| Basic Information | |
|---|---|
| Family ID | F015639 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 253 |
| Average Sequence Length | 44 residues |
| Representative Sequence | ESEGRWEDRSAKSAYDSVLLGENGQVKEVRFAGQTRVFVFSE |
| Number of Associated Samples | 173 |
| Number of Associated Scaffolds | 253 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 1.81 % |
| % of genes near scaffold ends (potentially truncated) | 85.77 % |
| % of genes from short scaffolds (< 2000 bps) | 70.75 % |
| Associated GOLD sequencing projects | 153 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.70 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (86.561 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (28.854 % of family members) |
| Environment Ontology (ENVO) | Unclassified (30.830 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (49.802 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 30.00% Coil/Unstructured: 70.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.70 |
| Powered by PDBe Molstar | |
| SCOP family | SCOP domain | Representative PDB | TM-score |
|---|---|---|---|
| e.45.1.1: Antivirulence factor | d1nh1a_ | 1nh1 | 0.61408 |
| d.129.1.1: TATA-box binding protein (TBP), C-terminal domain | d1pcza2 | 1pcz | 0.60611 |
| e.83.1.1: Coronavirus S1 beta-rich region | d3jcla3 | 3jcl | 0.5918 |
| d.104.1.1: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain | d1yfsa2 | 1yfs | 0.59071 |
| d.129.1.0: automated matches | d3eika1 | 3eik | 0.59031 |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 253 Family Scaffolds |
|---|---|---|
| PF02547 | Queuosine_synth | 83.79 |
| PF00011 | HSP20 | 6.72 |
| PF02861 | Clp_N | 3.56 |
| PF12850 | Metallophos_2 | 0.79 |
| PF01435 | Peptidase_M48 | 0.79 |
| PF02823 | ATP-synt_DE_N | 0.40 |
| PF02321 | OEP | 0.40 |
| COG ID | Name | Functional Category | % Frequency in 253 Family Scaffolds |
|---|---|---|---|
| COG0809 | S-adenosylmethionine:tRNA-ribosyltransferase-isomerase (queuine synthetase) | Translation, ribosomal structure and biogenesis [J] | 83.79 |
| COG0071 | Small heat shock protein IbpA, HSP20 family | Posttranslational modification, protein turnover, chaperones [O] | 6.72 |
| COG0542 | ATP-dependent Clp protease, ATP-binding subunit ClpA | Posttranslational modification, protein turnover, chaperones [O] | 3.56 |
| COG1538 | Outer membrane protein TolC | Cell wall/membrane/envelope biogenesis [M] | 0.79 |
| COG0355 | FoF1-type ATP synthase, epsilon subunit | Energy production and conversion [C] | 0.40 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 86.56 % |
| Unclassified | root | N/A | 13.44 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2189573004|GZGWRS402G2YA5 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 505 | Open in IMG/M |
| 3300002917|JGI25616J43925_10044131 | All Organisms → cellular organisms → Bacteria | 1946 | Open in IMG/M |
| 3300003350|JGI26347J50199_1045856 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 516 | Open in IMG/M |
| 3300004082|Ga0062384_100130896 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1393 | Open in IMG/M |
| 3300004100|Ga0058904_1444016 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 549 | Open in IMG/M |
| 3300004139|Ga0058897_10794265 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 553 | Open in IMG/M |
| 3300004633|Ga0066395_10943595 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 524 | Open in IMG/M |
| 3300005176|Ga0066679_10180655 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1337 | Open in IMG/M |
| 3300005179|Ga0066684_10042208 | All Organisms → cellular organisms → Bacteria | 2567 | Open in IMG/M |
| 3300005179|Ga0066684_10125459 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1603 | Open in IMG/M |
| 3300005186|Ga0066676_10529347 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 800 | Open in IMG/M |
| 3300005434|Ga0070709_10041281 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2842 | Open in IMG/M |
| 3300005434|Ga0070709_10553305 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 881 | Open in IMG/M |
| 3300005436|Ga0070713_101912149 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 576 | Open in IMG/M |
| 3300005530|Ga0070679_101023258 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 770 | Open in IMG/M |
| 3300005534|Ga0070735_10076303 | All Organisms → cellular organisms → Bacteria | 2147 | Open in IMG/M |
| 3300005538|Ga0070731_10148814 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1553 | Open in IMG/M |
| 3300005555|Ga0066692_10866173 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 554 | Open in IMG/M |
| 3300005556|Ga0066707_10653054 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 665 | Open in IMG/M |
| 3300005557|Ga0066704_10929970 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 537 | Open in IMG/M |
| 3300005568|Ga0066703_10151094 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1395 | Open in IMG/M |
| 3300005568|Ga0066703_10584413 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 652 | Open in IMG/M |
| 3300005598|Ga0066706_10110323 | All Organisms → cellular organisms → Bacteria | 2014 | Open in IMG/M |
| 3300005602|Ga0070762_10410673 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 874 | Open in IMG/M |
| 3300005602|Ga0070762_11023636 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 567 | Open in IMG/M |
| 3300005712|Ga0070764_10493006 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 736 | Open in IMG/M |
| 3300005921|Ga0070766_10986144 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 579 | Open in IMG/M |
| 3300006059|Ga0075017_100450050 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 972 | Open in IMG/M |
| 3300006162|Ga0075030_100141990 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium → unclassified Acidobacterium → Acidobacterium sp. | 1945 | Open in IMG/M |
| 3300006173|Ga0070716_100498972 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 897 | Open in IMG/M |
| 3300006174|Ga0075014_100024190 | All Organisms → cellular organisms → Bacteria | 2375 | Open in IMG/M |
| 3300006176|Ga0070765_101958258 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 548 | Open in IMG/M |
| 3300006797|Ga0066659_10094814 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2015 | Open in IMG/M |
| 3300006797|Ga0066659_11419013 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 580 | Open in IMG/M |
| 3300006893|Ga0073928_10604594 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 774 | Open in IMG/M |
| 3300007258|Ga0099793_10025348 | All Organisms → cellular organisms → Bacteria | 2474 | Open in IMG/M |
| 3300007258|Ga0099793_10037660 | All Organisms → cellular organisms → Bacteria | 2088 | Open in IMG/M |
| 3300009038|Ga0099829_10571877 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 939 | Open in IMG/M |
| 3300009038|Ga0099829_10652454 | Not Available | 875 | Open in IMG/M |
| 3300009088|Ga0099830_11738471 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 521 | Open in IMG/M |
| 3300009089|Ga0099828_10400651 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1238 | Open in IMG/M |
| 3300009089|Ga0099828_11478306 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 599 | Open in IMG/M |
