Basic Information | |
---|---|
Family ID | F015594 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 253 |
Average Sequence Length | 43 residues |
Representative Sequence | MIKLKDILLEGKPPSIFIPRRMEDRVERMISLYIRNGSKGD |
Number of Associated Samples | 178 |
Number of Associated Scaffolds | 253 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 63.75 % |
% of genes near scaffold ends (potentially truncated) | 98.02 % |
% of genes from short scaffolds (< 2000 bps) | 90.51 % |
Associated GOLD sequencing projects | 164 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.37 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (58.103 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (13.043 % of family members) |
Environment Ontology (ENVO) | Unclassified (50.198 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (60.870 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 34.78% β-sheet: 0.00% Coil/Unstructured: 65.22% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.37 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 253 Family Scaffolds |
---|---|---|
PF13240 | zinc_ribbon_2 | 1.58 |
PF00005 | ABC_tran | 0.40 |
PF00149 | Metallophos | 0.40 |
PF13248 | zf-ribbon_3 | 0.40 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 58.10 % |
All Organisms | root | All Organisms | 41.90 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300002274|B570J29581_111067 | Not Available | 546 | Open in IMG/M |
3300002278|B570J29590_110333 | Not Available | 524 | Open in IMG/M |
3300002389|B570J29643_101290 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1407 | Open in IMG/M |
3300002408|B570J29032_108908585 | Not Available | 538 | Open in IMG/M |
3300002408|B570J29032_109480986 | Not Available | 798 | Open in IMG/M |
3300002408|B570J29032_109797647 | All Organisms → Viruses → Predicted Viral | 1365 | Open in IMG/M |
3300003277|JGI25908J49247_10040728 | All Organisms → Viruses → Predicted Viral | 1256 | Open in IMG/M |
3300003277|JGI25908J49247_10155882 | Not Available | 532 | Open in IMG/M |
3300003394|JGI25907J50239_1098335 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
3300003616|JGI25928J51866_1075026 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 755 | Open in IMG/M |
3300004795|Ga0007756_11561595 | Not Available | 763 | Open in IMG/M |
3300005527|Ga0068876_10299484 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 913 | Open in IMG/M |
3300005581|Ga0049081_10045319 | All Organisms → cellular organisms → Bacteria | 1667 | Open in IMG/M |
3300005581|Ga0049081_10176587 | Not Available | 773 | Open in IMG/M |
3300005581|Ga0049081_10239638 | Not Available | 639 | Open in IMG/M |
3300005581|Ga0049081_10267163 | Not Available | 596 | Open in IMG/M |
3300005582|Ga0049080_10137980 | Not Available | 820 | Open in IMG/M |
3300005582|Ga0049080_10160444 | All Organisms → cellular organisms → Bacteria | 751 | Open in IMG/M |
3300005582|Ga0049080_10186870 | Not Available | 687 | Open in IMG/M |
3300005584|Ga0049082_10290928 | Not Available | 546 | Open in IMG/M |
3300005585|Ga0049084_10225516 | Not Available | 634 | Open in IMG/M |
3300005805|Ga0079957_1095668 | Not Available | 1634 | Open in IMG/M |
3300005805|Ga0079957_1125263 | Not Available | 1350 | Open in IMG/M |
3300005805|Ga0079957_1373051 | Not Available | 615 | Open in IMG/M |
3300005941|Ga0070743_10248042 | Not Available | 579 | Open in IMG/M |
3300005955|Ga0073922_1013677 | Not Available | 951 | Open in IMG/M |
3300006484|Ga0070744_10094197 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 867 | Open in IMG/M |
3300006641|Ga0075471_10496277 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 605 | Open in IMG/M |
3300006875|Ga0075473_10048112 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1648 | Open in IMG/M |
3300007548|Ga0102877_1151671 | Not Available | 655 | Open in IMG/M |
3300007549|Ga0102879_1006703 | All Organisms → cellular organisms → Bacteria | 4147 | Open in IMG/M |
3300007550|Ga0102880_1141993 | Not Available | 629 | Open in IMG/M |
3300007554|Ga0102820_1098280 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 703 | Open in IMG/M |
3300007557|Ga0102821_1160761 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 571 | Open in IMG/M |
3300007562|Ga0102915_1309778 | Not Available | 510 | Open in IMG/M |
3300007606|Ga0102923_1147352 | Not Available | 736 | Open in IMG/M |
