAFALFALGFGIVAFVLATLY |
| Ga0310913_107247362 | 3300031945 | Soil | MKTTDKSRKWMWWFLGAIGAIQLYFVRELLAAFALFALG |
| Ga0306926_128993222 | 3300031954 | Soil | MKTTDTGRKWMWWFLGAIGAVQLYFVRELLAAFALFALVFGIVAFVLAALYML |
| Ga0307470_100987671 | 3300032174 | Hardwood Forest Soil | MKTKDSSRKWMWWFLAVVLAMQLYFVRELLAAFALFVLGFGAIAFVLGAVYMIHQ |
| Ga0307471_1006281731 | 3300032180 | Hardwood Forest Soil | MGNGNRGKMKTKDSGRKWMWGFLGLVVALQTYIVWELLAVFALF |
| Ga0307471_1006634942 | 3300032180 | Hardwood Forest Soil | MKTKDSGRKWMWWFLGVLAALQLYFVRELLAAFALFAMAFAAIAFVIVSLYMLQK |
| Ga0335085_108986332 | 3300032770 | Soil | MKNKDNSRKWMWWFLAIIGAMQLYFVRELLAAFALFAA |
| Ga0335085_114672982 | 3300032770 | Soil | MKTTDKGRKWMWGFLGAVALLQTYFAWEVLAALALFAVV |
| Ga0364934_0325698_438_581 | 3300034178 | Sediment | MSKKDTGRKWMWWFLAAVAALQLYFVRELIAAFALFAVGFAVLATVVS |
| ⦗Top⦘ |