| 3300009089|Ga0099828_11739755 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 548 | Open in IMG/M |
| 3300009520|Ga0116214_1053099 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1470 | Open in IMG/M |
| 3300010043|Ga0126380_11548445 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 589 | Open in IMG/M |
| 3300010159|Ga0099796_10143452 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 935 | Open in IMG/M |
| 3300010320|Ga0134109_10149839 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 839 | Open in IMG/M |
| 3300010326|Ga0134065_10163547 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 785 | Open in IMG/M |
| 3300010343|Ga0074044_10901338 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 578 | Open in IMG/M |
| 3300010358|Ga0126370_10390292 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1140 | Open in IMG/M |
| 3300010358|Ga0126370_11382245 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 664 | Open in IMG/M |
| 3300010359|Ga0126376_12921018 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 527 | Open in IMG/M |
| 3300010360|Ga0126372_10729963 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 971 | Open in IMG/M |
| 3300010360|Ga0126372_11020829 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 840 | Open in IMG/M |
| 3300010361|Ga0126378_12198358 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 629 | Open in IMG/M |
| 3300010362|Ga0126377_10068088 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3159 | Open in IMG/M |
| 3300010364|Ga0134066_10429535 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 511 | Open in IMG/M |
| 3300010375|Ga0105239_11713117 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 728 | Open in IMG/M |
| 3300010379|Ga0136449_101959937 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 867 | Open in IMG/M |
| 3300011120|Ga0150983_10486778 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 642 | Open in IMG/M |
| 3300011120|Ga0150983_10644115 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1313 | Open in IMG/M |
| 3300011120|Ga0150983_11613539 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 524 | Open in IMG/M |
| 3300011120|Ga0150983_11668563 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 761 | Open in IMG/M |
| 3300011120|Ga0150983_13284155 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 514 | Open in IMG/M |
| 3300011120|Ga0150983_14777304 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 675 | Open in IMG/M |
| 3300011120|Ga0150983_14826806 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 784 | Open in IMG/M |
| 3300011120|Ga0150983_15063829 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 545 | Open in IMG/M |
| 3300011120|Ga0150983_15223276 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 647 | Open in IMG/M |
| 3300011120|Ga0150983_15294702 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 560 | Open in IMG/M |
| 3300011269|Ga0137392_10723480 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 824 | Open in IMG/M |
| 3300011269|Ga0137392_11210756 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 614 | Open in IMG/M |
| 3300011270|Ga0137391_10344246 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1281 | Open in IMG/M |
| 3300011270|Ga0137391_10543390 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 979 | Open in IMG/M |
| 3300011270|Ga0137391_11544528 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 508 | Open in IMG/M |
| 3300011271|Ga0137393_10763356 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 827 | Open in IMG/M |
| 3300011271|Ga0137393_11182496 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 649 | Open in IMG/M |
| 3300011271|Ga0137393_11328331 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 608 | Open in IMG/M |
| 3300012096|Ga0137389_10111844 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium | 2187 | Open in IMG/M |
| 3300012189|Ga0137388_10072383 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2876 | Open in IMG/M |
| 3300012199|Ga0137383_10001673 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 13352 | Open in IMG/M |
| 3300012199|Ga0137383_10205574 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1443 | Open in IMG/M |
| 3300012199|Ga0137383_11310149 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 516 | Open in IMG/M |
| 3300012202|Ga0137363_11163435 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 656 | Open in IMG/M |
| 3300012203|Ga0137399_11641775 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 531 | Open in IMG/M |
| 3300012205|Ga0137362_10021619 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4969 | Open in IMG/M |
| 3300012205|Ga0137362_10155922 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1954 | Open in IMG/M |
| 3300012205|Ga0137362_10624172 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 929 | Open in IMG/M |
| 3300012205|Ga0137362_10858043 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 776 | Open in IMG/M |
| 3300012206|Ga0137380_11106122 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 675 | Open in IMG/M |
| 3300012359|Ga0137385_10150959 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium | 2043 | Open in IMG/M |
| 3300012361|Ga0137360_10787752 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 818 | Open in IMG/M |
| 3300012361|Ga0137360_11455552 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 589 | Open in IMG/M |
| 3300012362|Ga0137361_10721577 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 910 | Open in IMG/M |
| 3300012362|Ga0137361_10850438 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 829 | Open in IMG/M |
| 3300012363|Ga0137390_10230295 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1839 | Open in IMG/M |
| 3300012582|Ga0137358_10473068 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 845 | Open in IMG/M |
| 3300012683|Ga0137398_10094679 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1868 | Open in IMG/M |
| 3300012917|Ga0137395_10520399 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 857 | Open in IMG/M |
| 3300012918|Ga0137396_10063540 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium | 2564 | Open in IMG/M |
| 3300012918|Ga0137396_10110093 | All Organisms → cellular organisms → Bacteria | 1976 | Open in IMG/M |
| 3300012918|Ga0137396_10379978 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1047 | Open in IMG/M |
| 3300012918|Ga0137396_10719792 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 736 | Open in IMG/M |
| 3300012923|Ga0137359_10104626 | All Organisms → cellular organisms → Bacteria | 2501 | Open in IMG/M |
| 3300012923|Ga0137359_10194227 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1813 | Open in IMG/M |
| 3300012923|Ga0137359_10631939 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 937 | Open in IMG/M |
| 3300012923|Ga0137359_11729328 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 513 | Open in IMG/M |
| 3300012924|Ga0137413_10060208 | All Organisms → cellular organisms → Bacteria | 2236 | Open in IMG/M |
| 3300012924|Ga0137413_11253563 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 593 | Open in IMG/M |
| 3300012927|Ga0137416_10430758 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1123 | Open in IMG/M |