3300007618|Ga0102896_1013458 | All Organisms → cellular organisms → Bacteria | 2788 | Open in IMG/M |
3300007618|Ga0102896_1133112 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 800 | Open in IMG/M |
3300007622|Ga0102863_1024329 | Not Available | 1720 | Open in IMG/M |
3300007632|Ga0102894_1045978 | Not Available | 1136 | Open in IMG/M |
3300007642|Ga0102876_1138438 | Not Available | 653 | Open in IMG/M |
3300007647|Ga0102855_1218995 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 507 | Open in IMG/M |
3300007670|Ga0102862_1151866 | Not Available | 592 | Open in IMG/M |
3300007992|Ga0105748_10026247 | All Organisms → cellular organisms → Bacteria | 2210 | Open in IMG/M |
3300007992|Ga0105748_10362441 | Not Available | 622 | Open in IMG/M |
3300008052|Ga0102893_1005234 | All Organisms → cellular organisms → Bacteria | 4183 | Open in IMG/M |
3300008055|Ga0108970_11670143 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae | 1172 | Open in IMG/M |
3300008107|Ga0114340_1099437 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → Campylobacterales → Arcobacteraceae → Arcobacter | 1166 | Open in IMG/M |
3300008107|Ga0114340_1132187 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → Campylobacterales → Arcobacteraceae → Arcobacter | 948 | Open in IMG/M |
3300008107|Ga0114340_1146443 | All Organisms → cellular organisms → Bacteria | 877 | Open in IMG/M |
3300008107|Ga0114340_1169548 | All Organisms → cellular organisms → Bacteria | 778 | Open in IMG/M |
3300008107|Ga0114340_1180234 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Flavobacterium | 738 | Open in IMG/M |
3300008107|Ga0114340_1184771 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 722 | Open in IMG/M |
3300008107|Ga0114340_1215609 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 625 | Open in IMG/M |
3300008108|Ga0114341_10327665 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 782 | Open in IMG/M |
3300008110|Ga0114343_1111730 | Not Available | 929 | Open in IMG/M |
3300008111|Ga0114344_1222016 | Not Available | 575 | Open in IMG/M |
3300008113|Ga0114346_1190106 | Not Available | 831 | Open in IMG/M |
3300008113|Ga0114346_1238499 | All Organisms → cellular organisms → Bacteria | 688 | Open in IMG/M |
3300008113|Ga0114346_1249012 | Not Available | 662 | Open in IMG/M |
3300008116|Ga0114350_1108454 | Not Available | 861 | Open in IMG/M |
3300008116|Ga0114350_1163057 | Not Available | 601 | Open in IMG/M |
3300008117|Ga0114351_1210786 | All Organisms → Viruses → Predicted Viral | 1004 | Open in IMG/M |
3300008120|Ga0114355_1178890 | Not Available | 1208 | Open in IMG/M |
3300008120|Ga0114355_1197893 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 651 | Open in IMG/M |
3300008266|Ga0114363_1230336 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
3300008448|Ga0114876_1176538 | All Organisms → cellular organisms → Bacteria | 749 | Open in IMG/M |
3300008448|Ga0114876_1183858 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Flavobacterium → unclassified Flavobacterium → Flavobacterium sp. ASV13 | 724 | Open in IMG/M |
3300008953|Ga0104241_1016254 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 505 | Open in IMG/M |
3300008962|Ga0104242_1055582 | Not Available | 665 | Open in IMG/M |
3300008962|Ga0104242_1063965 | Not Available | 615 | Open in IMG/M |
3300009026|Ga0102829_1196781 | All Organisms → cellular organisms → Bacteria | 654 | Open in IMG/M |
3300009059|Ga0102830_1010997 | Not Available | 2931 | Open in IMG/M |
3300009068|Ga0114973_10323466 | Not Available | 818 | Open in IMG/M |
3300009079|Ga0102814_10459081 | Not Available | 693 | Open in IMG/M |
3300009086|Ga0102812_10093205 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1656 | Open in IMG/M |
3300009146|Ga0105091_10142456 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1120 | Open in IMG/M |
3300009152|Ga0114980_10305602 | Not Available | 922 | Open in IMG/M |
3300009155|Ga0114968_10179661 | Not Available | 1238 | Open in IMG/M |
3300009160|Ga0114981_10390095 | Not Available | 751 | Open in IMG/M |
3300009163|Ga0114970_10388514 | Not Available | 778 | Open in IMG/M |
3300009164|Ga0114975_10014817 | All Organisms → cellular organisms → Bacteria | 4789 | Open in IMG/M |
3300009170|Ga0105096_10743833 | Not Available | 522 | Open in IMG/M |
3300009180|Ga0114979_10574596 | Not Available | 646 | Open in IMG/M |
3300009181|Ga0114969_10346568 | Not Available | 864 | Open in IMG/M |
3300009184|Ga0114976_10382500 | Not Available | 739 | Open in IMG/M |
3300010354|Ga0129333_10406257 | Not Available | 1205 | Open in IMG/M |
3300010354|Ga0129333_10498270 | Not Available | 1068 | Open in IMG/M |
3300010354|Ga0129333_10584125 | All Organisms → cellular organisms → Bacteria | 971 | Open in IMG/M |
3300010354|Ga0129333_10717134 | Not Available | 858 | Open in IMG/M |
3300010354|Ga0129333_11347064 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
3300010370|Ga0129336_10362085 | Not Available | 797 | Open in IMG/M |
3300010370|Ga0129336_10415429 | Not Available | 733 | Open in IMG/M |
3300010885|Ga0133913_13022490 | Not Available | 1121 | Open in IMG/M |
3300011995|Ga0153800_1007581 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 1042 | Open in IMG/M |
3300012012|Ga0153799_1038323 | All Organisms → cellular organisms → Bacteria | 902 | Open in IMG/M |
3300012012|Ga0153799_1060821 | Not Available | 687 | Open in IMG/M |
3300012013|Ga0153805_1061704 | Not Available | 635 | Open in IMG/M |
3300012017|Ga0153801_1055907 | Not Available | 694 | Open in IMG/M |
(restricted) 3300013128|Ga0172366_10758250 | Not Available | 566 | Open in IMG/M |
(restricted) 3300013129|Ga0172364_10037736 | All Organisms → cellular organisms → Bacteria | 3556 | Open in IMG/M |
(restricted) 3300013129|Ga0172364_10521054 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 750 | Open in IMG/M |
(restricted) 3300013133|Ga0172362_10023808 | Not Available | 5007 | Open in IMG/M |
3300014050|Ga0119952_1075963 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 832 | Open in IMG/M |
3300014819|Ga0119954_1039319 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 851 | Open in IMG/M |
3300017722|Ga0181347_1212553 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
3300017736|Ga0181365_1068230 | Not Available | 879 | Open in IMG/M |
3300017736|Ga0181365_1166100 | Not Available | 519 | Open in IMG/M |
3300017747|Ga0181352_1096554 | Not Available | 814 | Open in IMG/M |
3300017761|Ga0181356_1143932 | Not Available | 743 | Open in IMG/M |
3300017761|Ga0181356_1174092 | Not Available | 653 | Open in IMG/M |
3300017777|Ga0181357_1186569 | Not Available | 747 | Open in IMG/M |
3300017778|Ga0181349_1216642 | Not Available | 654 | Open in IMG/M |
3300017784|Ga0181348_1093864 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Chlorobi → Chlorobia → Chlorobiales → Chlorobiaceae → Chlorobium/Pelodictyon group → Pelodictyon → Pelodictyon phaeoclathratiforme | 1177 | Open in IMG/M |
3300017784|Ga0181348_1197271 | Not Available | 724 | Open in IMG/M |
3300017784|Ga0181348_1281589 | Not Available | 563 | Open in IMG/M |
3300017785|Ga0181355_1263131 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 658 | Open in IMG/M |
3300017785|Ga0181355_1374783 | Not Available | 519 | Open in IMG/M |
3300018048|Ga0181606_10619851 | Not Available | 554 | Open in IMG/M |
3300019784|Ga0181359_1040032 | Not Available | 1815 | Open in IMG/M |
3300019784|Ga0181359_1194530 | Not Available | 658 | Open in IMG/M |
3300019784|Ga0181359_1246396 | Not Available | 545 | Open in IMG/M |
3300020083|Ga0194111_10473101 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 811 | Open in IMG/M |
3300020109|Ga0194112_10156311 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Chlorobi → Chlorobia → Chlorobiales → Chlorobiaceae → Chlorobium/Pelodictyon group → Pelodictyon → Pelodictyon phaeoclathratiforme | 1919 | Open in IMG/M |
3300020141|Ga0211732_1221424 | Not Available | 1087 | Open in IMG/M |
3300020141|Ga0211732_1262081 | Not Available | 690 | Open in IMG/M |
3300020141|Ga0211732_1575498 | Not Available | 869 | Open in IMG/M |
3300020151|Ga0211736_10135281 | Not Available | 1124 | Open in IMG/M |
3300020151|Ga0211736_10917553 | Not Available | 624 | Open in IMG/M |
3300020159|Ga0211734_10071735 | Not Available | 568 | Open in IMG/M |
3300020159|Ga0211734_10225380 | Not Available | 797 | Open in IMG/M |
3300020159|Ga0211734_10246807 | Not Available | 612 | Open in IMG/M |
3300020160|Ga0211733_10074184 | Not Available | 733 | Open in IMG/M |
3300020160|Ga0211733_11006726 | All Organisms → cellular organisms → Bacteria | 1247 | Open in IMG/M |