| 3300012927|Ga0137416_11970314 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 535 | Open in IMG/M |
| 3300012929|Ga0137404_10543946 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1040 | Open in IMG/M |
| 3300012929|Ga0137404_10818238 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 847 | Open in IMG/M |
| 3300012930|Ga0137407_10812835 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 883 | Open in IMG/M |
| 3300014150|Ga0134081_10011445 | All Organisms → cellular organisms → Bacteria | 2384 | Open in IMG/M |
| 3300014154|Ga0134075_10014230 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium → Acidobacterium ailaaui | 3101 | Open in IMG/M |
| 3300015053|Ga0137405_1308289 | Not Available | 945 | Open in IMG/M |
| 3300015053|Ga0137405_1398219 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 5139 | Open in IMG/M |
| 3300015242|Ga0137412_10437812 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1007 | Open in IMG/M |
| 3300015264|Ga0137403_10032413 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5511 | Open in IMG/M |
| 3300015264|Ga0137403_10598927 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 967 | Open in IMG/M |
| 3300016422|Ga0182039_11585419 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 597 | Open in IMG/M |
| 3300017947|Ga0187785_10623103 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 557 | Open in IMG/M |
| 3300017959|Ga0187779_10020893 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3734 | Open in IMG/M |
| 3300018006|Ga0187804_10150778 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 979 | Open in IMG/M |
| 3300019786|Ga0182025_1291608 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1382 | Open in IMG/M |
| 3300020199|Ga0179592_10084319 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1458 | Open in IMG/M |
| 3300020579|Ga0210407_11025203 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 628 | Open in IMG/M |
| 3300020581|Ga0210399_10304470 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1330 | Open in IMG/M |
| 3300020581|Ga0210399_10667311 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 856 | Open in IMG/M |
| 3300020581|Ga0210399_11418223 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 542 | Open in IMG/M |
| 3300020582|Ga0210395_10092215 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2236 | Open in IMG/M |
| 3300020583|Ga0210401_10158402 | All Organisms → cellular organisms → Bacteria | 2115 | Open in IMG/M |
| 3300020583|Ga0210401_10761608 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 828 | Open in IMG/M |
| 3300020583|Ga0210401_11089821 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 657 | Open in IMG/M |
| 3300021046|Ga0215015_10096207 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 580 | Open in IMG/M |
| 3300021171|Ga0210405_11234038 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 552 | Open in IMG/M |
| 3300021180|Ga0210396_10179894 | All Organisms → cellular organisms → Bacteria | 1893 | Open in IMG/M |
| 3300021180|Ga0210396_10231792 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1644 | Open in IMG/M |
| 3300021384|Ga0213876_10123827 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1373 | Open in IMG/M |
| 3300021401|Ga0210393_10985816 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 682 | Open in IMG/M |
| 3300021404|Ga0210389_10037071 | All Organisms → cellular organisms → Bacteria | 3745 | Open in IMG/M |
| 3300021406|Ga0210386_11325602 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 605 | Open in IMG/M |
| 3300021407|Ga0210383_10082037 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2701 | Open in IMG/M |
| 3300021420|Ga0210394_10093243 | All Organisms → cellular organisms → Bacteria | 2603 | Open in IMG/M |
| 3300021420|Ga0210394_10188697 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1796 | Open in IMG/M |
| 3300021478|Ga0210402_10407765 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1262 | Open in IMG/M |
| 3300021559|Ga0210409_10015113 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium | 7625 | Open in IMG/M |
| 3300021559|Ga0210409_10123734 | All Organisms → cellular organisms → Bacteria | 2377 | Open in IMG/M |
| 3300021560|Ga0126371_10379206 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1553 | Open in IMG/M |
| 3300021861|Ga0213853_10750206 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1012 | Open in IMG/M |
| 3300022531|Ga0242660_1068070 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 814 | Open in IMG/M |
| 3300022531|Ga0242660_1141080 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 624 | Open in IMG/M |
| 3300022724|Ga0242665_10147497 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 740 | Open in IMG/M |
| 3300022724|Ga0242665_10356276 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 525 | Open in IMG/M |
| 3300024186|Ga0247688_1003565 | All Organisms → cellular organisms → Bacteria | 2286 | Open in IMG/M |
| 3300024227|Ga0228598_1048578 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 840 | Open in IMG/M |
| 3300024249|Ga0247676_1037398 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 783 | Open in IMG/M |
| 3300025906|Ga0207699_11125076 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
| 3300026315|Ga0209686_1142299 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 752 | Open in IMG/M |
| 3300026325|Ga0209152_10313188 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 590 | Open in IMG/M |
| 3300026342|Ga0209057_1045528 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2121 | Open in IMG/M |
| 3300026481|Ga0257155_1082112 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 524 | Open in IMG/M |
| 3300026482|Ga0257172_1095247 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 547 | Open in IMG/M |
| 3300026527|Ga0209059_1038597 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium → Acidobacterium ailaaui | 2135 | Open in IMG/M |
| 3300026527|Ga0209059_1343434 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 507 | Open in IMG/M |
| 3300026532|Ga0209160_1042325 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2729 | Open in IMG/M |
| 3300026548|Ga0209161_10209864 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1065 | Open in IMG/M |
| 3300026551|Ga0209648_10120981 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2112 | Open in IMG/M |
| 3300026557|Ga0179587_11010566 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 547 | Open in IMG/M |
| 3300027047|Ga0208730_1026020 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 672 | Open in IMG/M |
| 3300027660|Ga0209736_1202199 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 515 | Open in IMG/M |
| 3300027671|Ga0209588_1221850 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 584 | Open in IMG/M |
| 3300027727|Ga0209328_10235655 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 548 | Open in IMG/M |
| 3300027729|Ga0209248_10101296 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 869 | Open in IMG/M |
| 3300027748|Ga0209689_1058714 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium → Acidobacterium ailaaui | 2118 | Open in IMG/M |
| 3300027846|Ga0209180_10159566 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1300 | Open in IMG/M |