3300020172|Ga0211729_10285839 | Not Available | 705 | Open in IMG/M |
3300020172|Ga0211729_10373251 | Not Available | 654 | Open in IMG/M |
3300020172|Ga0211729_10621383 | Not Available | 626 | Open in IMG/M |
3300020172|Ga0211729_10781896 | Not Available | 576 | Open in IMG/M |
3300020205|Ga0211731_10045380 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 574 | Open in IMG/M |
3300020205|Ga0211731_10173907 | Not Available | 600 | Open in IMG/M |
3300020221|Ga0194127_10679020 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 647 | Open in IMG/M |
3300020541|Ga0208359_1052783 | Not Available | 595 | Open in IMG/M |
3300020549|Ga0207942_1033582 | Not Available | 642 | Open in IMG/M |
3300020556|Ga0208486_1037390 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 724 | Open in IMG/M |
3300020573|Ga0208485_1071227 | Not Available | 581 | Open in IMG/M |
3300021424|Ga0194117_10052633 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2345 | Open in IMG/M |
3300021424|Ga0194117_10304700 | Not Available | 751 | Open in IMG/M |
3300021962|Ga0222713_10236959 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 1197 | Open in IMG/M |
3300021962|Ga0222713_10392160 | Not Available | 857 | Open in IMG/M |
3300021963|Ga0222712_10287372 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1036 | Open in IMG/M |
3300022190|Ga0181354_1190191 | Not Available | 618 | Open in IMG/M |
3300024346|Ga0244775_11279466 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 568 | Open in IMG/M |
3300024346|Ga0244775_11348046 | Not Available | 550 | Open in IMG/M |
3300024348|Ga0244776_10123143 | Not Available | 1915 | Open in IMG/M |
3300024348|Ga0244776_10547210 | Not Available | 739 | Open in IMG/M |
3300024563|Ga0255236_1038425 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1126 | Open in IMG/M |
3300024566|Ga0256309_1064107 | Not Available | 952 | Open in IMG/M |
3300024566|Ga0256309_1171968 | Not Available | 529 | Open in IMG/M |
3300025585|Ga0208546_1107666 | Not Available | 620 | Open in IMG/M |
3300025732|Ga0208784_1020494 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2154 | Open in IMG/M |
3300026931|Ga0209850_1022810 | Not Available | 513 | Open in IMG/M |
3300027121|Ga0255074_1012037 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 1145 | Open in IMG/M |
3300027123|Ga0255090_1034636 | Not Available | 801 | Open in IMG/M |
3300027123|Ga0255090_1034878 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → pseudomallei group → Burkholderia pseudomallei | 797 | Open in IMG/M |
3300027133|Ga0255070_1045577 | Not Available | 681 | Open in IMG/M |
3300027140|Ga0255080_1000856 | All Organisms → cellular organisms → Bacteria | 6722 | Open in IMG/M |
3300027144|Ga0255102_1076525 | Not Available | 527 | Open in IMG/M |
3300027145|Ga0255114_1022658 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1215 | Open in IMG/M |
3300027145|Ga0255114_1029083 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Chlorobi → Chlorobia → Chlorobiales → Chlorobiaceae | 1047 | Open in IMG/M |
3300027210|Ga0208802_1021399 | Not Available | 890 | Open in IMG/M |
3300027210|Ga0208802_1027067 | Not Available | 789 | Open in IMG/M |
3300027211|Ga0208307_1004670 | Not Available | 2350 | Open in IMG/M |
3300027211|Ga0208307_1017329 | All Organisms → Viruses → Predicted Viral | 1178 | Open in IMG/M |
3300027213|Ga0208555_1026320 | Not Available | 916 | Open in IMG/M |
3300027224|Ga0208164_1012773 | Not Available | 1580 | Open in IMG/M |
3300027285|Ga0255131_1013408 | All Organisms → Viruses → Predicted Viral | 1823 | Open in IMG/M |
3300027286|Ga0255129_1056719 | Not Available | 597 | Open in IMG/M |
3300027295|Ga0255126_1042957 | Not Available | 905 | Open in IMG/M |
3300027305|Ga0208168_1105881 | Not Available | 548 | Open in IMG/M |
3300027314|Ga0208811_1032076 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1209 | Open in IMG/M |
3300027333|Ga0255138_1039588 | Not Available | 823 | Open in IMG/M |
3300027368|Ga0255133_1066343 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 724 | Open in IMG/M |
3300027375|Ga0255137_1051601 | Not Available | 760 | Open in IMG/M |
3300027489|Ga0255095_1052251 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 733 | Open in IMG/M |
3300027538|Ga0255085_1089258 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 644 | Open in IMG/M |
3300027586|Ga0208966_1007089 | All Organisms → cellular organisms → Bacteria | 3356 | Open in IMG/M |
3300027586|Ga0208966_1147509 | Not Available | 624 | Open in IMG/M |
3300027593|Ga0255118_1015100 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1488 | Open in IMG/M |
3300027593|Ga0255118_1063181 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 615 | Open in IMG/M |
3300027600|Ga0255117_1026966 | Not Available | 1256 | Open in IMG/M |
3300027608|Ga0208974_1097426 | Not Available | 788 | Open in IMG/M |
3300027608|Ga0208974_1155047 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 578 | Open in IMG/M |
3300027621|Ga0208951_1049615 | All Organisms → Viruses → Predicted Viral | 1227 | Open in IMG/M |
3300027649|Ga0208960_1013625 | All Organisms → cellular organisms → Bacteria | 3388 | Open in IMG/M |
3300027697|Ga0209033_1163878 | Not Available | 684 | Open in IMG/M |
3300027732|Ga0209442_1280325 | Not Available | 583 | Open in IMG/M |
3300027753|Ga0208305_10274226 | Not Available | 595 | Open in IMG/M |
3300027754|Ga0209596_1018145 | All Organisms → cellular organisms → Bacteria | 4312 | Open in IMG/M |
3300027754|Ga0209596_1308049 | All Organisms → cellular organisms → Bacteria | 627 | Open in IMG/M |
3300027756|Ga0209444_10173939 | Not Available | 803 | Open in IMG/M |
3300027759|Ga0209296_1118413 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 1237 | Open in IMG/M |
3300027785|Ga0209246_10024689 | All Organisms → cellular organisms → Bacteria | 2265 | Open in IMG/M |
3300027798|Ga0209353_10128912 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 1135 | Open in IMG/M |
3300027798|Ga0209353_10418880 | Not Available | 546 | Open in IMG/M |
3300027804|Ga0209358_10058034 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 2261 | Open in IMG/M |
3300027808|Ga0209354_10007937 | All Organisms → cellular organisms → Bacteria | 4252 | Open in IMG/M |
3300027808|Ga0209354_10391827 | Not Available | 541 | Open in IMG/M |
3300027816|Ga0209990_10322743 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 687 | Open in IMG/M |
3300028178|Ga0265593_1053179 | Not Available | 1155 | Open in IMG/M |
3300028298|Ga0268280_1037270 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 1453 | Open in IMG/M |
3300029930|Ga0119944_1029222 | Not Available | 717 | Open in IMG/M |
3300031746|Ga0315293_10842393 | Not Available | 667 | Open in IMG/M |
3300031758|Ga0315907_10096996 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → pseudomallei group → Burkholderia pseudomallei | 2529 | Open in IMG/M |
3300031758|Ga0315907_10571241 | Not Available | 882 | Open in IMG/M |
3300031784|Ga0315899_10490546 | All Organisms → cellular organisms → Bacteria | 1179 | Open in IMG/M |
3300031784|Ga0315899_10865444 | All Organisms → cellular organisms → Bacteria | 819 | Open in IMG/M |
3300031787|Ga0315900_10517202 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 899 | Open in IMG/M |
3300031857|Ga0315909_10147475 | Not Available | 1944 | Open in IMG/M |
3300031857|Ga0315909_10453786 | All Organisms → cellular organisms → Bacteria | 900 | Open in IMG/M |
3300031857|Ga0315909_10455121 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 898 | Open in IMG/M |
3300031857|Ga0315909_10684910 | Not Available | 668 | Open in IMG/M |
3300031951|Ga0315904_11197883 | Not Available | 583 | Open in IMG/M |
3300031952|Ga0315294_10473678 | Not Available | 1152 | Open in IMG/M |
3300031963|Ga0315901_10947781 | Not Available | 607 | Open in IMG/M |
3300032050|Ga0315906_10613219 | All Organisms → cellular organisms → Bacteria | 893 | Open in IMG/M |
3300032050|Ga0315906_10702929 | Not Available | 811 | Open in IMG/M |
3300032092|Ga0315905_10507120 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1110 | Open in IMG/M |
3300032092|Ga0315905_11415277 | Not Available | 551 | Open in IMG/M |
3300032093|Ga0315902_10296046 | All Organisms → cellular organisms → Bacteria | 1535 | Open in IMG/M |
3300032116|Ga0315903_10635863 | Not Available | 811 | Open in IMG/M |
3300032116|Ga0315903_10690778 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 765 | Open in IMG/M |
3300032173|Ga0315268_12718356 | Not Available | 508 | Open in IMG/M |
3300033816|Ga0334980_0060105 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1601 | Open in IMG/M |
3300033993|Ga0334994_0214421 | Not Available | 1032 | Open in IMG/M |