| 3300027869|Ga0209579_10126516 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1358 | Open in IMG/M |
| 3300027875|Ga0209283_10701686 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 632 | Open in IMG/M |
| 3300027884|Ga0209275_10647685 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 607 | Open in IMG/M |
| 3300027889|Ga0209380_10083474 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1835 | Open in IMG/M |
| 3300027986|Ga0209168_10165729 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1116 | Open in IMG/M |
| 3300028047|Ga0209526_10102519 | All Organisms → cellular organisms → Bacteria | 2014 | Open in IMG/M |
| 3300028047|Ga0209526_10298549 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1091 | Open in IMG/M |
| 3300028047|Ga0209526_10337299 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1013 | Open in IMG/M |
| 3300028536|Ga0137415_10326768 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1337 | Open in IMG/M |
| 3300028536|Ga0137415_11338995 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 535 | Open in IMG/M |
| 3300028577|Ga0265318_10215463 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 702 | Open in IMG/M |
| 3300028746|Ga0302233_10103475 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1121 | Open in IMG/M |
| 3300028795|Ga0302227_10095545 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1240 | Open in IMG/M |
| 3300030042|Ga0302300_1161585 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 641 | Open in IMG/M |
| 3300030737|Ga0302310_10295826 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 912 | Open in IMG/M |
| 3300031057|Ga0170834_108861957 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 620 | Open in IMG/M |
| 3300031057|Ga0170834_111651354 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 667 | Open in IMG/M |
| 3300031090|Ga0265760_10028976 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1626 | Open in IMG/M |
| 3300031231|Ga0170824_119948160 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 629 | Open in IMG/M |
| 3300031708|Ga0310686_100951728 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1161 | Open in IMG/M |
| 3300031715|Ga0307476_10229592 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1352 | Open in IMG/M |
| 3300031715|Ga0307476_10356371 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1078 | Open in IMG/M |
| 3300031720|Ga0307469_10814617 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 858 | Open in IMG/M |
| 3300031720|Ga0307469_12014971 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 560 | Open in IMG/M |
| 3300031754|Ga0307475_10009811 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 6315 | Open in IMG/M |
| 3300031754|Ga0307475_10062700 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2826 | Open in IMG/M |
| 3300031754|Ga0307475_10733414 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 786 | Open in IMG/M |
| 3300031820|Ga0307473_10011284 | All Organisms → cellular organisms → Bacteria | 3263 | Open in IMG/M |
| 3300031820|Ga0307473_10597497 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 761 | Open in IMG/M |
| 3300031823|Ga0307478_10127343 | All Organisms → cellular organisms → Bacteria | 2002 | Open in IMG/M |
| 3300031823|Ga0307478_10310576 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1293 | Open in IMG/M |
| 3300031833|Ga0310917_10914572 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 590 | Open in IMG/M |
| 3300031912|Ga0306921_11219371 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 837 | Open in IMG/M |
| 3300031942|Ga0310916_11536079 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 542 | Open in IMG/M |
| 3300031946|Ga0310910_11490808 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 519 | Open in IMG/M |
| 3300031962|Ga0307479_10174500 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2113 | Open in IMG/M |
| 3300031962|Ga0307479_11186324 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 727 | Open in IMG/M |
| 3300031962|Ga0307479_12163663 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 503 | Open in IMG/M |
| 3300032174|Ga0307470_11604285 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 544 | Open in IMG/M |
| 3300032180|Ga0307471_100181254 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium | 2078 | Open in IMG/M |
| 3300032180|Ga0307471_101233148 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 911 | Open in IMG/M |
| 3300032180|Ga0307471_102034447 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 721 | Open in IMG/M |
| 3300032180|Ga0307471_102704634 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 629 | Open in IMG/M |
| 3300032205|Ga0307472_100162707 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1648 | Open in IMG/M |
| 3300033480|Ga0316620_11201362 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 743 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 28.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 13.04% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 8.70% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 8.70% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 7.11% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.74% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.77% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.37% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.37% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.98% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.19% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.19% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.19% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.58% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.58% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.58% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.58% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.79% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.79% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.79% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.79% |
| Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 0.40% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.40% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.40% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.40% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.40% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.40% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.40% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.40% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.40% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.40% |
| Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 0.40% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.40% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.40% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.40% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.40% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.40% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2189573004 | Grass soil microbial communities from Rothamsted Park, UK - FG2 (Nitrogen) | Environmental | Open in IMG/M |