3300033994|Ga0334996_0314371 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 772 | Open in IMG/M |
3300034018|Ga0334985_0216053 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1255 | Open in IMG/M |
3300034021|Ga0335004_0299644 | Not Available | 951 | Open in IMG/M |
3300034061|Ga0334987_0060862 | All Organisms → cellular organisms → Bacteria | 3070 | Open in IMG/M |
3300034071|Ga0335028_0035086 | Not Available | 3450 | Open in IMG/M |
3300034071|Ga0335028_0715872 | Not Available | 522 | Open in IMG/M |
3300034082|Ga0335020_0456523 | Not Available | 610 | Open in IMG/M |
3300034101|Ga0335027_0497397 | Not Available | 765 | Open in IMG/M |
3300034102|Ga0335029_0710561 | Not Available | 543 | Open in IMG/M |
3300034103|Ga0335030_0334803 | Not Available | 1002 | Open in IMG/M |
3300034106|Ga0335036_0564217 | Not Available | 697 | Open in IMG/M |
3300034117|Ga0335033_0063981 | All Organisms → cellular organisms → Bacteria | 2202 | Open in IMG/M |
3300034117|Ga0335033_0155258 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1269 | Open in IMG/M |
3300034283|Ga0335007_0431610 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 813 | Open in IMG/M |
3300034283|Ga0335007_0577557 | Not Available | 655 | Open in IMG/M |
3300034356|Ga0335048_0411146 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 668 | Open in IMG/M |
3300034356|Ga0335048_0425584 | Not Available | 652 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 13.04% |
Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 11.86% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 9.88% |
Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 8.70% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 7.51% |
Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 7.51% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 7.11% |
Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 5.93% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 5.14% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 3.56% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 2.77% |
Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 2.77% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 1.98% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 1.98% |
Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 1.19% |
Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 1.19% |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 1.58% |
Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 1.58% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.79% |
Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.79% |
Saline Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water | 0.79% |
Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Sand | 0.79% |
Aquatic | Environmental → Aquatic → Freshwater → Drinking Water → Unclassified → Aquatic | 0.40% |
Surface Ice | Environmental → Aquatic → Freshwater → Ice → Unclassified → Surface Ice | 0.40% |
Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 0.40% |
Estuary | Host-Associated → Plants → Leaf → Unclassified → Unclassified → Estuary | 0.40% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300002274 | Freshwater microbial communities from Lake Mendota, WI - 12OCT2012 deep hole epilimnion | Environmental | Open in IMG/M |
3300002278 | Freshwater microbial communities from Lake Mendota, WI - 22OCT2012 deep hole epilimnion | Environmental | Open in IMG/M |
3300002389 | Freshwater microbial communities from Lake Mendota, WI - 21SEP2012 deep hole epilimnion | Environmental | Open in IMG/M |
3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
3300003277 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD | Environmental | Open in IMG/M |
3300003394 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN | Environmental | Open in IMG/M |
3300003616 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.DN | Environmental | Open in IMG/M |
3300004795 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
3300005584 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF | Environmental | Open in IMG/M |
3300005585 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ON33MSRF | Environmental | Open in IMG/M |
3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
3300005941 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.697 | Environmental | Open in IMG/M |