| 2228664022 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300002917 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_100cm | Environmental | Open in IMG/M |
| 3300003350 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004100 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF244 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004139 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF230 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
| 3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
| 3300010320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010364 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014150 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
| 3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300017947 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
| 3300019786 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021046 | Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depth | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Host-Associated | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300021861 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022531 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-28-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022724 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300024186 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK29 | Environmental | Open in IMG/M |
| 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Host-Associated | Open in IMG/M |
| 3300024249 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK17 | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026315 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 (SPAdes) | Environmental | Open in IMG/M |
| 3300026325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes) | Environmental | Open in IMG/M |
| 3300026342 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 (SPAdes) | Environmental | Open in IMG/M |
| 3300026481 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-19-A | Environmental | Open in IMG/M |
| 3300026482 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-16-B | Environmental | Open in IMG/M |
| 3300026527 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 (SPAdes) | Environmental | Open in IMG/M |
| 3300026532 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 (SPAdes) | Environmental | Open in IMG/M |
| 3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027047 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF042 (SPAdes) | Environmental | Open in IMG/M |
| 3300027660 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027727 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027729 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027748 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027986 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Host-Associated | Open in IMG/M |
| 3300028746 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_1 | Environmental | Open in IMG/M |
| 3300028795 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_1 | Environmental | Open in IMG/M |
| 3300030042 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E1_1 | Environmental | Open in IMG/M |
| 3300030737 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_2 | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300033480 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D5_B | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| FG2_08320420 | 2189573004 | Grass Soil | EGRWEDRDTKSSYDAVMLGENGQVKEVRFAGQKRVFVFSE |
| INPgaii200_11802732 | 2228664022 | Soil | SEGRWEERDSKSEYTSILVGENGQIREVRFAGQKKVFVFSE |
| JGI1027J12803_1041443902 | 3300000955 | Soil | RWEERDAKSEYTSILVGENGQVREVRFAGQKKVFVFSE* |
| JGI25616J43925_100441311 | 3300002917 | Grasslands Soil | QKGKSVVAESEGRWEDRDTKSNYDAVLLGENGQVKEVRFSGQKRVFVLSE* |
| JGI26347J50199_10458562 | 3300003350 | Bog Forest Soil | NQVLAESEGRWEDRSAKSAYDSVLIGENGQVKEVRFSGQTRVFVFSE* |
| Ga0062384_1001308961 | 3300004082 | Bog Forest Soil | EKGKQVVAESEGRWEDREAKSAYDAVLLNNNGQVTEVRFSGQKRVFVFSE* |
| Ga0062389_1040959541 | 3300004092 | Bog Forest Soil | VQKGKSVVAESEGRWEDRDTKANADSLLLGADGSVKEVRFAGKTKVFVFNE* |
| Ga0058904_14440162 | 3300004100 | Forest Soil | VAESEGRWEERDTKSNYDAVLLSESGQVKEVRFSGQKRVFVFSE* |
| Ga0058897_107942652 | 3300004139 | Forest Soil | SEGRWEDRSRKSDYDSVLISETGKVMEVRFAGQTRVFVFSE* |
| Ga0066395_109435952 | 3300004633 | Tropical Forest Soil | VAESEGRWEDRSAKSNYDSLLISENGQVKEVRFSGQARVFVFSE* |
| Ga0066672_101874132 | 3300005167 | Soil | GRQVVAESEGRWEERNAKSVYDSLLLGENGQVREVRFAGQTRVFVFSE* |
| Ga0066679_101806552 | 3300005176 | Soil | QKGKQVVAESEGRWEDRSTKSAYDSLLLGDNGQVREVRFAGQTRVFVFSE* |
| Ga0066684_100422081 | 3300005179 | Soil | KATVQKGGKVVAESEGRWEDRSAKSSYDSLLISENGQVKEVRFSGQSRVFVFSE* |
| Ga0066684_101254592 | 3300005179 | Soil | QKGKQVVAESEGRWEDRSTKSVYDSLLLGENGQVREVRFAGQARVFVFSE* |
| Ga0066676_105293472 | 3300005186 | Soil | QKGKQVVAESEGRWEDRSAKSAYDSLLLGENGQVREVRFAGQTRVFVFSE* |
| Ga0070709_100412811 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | EGRWEDRTTKSSNDSVLIGENGQVKEVRFSGKTRVFVFSE* |
| Ga0070709_105533051 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | DGNKATVQKGKSVVAQSEGRWEDRDTKSIYDAVLLNDAGKVSEVRFAGQKKVFVFSE* |
| Ga0070713_1019121492 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | AQSEGRWEDRDKKSDYDAVLLGENGQVKEVRFSGQKRVFVFSE* |
| Ga0070679_1010232581 | 3300005530 | Corn Rhizosphere | AEAEGRWEDRTTKSSNDSVLIGENGQVKEVRFSGKTRVFVFSE* |
| Ga0070735_100763031 | 3300005534 | Surface Soil | AQSEGRWEDRDTKSNYDAVLLNDAGQVQEVRFAGQKKVFIFSE* |
| Ga0070731_101488142 | 3300005538 | Surface Soil | EGRWEDRSSKSAYDSVLLSETGQVKEVRFAGQTRVFVFSE* |
| Ga0066692_108661731 | 3300005555 | Soil | AESEGRWEDRETKSNYDAVLLGENGQVKEVRFSGQKRVFVFSE* |
| Ga0066707_106530541 | 3300005556 | Soil | QIAEAEGRWEERALKSDYNSVLIEADGQVKEVRFAGEKRVFVLSE* |
| Ga0066704_109299701 | 3300005557 | Soil | NKATVQKGKQVVAESEGRWEDRSTKSIYDSVVLSANGQVMEVRFAGQNRVFVFSE* |
| Ga0066703_101510941 | 3300005568 | Soil | QHGKDQVAQSEGRWEDRDKKSDYDAVLLGENGQVKEVRFSGQKRVFVFSE* |
| Ga0066703_105844131 | 3300005568 | Soil | QVVAESEGRWEERNAKSVYDSLLLGENGQVREVRFAGQTRVFVFSE* |
| Ga0066706_101103231 | 3300005598 | Soil | AESDGRWEDRDAKSSYDAVLLSDNGQVKEVRFSGQKRVFVFNE* |
| Ga0070762_104106733 | 3300005602 | Soil | QSEGRWEDRDTKSNYDAVLLNDSGQVSEVRFAGQKKVFVFSE* |
| Ga0070762_110236362 | 3300005602 | Soil | RWEDRDAKSAYDAVLLNNNGQVTEVRFSGQKRVFVFNE* |
| Ga0070764_104930061 | 3300005712 | Soil | GKTVVAQSEGRWEDRDTKSNYDAVLLNDAGQVQEVRFAGQKKVFIFSE* |
| Ga0068858_1010311072 | 3300005842 | Switchgrass Rhizosphere | SEGRWEERDSKSEYTSILVGENGQIREVRFAGQKKVFVFSE* |
| Ga0070766_109861441 | 3300005921 | Soil | QTIAESEGRWEDRATKSSMDSVLIGENGQVKEVRFSGQTRVFVFSE* |
| Ga0075017_1004500503 | 3300006059 | Watersheds | QMVAESEGRWEDRESKAAYDSVLIGGNGQLKEVRFAGQNRVFVFNE* |
| Ga0075030_1001419903 | 3300006162 | Watersheds | EVVAESEGRWEDRSTKSNYDSVLVNETGKVLEVRFAGQNRVFVFSE* |
| Ga0070716_1004989721 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | AESEGRWEDREAKSNYDAVLLGDNGQVKEVRFSGQKRIFVFSE* |
| Ga0075014_1000241901 | 3300006174 | Watersheds | EGRWEDRSAKSDYNSVVLSETGKIMEVRFAGQTRVFVFSE* |
| Ga0070712_1010251102 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | GKNTVAESEGRWEDRDQKSQYTAILLGPDGQVREVRFAGQKRVFVFGE* |
| Ga0070765_1019582582 | 3300006176 | Soil | ATVQKGKTVVAQSEGRWEDRDTKSNYDAVLLNDAGQVQEVRFAGQKKVFIFSE* |
| Ga0066659_100948143 | 3300006797 | Soil | VAESEGRWEDRSTKSSYDSLLVGENGQVKEVRFAGQTRVFVFSE* |
| Ga0066659_114190131 | 3300006797 | Soil | ESEGRWEDRSAKSAYDSVLLGENGQVKEVRFAGQTRVFVFSE* |
| Ga0075434_1017343112 | 3300006871 | Populus Rhizosphere | EGRWEERDSKSDYTSILVGENGQVREVRFAGQKKVFVFNE* |
| Ga0075434_1024980212 | 3300006871 | Populus Rhizosphere | AESEGRWEERDAKSEYTSILVGENGQVREVRFAGQKKVFVFSE* |
| Ga0073928_106045941 | 3300006893 | Iron-Sulfur Acid Spring | RETKSVYDAVLLGEKGQVTEVRFSGQKRVFVLNE* |
| Ga0099793_100253484 | 3300007258 | Vadose Zone Soil | QKGKSVVAESEGRWEDRDAKSNYDAVLLGENGQVKEVRFSGQKRVFVFSE* |
| Ga0099793_100376601 | 3300007258 | Vadose Zone Soil | EGRWEDRDAKSNYDAVLLGENGQVKEVRFSGQKRVFVFSE* |
| Ga0099829_105718771 | 3300009038 | Vadose Zone Soil | DRSTKSVYDAVLISETGQVKEVRFAGQVRVFVFSE* |
| Ga0099829_106524542 | 3300009038 | Vadose Zone Soil | TVQKGKATVAESGGRWEERDQKSSYDAVLLAADGQVKEVRFAGKKSVFVFNN* |
| Ga0099830_117384711 | 3300009088 | Vadose Zone Soil | VVAESEGRWEDRSTKSAYDSILIGENGQVREVRFAGQMRVFVFSE* |
| Ga0099828_104006512 | 3300009089 | Vadose Zone Soil | EGRWEDRDTKSNYDAVLLGENGQVREVRFSGQKRVFVFSE* |
| Ga0099828_114783061 | 3300009089 | Vadose Zone Soil | QKGKSVIAESEGRWEERDTKSNYDAVLIGENGQVKEVRFSGQKRVFVFSE* |
| Ga0099828_117397552 | 3300009089 | Vadose Zone Soil | VQKGKQVVAESEGRWEDRSAKSAYDSLLLGENGQVKEARFAGQTRVFVFSE* |
| Ga0105248_130394961 | 3300009177 | Switchgrass Rhizosphere | SEGRWEERDTKSEYTSILVGENGQVREVRFAGQKKVFVFSE* |
| Ga0116214_10530991 | 3300009520 | Peatlands Soil | EVVAESEGRWEDRSAKSDYDSIVIGEAGQVKEVRFAGQTRVFVFNE* |
| Ga0126380_115484451 | 3300010043 | Tropical Forest Soil | DRSTKFRHDAVTIRENGQVKEVRFSGQKRVFVFNE* |
| Ga0126384_103875901 | 3300010046 | Tropical Forest Soil | GRWEERGSKSDYTSILVGENGQVREVRFAGQKKVFVFSE* |
| Ga0126382_118329222 | 3300010047 | Tropical Forest Soil | AESEGRWEERDTKSEYTSILVGENGQVREVRFAGQKKVFVFNE* |
| Ga0099796_101434522 | 3300010159 | Vadose Zone Soil | DRSAKSAYDSLLLGENGQVREVRFAGQTRVFVFSE* |
| Ga0134109_101498391 | 3300010320 | Grasslands Soil | GRWEDRSAKSRYDSLLISENGQVKEVRFSGQSRVFVFSE* |
| Ga0134065_101635471 | 3300010326 | Grasslands Soil | DRSAKSSYDSLLIGENGQVKEVRFSGQSRVFVFGE* |
| Ga0074044_109013382 | 3300010343 | Bog Forest Soil | ANKTVAESEGRWEDRDTKSPFDAVLLSENGQVKEVRFAGQKRVFVFSE* |
| Ga0126370_103902922 | 3300010358 | Tropical Forest Soil | ATVQKGGKVVAESEGRWEDRSAKSSYDSVLISENGQVKEVRFSGQSRVFVFSE* |
| Ga0126370_113822452 | 3300010358 | Tropical Forest Soil | WEDRTTKSPYDAVLIGENGQVKEVRFSGQKRVFVFNE* |
| Ga0126376_129210181 | 3300010359 | Tropical Forest Soil | DRSNKAAYDSVLLGENGQVKEVRFAGQTRVFVFSE* |
| Ga0126372_107299632 | 3300010360 | Tropical Forest Soil | VAQSEGRWEDRNTKSDYDAVLLNADGQVKEVRFSGQKRVFVFNN* |
| Ga0126372_110208291 | 3300010360 | Tropical Forest Soil | ERDTKSNYDAVLLGDHGQVKEVRFSGQKRVFVFNE* |
| Ga0126378_121983582 | 3300010361 | Tropical Forest Soil | WEDRSAKANYNSVLIDESGQVKEVRFAGQTRVFVFSE* |
| Ga0126377_100680881 | 3300010362 | Tropical Forest Soil | EVAQSEGRWEERSTKSDYDAVLLGENGQVKEVRFYGQKRVFVFNE* |
| Ga0126377_130128562 | 3300010362 | Tropical Forest Soil | WEERDKKSEYTSILVGENGQVREVRFAGQKRVFVFNE* |
| Ga0134066_104295351 | 3300010364 | Grasslands Soil | KVSVQHGKDQVAQSEGRWEDRDRKSDYDAVLLGENGQVKEVRFSGQKRVFVFSE* |
| Ga0105239_117131171 | 3300010375 | Corn Rhizosphere | TVQKGKSVVAQSEGRWEDRDTKSIYDAVLLNDAGKVSEVRFAGQKKVFVFSK* |
| Ga0136449_1019599371 | 3300010379 | Peatlands Soil | SEGRWEDRSTKSEYNSVLLSETGNVKEVRFAGQSRVFVFSE* |
| Ga0150983_104867781 | 3300011120 | Forest Soil | GRQMVAESEGRWEDRQTKSAYDSVLLGENGQLKEVRFAGQSRVFVFSE* |
| Ga0150983_106441153 | 3300011120 | Forest Soil | RWEDRSSKAANDSVLIGEDGQVKEVRFSGQTRVFVFSE* |
| Ga0150983_116135391 | 3300011120 | Forest Soil | KTVAESEGRWEDRESKSQYDAVLLSENGQVKEVRFAGQKRVFVFSE* |
| Ga0150983_116685631 | 3300011120 | Forest Soil | TVQKGKSVVAESEGRWEDRDTKSNYDAVLLGENGQVREVRFSGQKRVFVFSE* |
| Ga0150983_132841552 | 3300011120 | Forest Soil | VESEGRWEDRSSKAANDSVLIGEDGQVKEVRFSGQTRVFVFSE* |
| Ga0150983_147773041 | 3300011120 | Forest Soil | TKATVQKGKQTIAESEGRWEDRATKSSYDSVLIGEDGQVKEVRFSGQTRVFVFSE* |
| Ga0150983_148268061 | 3300011120 | Forest Soil | RWEDRSTKAAYDSVLLAENGQVKEVRFAGQTRVFVFSE* |
| Ga0150983_150638291 | 3300011120 | Forest Soil | TVQKGKSVVAESEGRWEERDTKSNYDAVLLSESGQVKEVRFSGQKRVFVFSE* |
| Ga0150983_152232761 | 3300011120 | Forest Soil | IVESEGRWEDRSSKAANDSVLIGEDGQVKEVRFSGQTRVFVFSE* |
| Ga0150983_152947021 | 3300011120 | Forest Soil | ESEGRWEDRASKSSNDSVLIGENGQVKEVRFSGQTRVFVFNE* |
| Ga0137392_107234802 | 3300011269 | Vadose Zone Soil | QKGKQVVAESEGRWEDRSAKSAYNSLLLGENGQVKEARFAGQTRVFVFSE* |
| Ga0137392_112107561 | 3300011269 | Vadose Zone Soil | AESEGRWEDRSTKSAYDSVVIAATGQVMEVRFAGQTRVFVFSE* |
| Ga0137391_103442461 | 3300011270 | Vadose Zone Soil | ESEGRWEDRSAKSAYDSLLLGENGQVKEARFAGQTRVFVFSE* |
| Ga0137391_105433901 | 3300011270 | Vadose Zone Soil | VQKGKSVVAESEGRWEDRDAKSNYDAVLLGENGQVKEVRFFGQKRVFVFSE* |
| Ga0137391_115445281 | 3300011270 | Vadose Zone Soil | IAESEGRWEERDTKSNYDAVLVGENGQVKEVRFSGQKRVFVFSE* |
| Ga0137393_107633561 | 3300011271 | Vadose Zone Soil | GKSVVAESEGRWEDRDTKSSYDAVLLGENGQVKEVRFSGQKRVFVFSE* |
| Ga0137393_111824962 | 3300011271 | Vadose Zone Soil | VAESEGRWEDRDTKSNYDAVLLGENGQVREVRFSGQKRVFVFSE* |
| Ga0137393_113283311 | 3300011271 | Vadose Zone Soil | GKVVAESEGRWEDRSAKSSYDSLLISENGQVKEVRFSGQSRVFVFSE* |
| Ga0137389_101118443 | 3300012096 | Vadose Zone Soil | AESEGRWEDRQTKSANDSVLLGESGQLLEVRFAGQNRVFVLNE* |
| Ga0137388_100723834 | 3300012189 | Vadose Zone Soil | EDRNTKSVYDAVLIGETGQVKEVRFAGQARVFVFSE* |
| Ga0137383_100016731 | 3300012199 | Vadose Zone Soil | KGKEQIAEAEGRWEERALKSDYNSVLIDADGQVKEVRFAGEKRVFVLSE* |
| Ga0137383_102055742 | 3300012199 | Vadose Zone Soil | VAESEGRWEDRSAKSAYDSLLLGENGQVREVRFAGQTRVFVFSE* |
| Ga0137383_113101491 | 3300012199 | Vadose Zone Soil | GKLVVAESEGRWEDRSSKSAYDSVLVGEGGQVKEVRFAGQTRVFVFNE* |
| Ga0137363_111634352 | 3300012202 | Vadose Zone Soil | WEDRSTKAAYDSILVGENGQVKEVRFAGQTRVFVFSE* |
| Ga0137399_106172242 | 3300012203 | Vadose Zone Soil | VAESEGRWEDRSAKAAYDSILVGENGQVREVRFAGQTRVFVFSE* |
| Ga0137399_116417752 | 3300012203 | Vadose Zone Soil | DRDAKSNYDAVLLGENGQVKEVRFSGQKRVFVFSE* |
| Ga0137362_100216195 | 3300012205 | Vadose Zone Soil | VVAESEGRWEDRDTKSNYDAVLLGENGQVKEVRFSGQKRVFVFSE* |
| Ga0137362_101559221 | 3300012205 | Vadose Zone Soil | RSAKSAYDSLLLGENGQVREVRFAGQTRVFVFSE* |
| Ga0137362_106241722 | 3300012205 | Vadose Zone Soil | QKGKQVVAESEGRWEDRSTKSNYDSVVIGENGQVMEVRFAGQTRVFVFSE* |
| Ga0137362_108580431 | 3300012205 | Vadose Zone Soil | EDRDTKSNYDAVLLSETGQVKEVRFSGQKRVFVFSE* |
| Ga0137380_111061221 | 3300012206 | Vadose Zone Soil | AEGRWEERALKSDYNSVLIDADGQVKEVRFAGEKRVFVLSE* |
| Ga0137384_115625532 | 3300012357 | Vadose Zone Soil | GRWEDRDRKSEYTSILLGADGQVHEVRFAGQKRVFVFSE* |
| Ga0137385_101509593 | 3300012359 | Vadose Zone Soil | AESEGRWEDRSSKSAYDSVLIGEGGQVKEVRFAGQTRVFVFNE* |
| Ga0137360_107877521 | 3300012361 | Vadose Zone Soil | VAESEGRWEDREQKSQYTAILLGADGQVHEVRFAGQKRVFVFSE* |
| Ga0137360_114555522 | 3300012361 | Vadose Zone Soil | RWEDRDAKSNYDAVLLGENGQVKEVRFSGQKRVFVFSE* |
| Ga0137361_107215771 | 3300012362 | Vadose Zone Soil | EDRDTKSNYDAVLLGENGQVKEVRFSGQKRVFVFSE* |
| Ga0137361_108504381 | 3300012362 | Vadose Zone Soil | KGKQVVAESEGRWEDRSAKSAYDSLLLGENGQVREVRFAGQTRVFVFSE* |