3300005955 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T2_23-Sept-14 | Environmental | Open in IMG/M |
3300006484 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 | Environmental | Open in IMG/M |
3300006641 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA | Environmental | Open in IMG/M |
3300006875 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA | Environmental | Open in IMG/M |
3300007548 | Estuarine microbial communities from the Columbia River estuary - metaG 1548B-3 | Environmental | Open in IMG/M |
3300007549 | Estuarine microbial communities from the Columbia River estuary - metaG 1548B-02 | Environmental | Open in IMG/M |
3300007550 | Estuarine microbial communities from the Columbia River estuary - metaG 1549A-3 | Environmental | Open in IMG/M |
3300007554 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.709 | Environmental | Open in IMG/M |
3300007557 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.715 | Environmental | Open in IMG/M |
3300007562 | Estuarine microbial communities from the Columbia River estuary - metaG 1561A-02 | Environmental | Open in IMG/M |
3300007606 | Estuarine microbial communities from the Columbia River estuary - metaG 1569-02 | Environmental | Open in IMG/M |
3300007618 | Estuarine microbial communities from the Columbia River estuary - metaG 1554A-02 | Environmental | Open in IMG/M |
3300007622 | Estuarine microbial communities from the Columbia River estuary - metaG 1449A-02 | Environmental | Open in IMG/M |
3300007632 | Estuarine microbial communities from the Columbia River estuary - metaG 1554A-3 | Environmental | Open in IMG/M |
3300007642 | Estuarine microbial communities from the Columbia River estuary - metaG 1548A-3 | Environmental | Open in IMG/M |
3300007647 | Estuarine microbial communities from the Columbia River estuary - metaG 1370B-02 | Environmental | Open in IMG/M |
3300007670 | Estuarine microbial communities from the Columbia River estuary - metaG 1449C-3 | Environmental | Open in IMG/M |
3300007992 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1461AB_0.2um | Environmental | Open in IMG/M |
3300008052 | Estuarine microbial communities from the Columbia River estuary - metaG 1553A-02 | Environmental | Open in IMG/M |
3300008055 | Metatranscriptomes of the Eelgrass leaves and roots. Combined Assembly of Gp0128390, Gp0128391, Gp0128392, and Gp0128393 | Host-Associated | Open in IMG/M |
3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
3300008108 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-C-NA | Environmental | Open in IMG/M |
3300008110 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NA | Environmental | Open in IMG/M |
3300008111 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-C-NA | Environmental | Open in IMG/M |
3300008113 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA | Environmental | Open in IMG/M |
3300008116 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NA | Environmental | Open in IMG/M |
3300008117 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-C-NA | Environmental | Open in IMG/M |
3300008120 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-3-NA | Environmental | Open in IMG/M |
3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
3300008953 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007_MT4 | Environmental | Open in IMG/M |
3300008962 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007_MT5 | Environmental | Open in IMG/M |
3300009026 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575 | Environmental | Open in IMG/M |
3300009059 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.703 | Environmental | Open in IMG/M |
3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
3300009079 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.741 | Environmental | Open in IMG/M |
3300009086 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.713 | Environmental | Open in IMG/M |
3300009146 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm March2015 | Environmental | Open in IMG/M |
3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
3300009160 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG | Environmental | Open in IMG/M |
3300009163 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG | Environmental | Open in IMG/M |