| Ga0137390_102302951 | 3300012363 | Vadose Zone Soil | QKGKQTVAESEGRWEDRSTKSNYDALLLGENGQVKEVRFAGQTRVFVFSE* |
| Ga0137358_101091243 | 3300012582 | Vadose Zone Soil | EEREAKSQYTSILVGENGQVREVRFAGQKKVFVFAE* |
| Ga0137358_104730682 | 3300012582 | Vadose Zone Soil | ESEGRWEDRDEKYLYDAVLMSDKGQVTEVRFSGQKRVFVFSE* |
| Ga0137398_100946791 | 3300012683 | Vadose Zone Soil | QVVAESEGRWEDRSSKSEYNAVLIGENGQVREVRFAGQARVFVFSE* |
| Ga0137395_105203992 | 3300012917 | Vadose Zone Soil | AESEGRWEDRSTKSAYDSLLLGENGQVREVRFAGQTRVFVFSE* |
| Ga0137395_111377861 | 3300012917 | Vadose Zone Soil | IVAESEGRWEDRDQKSQYTAILLGADGQVREVRFAGQKRVFVFGE* |
| Ga0137396_100635401 | 3300012918 | Vadose Zone Soil | SEGRWEDRSAKSAYDSLLLGENGQVREVRFAGQTRVFIFSE* |
| Ga0137396_101100933 | 3300012918 | Vadose Zone Soil | IVAESEGRWEDRSAKASYDSLLVGENGQVKEVRFAGQTRVFVFSE* |
| Ga0137396_103799781 | 3300012918 | Vadose Zone Soil | SVVAESEGRWEDRDTKSSYDAVLLGENGQVKEVRFSGQKRVFVFSE* |
| Ga0137396_107197921 | 3300012918 | Vadose Zone Soil | IVAESEGRWEDRSTKSSYDSLLVGENGQVKEVRFAGQTRVFVFSE* |
| Ga0137359_101046261 | 3300012923 | Vadose Zone Soil | SVVAESEGRWEDRDAKSNYDAVLLGENGQVKEVRFSGQKRVFVFSE* |
| Ga0137359_101942271 | 3300012923 | Vadose Zone Soil | QVVAESEGRWEDRSAKSAYDSLLLGENGQVREVRFAGQTRVFVFSE* |
| Ga0137359_106319391 | 3300012923 | Vadose Zone Soil | KATVQKGKSVVAESEGRWEDRDTKSNYDAVLLGENGQVKEVRFSGQKRVFVFSE* |
| Ga0137359_117293281 | 3300012923 | Vadose Zone Soil | KGKQVVAESEGRWEDRSAKSVYDSLLLGENGQVREVRFAGQTRVFVFSE* |
| Ga0137413_100341704 | 3300012924 | Vadose Zone Soil | AESEGRWEDRSAKAAYDSILVGENGQVREVRFAGQTRVFVFSE* |
| Ga0137413_100602081 | 3300012924 | Vadose Zone Soil | IDGNKVSVQHGKDQVAQSEGRWEERDRKSDYDAVLLGENGQVKEVRFSGQKRVFVFSE* |
| Ga0137413_112535632 | 3300012924 | Vadose Zone Soil | GNKVSVQHGKDQVAQSEGRWEERDRKSDYDAVLLGENGQVKEVRFSGQKRVFVFSE* |
| Ga0137416_104307581 | 3300012927 | Vadose Zone Soil | GRWEDRSTKSNYDSVVIGENGQVMEVRFAGQTRVFVFSE* |
| Ga0137416_119703141 | 3300012927 | Vadose Zone Soil | SEGRWEDRSAKSVYDSVLLGEGGQVKEVRFAGQARVFVFSE* |
| Ga0137404_105439461 | 3300012929 | Vadose Zone Soil | EGRWEDRSAKSAYDSLLLGENGQVREVRFAGQTRVFVFSE* |
| Ga0137404_108182381 | 3300012929 | Vadose Zone Soil | KATVQKGKDIVAESEGRWEDRSTKSSYDSLLIGENGQVKEVRFAGQTRVFVFSE* |
| Ga0137407_108128351 | 3300012930 | Vadose Zone Soil | TKATVQKGKDIVAESEGRWEDRSTKSSYDSLLVSENGQVKEVRFAGQTRVFVFSE* |
| Ga0137407_117430451 | 3300012930 | Vadose Zone Soil | EGRWEEREAKSQYTSILVGENGQVREVRFAGQKKVFVFAE* |
| Ga0134081_100114453 | 3300014150 | Grasslands Soil | KQVVAESEGRWEDRSTKSSYDSLLITENGQVKEVRFSGQSRVFVFSE* |
| Ga0134075_100142301 | 3300014154 | Grasslands Soil | DRSTKSVYDSLLLGENGQVREVRFAGQTRVFVFSE* |
| Ga0137405_13082893 | 3300015053 | Vadose Zone Soil | SEGRWEDRSAKSNYDSVLLGENGQVKEVRFAGQTRVFVFSE* |
| Ga0137405_139821910 | 3300015053 | Vadose Zone Soil | MEERDRKSDYDAVLLGENGQVKEVRFSGQKRVFVFSE* |
| Ga0137412_104378121 | 3300015242 | Vadose Zone Soil | ESEGRWEDRSAKSAYDSLLLGENGQVREVRFAGQTRVFVFSE* |
| Ga0137403_100324131 | 3300015264 | Vadose Zone Soil | GKDIVAESEGRWEDRSTKSSYDSLLIGENGQVKEVRFAGQTRVFVFSE* |
| Ga0137403_105989271 | 3300015264 | Vadose Zone Soil | GKDIVAESEGRWEDRSTKSSYDSLLVGENGQVKEVRFAGQTRVFVFSE* |
| Ga0132256_1015220692 | 3300015372 | Arabidopsis Rhizosphere | GKNTLGESEGRWEERDSKSEYTSILVGENGQIREVRFAGQKKVFVFSE* |
| Ga0182032_112147912 | 3300016357 | Soil | EDRGTKSQYTSILVGENGQVREVRFAGEKRVFVFSE |
| Ga0182034_118472881 | 3300016371 | Soil | QKGKNTIAESEGRWEERDSKSDYTSILLGENGQVREVRFAGQKRVFVFTE |
| Ga0182039_115854192 | 3300016422 | Soil | RWEVRETTSNYDAVLIGETGQVKEVRFSGQKRVFVFNQ |
| Ga0187785_106231031 | 3300017947 | Tropical Peatland | ESEGRWEDRDSKSSYDAVLLSDNGQVKEVRFSGQKRVFVFSE |
| Ga0187779_100208934 | 3300017959 | Tropical Peatland | GRWEDRSTRSTYDSVLIGDDGQVKEVRFAGQSRVFVFNE |
| Ga0187804_101507782 | 3300018006 | Freshwater Sediment | RWEDRSSKSDYDSVLLSDTGKVMEVRFAGQTRVFVFSE |
| Ga0066655_111748491 | 3300018431 | Grasslands Soil | ESEGRWEEREAKSQYTSILVGENGQVREVRFAGQKKVFVFAE |
| Ga0173482_101117971 | 3300019361 | Soil | ESEGRWEERDTKSEYTSILVGENGQVREVRFAGQKKVFVFSE |
| Ga0182025_12916083 | 3300019786 | Permafrost | MKNRTTVAESEGRWEDRSDRSRYDAVVFGQNGEVKEVRFSGQTRVFIFKRII |
| Ga0137408_13027671 | 3300019789 | Vadose Zone Soil | VAEREGRWEEREAKSQYTSILVGENGHGQVREVRFAGQKKVFVFAE |
| Ga0179592_100843192 | 3300020199 | Vadose Zone Soil | GRWEDRDTKSNYDAVLLSETGQVKEVRFSGQKRVFVFSE |
| Ga0210407_110252031 | 3300020579 | Soil | TVQKGRQTIVESEGRWEDRSSKAANDSVLIGEDGQVKEVRFSGQTRVFVFSE |
| Ga0210399_103044701 | 3300020581 | Soil | KQTIAESEGRWEDRATKSSNDSVLISQDGQVKEVRFAGQTRVFVFNE |
| Ga0210399_106673112 | 3300020581 | Soil | KGRQTIVESEGRWEDRSSKAANDSVLVGEDGQVKEVRFSGQTRVFVFSE |
| Ga0210399_108668852 | 3300020581 | Soil | PVAESEGRWEDRQTKALYDSLLLGVDGQVREVRFAGKAQVFVFNE |
| Ga0210399_114182233 | 3300020581 | Soil | TVQKGKSVVAESEGRWEDRDTKSSYDAVLLGDDGQVKEVRFSGKSKVFVFSE |
| Ga0210395_100922151 | 3300020582 | Soil | EGRWEDRSTKSSNDSVLISQDGQVKEVRFAGHTRVFVFNE |
| Ga0210401_101584021 | 3300020583 | Soil | SEGRWEDRSTKSSSDSVLISENGQVKEVRFAGQTRVFVFSE |
| Ga0210401_107616082 | 3300020583 | Soil | QVVAESEGRWEDRSTKSSYDSVLISEDGQVKEVRFAGQARVFVFSE |
| Ga0210401_110898212 | 3300020583 | Soil | ESEGRWEDRDTKSLYDAVLLSDKGQVTEVRFSGQKRVFIFSE |
| Ga0215015_100962071 | 3300021046 | Soil | ESEGRWEDRQSKSAYDSVLVGENGQVKEVRFAGQNRVFVLNE |
| Ga0210405_112340382 | 3300021171 | Soil | QKGKQTIAESEGRWEDRASKSSNDSVLIGENGQVKEVRFSGQTRVFVFNE |
| Ga0210396_101798941 | 3300021180 | Soil | ESEGRWEDRATKSSNDSVLISQDGQVKEVRFAGQTRVFVFNE |
| Ga0210396_102317922 | 3300021180 | Soil | VQKGRQAIAETEGRWEDRSTKSASDSVLIGENGQLKEVRFSGQTRVFVFNE |
| Ga0213876_101238272 | 3300021384 | Plant Roots | GRWEDRDTKSNYDAVLLNDAGQVSEVRFAGQKKVFVFSE |
| Ga0210393_109858161 | 3300021401 | Soil | EGRWEDRSSKAANDSVLIGEDGQVKEVRFSGQTRVFVFSE |
| Ga0210389_100370714 | 3300021404 | Soil | KGKQTIVESEGRWEDRATKSSNDSVLIGEDGQVKEVRFSGQTRVFVFSE |
| Ga0210386_113256022 | 3300021406 | Soil | KQVVAESEGRWEDRSAKSAYDSLLLGENGQVREVRFAGQTRVFVFSE |
| Ga0210383_100820371 | 3300021407 | Soil | RWEVRASKSSNDSVLISQDAQVKEVRFAGQTRVFVFNE |
| Ga0210394_100932431 | 3300021420 | Soil | EDRSAKSAYDSLLLGENGQVREVRFAGQTRVFVFSE |
| Ga0210394_101886973 | 3300021420 | Soil | KQTIVESEGRWEDRASKSSNDSVLISQDGQVKEVRFAGQTRVFVFNE |
| Ga0210394_116008182 | 3300021420 | Soil | VSEGRWEERDAKSQYTSIVVGGDGQVKEVRFAGQKKVFVFNE |
| Ga0210402_104077651 | 3300021478 | Soil | QVVAESEGRWEDRSTKSSYDSLLISESGQVKEVRFAGQTRVFVFSE |
| Ga0210409_100151137 | 3300021559 | Soil | VAESEGRWEDRSTKSNYDSLLLGENGQVKEVRFAGQTRVFVFSE |
| Ga0210409_101237341 | 3300021559 | Soil | VAESEGRWEDRSAKSAYDSVLIGENGQVKEVRFAGQARVFVLSE |
| Ga0126371_103792061 | 3300021560 | Tropical Forest Soil | GDKVTVQHGKDQVAQSEGRWEERSTKSDYDAVLVTEDGHVKEVRFSGQKRVFVFNE |
| Ga0213853_107502061 | 3300021861 | Watersheds | DRSAKSNYDSVLVNETGKVLEVRFAGQTRVFVFSE |
| Ga0242660_10680702 | 3300022531 | Soil | VAQSEGRWEDRETKSDYDAVLLGENGQVKEVRFSGQKRVFVFNE |
| Ga0242660_11410802 | 3300022531 | Soil | VAESEGRWEDRDAKSNYDAVLLGDNGQVKEVRFSGQKRVFILSE |
| Ga0242665_101474972 | 3300022724 | Soil | QTVVESEGRWEDRSSKAAYDSVLIGQDGQVKEVRFSGQTRVFVFSE |
| Ga0242665_103562761 | 3300022724 | Soil | SEGRWEDRDTKSNYDAVLLGENGQVKEVRFSGQTRVFVFSE |
| Ga0247688_10035653 | 3300024186 | Soil | KVSVQHGKDQVAQSEGRWEDRDKKSDYDAVLLGENGQVKEVRFSGQKRVFVFSE |
| Ga0228598_10485783 | 3300024227 | Rhizosphere | GRQTIAESEGRWEDRASKSSNDSVLISQDGQVKEVRFAGQTRVFVFNE |
| Ga0247676_10373982 | 3300024249 | Soil | SEGRWEDRDKKSDYDAVLLGENGQVKEVRFSGQKRVFVFSE |
| Ga0207699_111250761 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | EDRDAKSQYDAVLLNDSGQVTEVRFSGQKRVFVFSE |
| Ga0209686_11422991 | 3300026315 | Soil | TEGRWEDRNTKSSYDSVLIGENGQVKEVRFSGQARVFVFSE |
| Ga0209152_103131881 | 3300026325 | Soil | GRWEDRSTKSAYDSLLLGENGQVREVRFAGQARVFVFSE |
| Ga0209057_10455283 | 3300026342 | Soil | GRWEDRSTKSVYDSLLLGENGQVREVRFAGQARVFVFSE |
| Ga0257155_10821122 | 3300026481 | Soil | VVAESEGRWEDRDTKSNYDAVLLSETGQVKEVRFSGQKRVFVFSE |
| Ga0257172_10952472 | 3300026482 | Soil | NKATVQKGKSVVAESEGRWEDRDAKSNYDAVLLGENGQVKEVRFSGQKRVFVFSE |
| Ga0209059_10385973 | 3300026527 | Soil | GKQIVAESEGRWEDRSTKSAYDSLLLGENGQVREVRFAGQARVFVFSE |
| Ga0209059_13434342 | 3300026527 | Soil | GRWEERSAKSAYDSVLVGEDGQVKEVRFAGQARVFVLGS |
| Ga0209160_10423253 | 3300026532 | Soil | VQKGKSVVAESEGRWEDRDTKSNYDAVLLGENGQVKEVRFSGQKRVFVFSE |
| Ga0209161_102098642 | 3300026548 | Soil | AESDGRWEDRDAKSSYDAVLLSDNGQVKEVRFSGQKRVFVFNE |
| Ga0209648_101209813 | 3300026551 | Grasslands Soil | VQKGKQLVAESEGRWEDRSAKSQYDSLLLGENGQVKEARFAGQTRVFVFSE |
| Ga0179587_110105662 | 3300026557 | Vadose Zone Soil | VAESEGRWEDRSSKSEYNAVLIGENGQVREVRFAGQARVFVFSE |
| Ga0208730_10260202 | 3300027047 | Forest Soil | EGRWEDRDSKSPYDAVLLNDKGRVTEVRFSGQKRVFVFSE |
| Ga0209736_12021991 | 3300027660 | Forest Soil | KTTVAESEGRWEDRDAKSSYDAVLLGENGQVKEVRFSGQKRVFILSE |
| Ga0209588_12218502 | 3300027671 | Vadose Zone Soil | VQKGKQVVAESEGRWEDRSAKASYDSLLLGENGQVREVRFAGQTRVFVFSE |
| Ga0209328_102356551 | 3300027727 | Forest Soil | SEGRWEDRNAKSNYDAVLLGENGQVKEVRFSGQKRVFVLSE |
| Ga0209248_101012961 | 3300027729 | Bog Forest Soil | IAESEGRWEDRATKSANDSVLISQDGQVKEVRFAGQTRVFVFNE |
| Ga0209689_10587141 | 3300027748 | Soil | ATVQKGKQIVAESEGRWEDRSTKSAYDSLLLGENGQVREVRFAGQARVFVFSE |
| Ga0209180_101595662 | 3300027846 | Vadose Zone Soil | VVAESEGRWEDRSAKSAYDSLLLGENGQVREVRFAGQTRVFVFSE |
| Ga0209579_101265162 | 3300027869 | Surface Soil | SEGRWEDRSSKSAYDSVLLSETGQVKEVRFAGQSRVFVFSEQTGRFCDSF |
| Ga0209283_104905492 | 3300027875 | Vadose Zone Soil | RNTVAESEGRWEDRDQKSQYTAILLGPDGQVHEVRFAGQKRVFVFSE |
| Ga0209283_107016861 | 3300027875 | Vadose Zone Soil | KGKQVVAESEGRWEDRSAKAAYDSILVEENGQVREVRFAGQTRVFVFSE |
| Ga0209275_106476851 | 3300027884 | Soil | VVAESEGRWEDRDAKSAYDAVLLNNNGQVTEVRFSGQKRVFVFNE |
| Ga0209380_100834741 | 3300027889 | Soil | VQKGNSVVAETEGRWEDRDTKSSFDAVLLGDDGQVKEVRFSGKSKVFVFSE |
| Ga0209168_101657292 | 3300027986 | Surface Soil | EGRWEDRDTKSNYDAVLLNDAGQVQEVRFAGQKKVFIFSE |
| Ga0209526_101025191 | 3300028047 | Forest Soil | KGKSTVAESEGRWEDRDTKSNYDAVLLGQDGQVKEVRFSGQKRVFVFSE |
| Ga0209526_102985494 | 3300028047 | Forest Soil | AESEGRWEDRASKSSNDSVLIGENGQVKEVRFSGQTRVFVFNE |
| Ga0209526_103372991 | 3300028047 | Forest Soil | KGSQVVAQSEGRWEDRDSKSPYDAVLLNDKGRVTEVRFSGQKRVFVFSE |
| Ga0268264_107139511 | 3300028381 | Switchgrass Rhizosphere | RWEERDSKSEYTSILVGENGQIREVRFAGQKRVFVFSE |
| Ga0137415_103267681 | 3300028536 | Vadose Zone Soil | QVVAESEGRREDRSAKSAYDSLLLGENGQVKEVRFAGQARVFVFSE |
| Ga0137415_113389952 | 3300028536 | Vadose Zone Soil | SEGRWEDRSAKSVYDSVLLGEGGQVKEVRFAGQARVFVFSE |
| Ga0265318_102154632 | 3300028577 | Rhizosphere | VQKGRQTIAESEGRWEDRSTKSAMDSVLIGENGQVKEVRFSGQTRVFVFNE |
| Ga0302233_101034752 | 3300028746 | Palsa | VAETEGRWEDRDSKAEVDSIVIDDGGQVREVRFSGQKRVFVIGQ |
| Ga0302227_100955451 | 3300028795 | Palsa | QQGKHMVAETEGRWEDRDSKAEVDSIVIDDGGQVREVRFSGQKRVFVIGQ |
| Ga0302300_11615852 | 3300030042 | Palsa | QGKHMVAETEGRWEDRDSKAEVDSIVIDDGGQVREVRFSGQKRVFVIGQ |
| Ga0302310_102958262 | 3300030737 | Palsa | IQQGKHMVAETEGRWEDRDSKAEVDSIVIDDGGQVREVRFSGQKRVFVIGQ |
| Ga0170834_1088619572 | 3300031057 | Forest Soil | VQKGKQVVAESEGRWEDRSTKSAYDSVLIGENGQVKEVRFAGQTRVFIFSE |
| Ga0170834_1116513541 | 3300031057 | Forest Soil | ATVQKGKSVVAESEGRWEDRDTKSSYDAVLLGENGQVKEVRFSGQTRVFVFSE |
| Ga0265760_100289761 | 3300031090 | Soil | GRWEDRASKSSTDSVLISDGQVKEVRFAGQTRVFVFND |
| Ga0170824_1199481601 | 3300031231 | Forest Soil | KATVQKGKQVVAESEGRWEDRSTKSAYDSVLIGENGQVKEVRFAGQTRVFIFSE |
| Ga0310686_1009517281 | 3300031708 | Soil | SEGRWEDRASKSSNDSVLISQDGQVKEVRFAGQTRVFVFNE |
| Ga0307476_102295922 | 3300031715 | Hardwood Forest Soil | RWEDRSTKAANDSVLIGEDGQVKEVRFSGQTRVFVFSE |
| Ga0307476_103563711 | 3300031715 | Hardwood Forest Soil | QKGKQTIAESEGRWEDRSTKAANDSVLIGEDGQVKEVRFSGQARVFVFNE |
| Ga0307469_108146171 | 3300031720 | Hardwood Forest Soil | EDRSSKSEYNAVLIGENGQVREVRFAGQARVFVFSE |
| Ga0307469_120149712 | 3300031720 | Hardwood Forest Soil | TEGRWEDLATKSANDSVLIGENGQVKEVRFSGKARVFVFNE |
| Ga0307475_100098115 | 3300031754 | Hardwood Forest Soil | SEGRWEDRDAKSLYDAVLLSDKGQVTEVRFSGQKRVFVFSE |
| Ga0307475_100627004 | 3300031754 | Hardwood Forest Soil | EGRWEDRDTKSNYDAVLLGENGQVKEVRFSGQTRVFVFSE |
| Ga0307475_107334142 | 3300031754 | Hardwood Forest Soil | ESEGRWEDRSAKSSYDSLLIGENGQVKEVRFSGQSRVFVFGE |
| Ga0307473_100112844 | 3300031820 | Hardwood Forest Soil | SVVAESEGRWEDRDTKSNYDAVLLGENGQVKEVRFSGQTRVFVFSE |
| Ga0307473_105742542 | 3300031820 | Hardwood Forest Soil | TLGESEGRWEERDSKSEYTSILVGENGQIREVRFAGQKKVFVFSE |
| Ga0307473_105974972 | 3300031820 | Hardwood Forest Soil | VAESDGRWEDRNAKSSYDAVLLSDNGQVREVRFSGQKRVFVFNE |
| Ga0307478_101273433 | 3300031823 | Hardwood Forest Soil | DGRWEDRDTKSNYDAVLLGENGQVKEVRFSGQKRVFVFSE |
| Ga0307478_103105761 | 3300031823 | Hardwood Forest Soil | EDRDTKSNYDAVLLGENGQVKEVRFSGQKRVFVFSE |
| Ga0310917_109145721 | 3300031833 | Soil | GRWEDRDSKPDYTSVLLGENGQVREVRFAGQRRVFVFTE |
| Ga0306919_112403412 | 3300031879 | Soil | SEGRWEERDSKSDYTSILVGENGQVREVRFAGQKKVFVFSE |
| Ga0306921_112193711 | 3300031912 | Soil | SEGRWEDRSAKSSYDSLLINENGQVKEVRFSGQSRVFVFSE |
| Ga0310916_115360791 | 3300031942 | Soil | KVVAESEGRWEDRSAKSGYDSLLISENGQVKEVRFSGQSRVFVFGE |
| Ga0310910_114908081 | 3300031946 | Soil | WEDRSSKSAYDSVLIGGNGQVKEVRFAGQARVFVFNE |
| Ga0307479_101745001 | 3300031962 | Hardwood Forest Soil | WEDRSAKSAYDSVLIGENGQVKEVRFAGQARVFVFSE |
| Ga0307479_111863243 | 3300031962 | Hardwood Forest Soil | WEDRSSKSPYDSLLLSENGQVKEVRFAGQSRVFVFNE |
| Ga0307479_121636631 | 3300031962 | Hardwood Forest Soil | GRWEDRDAKSNYDAVLLGDNGQVKEVRFSGQKRVFILSE |
| Ga0306924_103983091 | 3300032076 | Soil | IAESEGRWEDRDSKPDYTSVLLGENGQVREVRFAGQRRVFVFTE |
| Ga0307470_116042852 | 3300032174 | Hardwood Forest Soil | VAESEGRWEDRDTKSNYDAVLLSESGQVKEVRFSGQKRVFVFSE |
| Ga0307471_1001812541 | 3300032180 | Hardwood Forest Soil | SEGRWEDRSAKSAYDSLLLGENGQVREVRFAGQTRVFVFSE |
| Ga0307471_1012331482 | 3300032180 | Hardwood Forest Soil | TVQKGKSVVAESEGRWEDRDTKSSYDAVLLGENGQVKEVRFSGQTRVFVFSE |
| Ga0307471_1020344471 | 3300032180 | Hardwood Forest Soil | EDRNAKSSYDAVLLSDNGQVREVRFSGQKRVFVFNE |
| Ga0307471_1027046342 | 3300032180 | Hardwood Forest Soil | ESEGRWEDRDTKSTYDAVLLGENGQVKEVRFSGQKRVFVFSE |
| Ga0307472_1001627072 | 3300032205 | Hardwood Forest Soil | VVGESEGRWEDRSNKAAYDSVLLGENGQVKEVRFAGQTRVFVFSE |
| Ga0307472_1011293272 | 3300032205 | Hardwood Forest Soil | KNTVAESEGRWEERDQKSQYTSILVGADGQVHEVRFAGQKRVFVFAE |
| Ga0316620_112013622 | 3300033480 | Soil | GNKATVQRGNQVLAETEGRWEDRATKSSNDSVLIGENGQVKEVRFSGKTRVFVFSE |
| ⦗Top⦘ |