3300009164 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG | Environmental | Open in IMG/M |
3300009170 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm May2015 | Environmental | Open in IMG/M |
3300009180 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG | Environmental | Open in IMG/M |
3300009181 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG | Environmental | Open in IMG/M |
3300009184 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG | Environmental | Open in IMG/M |
3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
3300010370 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNA | Environmental | Open in IMG/M |
3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
3300011995 | Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 880 - Top - Depth 1m | Environmental | Open in IMG/M |
3300012012 | Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 879 - Top - Depth 1m | Environmental | Open in IMG/M |
3300012013 | Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 67 - Surface Ice | Environmental | Open in IMG/M |
3300012017 | Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Top - Depth 1m | Environmental | Open in IMG/M |
3300013128 (restricted) | Sediment microbial communities from Lake Kivu, Rwanda - Sediment site 69cm | Environmental | Open in IMG/M |
3300013129 (restricted) | Sediment microbial communities from Lake Kivu, Rwanda - Sediment site 10cm | Environmental | Open in IMG/M |
3300013133 (restricted) | Sediment microbial communities from Lake Kivu, Rwanda - Sediment s1_kivu2a2 | Environmental | Open in IMG/M |
3300014050 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007B | Environmental | Open in IMG/M |
3300014819 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1011A | Environmental | Open in IMG/M |
3300017722 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.N | Environmental | Open in IMG/M |
3300017736 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N | Environmental | Open in IMG/M |
3300017747 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.S.N | Environmental | Open in IMG/M |
3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
3300017778 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D | Environmental | Open in IMG/M |
3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
3300018048 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041412US metaG (megahit assembly) | Environmental | Open in IMG/M |
3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300020083 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015033 Kigoma Deep Cast 300m | Environmental | Open in IMG/M |
3300020109 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015016 Mahale Deep Cast 400m | Environmental | Open in IMG/M |
3300020141 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_104 megahit1 | Environmental | Open in IMG/M |
3300020151 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1 | Environmental | Open in IMG/M |
3300020159 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1 | Environmental | Open in IMG/M |
3300020160 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_105 megahit1 | Environmental | Open in IMG/M |
3300020172 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1 | Environmental | Open in IMG/M |
3300020183 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015002 Mahale S4 surface | Environmental | Open in IMG/M |
3300020205 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1 | Environmental | Open in IMG/M |
3300020221 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015036 Kigoma Deep Cast 100m | Environmental | Open in IMG/M |
3300020541 | Freshwater microbial communities from Lake Mendota, WI - 26AUG2009 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020549 | Freshwater microbial communities from Lake Mendota, WI - 12OCT2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020556 | Freshwater microbial communities from Lake Mendota, WI - 03AUG2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020573 | Freshwater microbial communities from Lake Mendota, WI - 17JUL2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020603 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015035 Kigoma Deep Cast 150m | Environmental | Open in IMG/M |
3300021424 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015009 Mahale N1 surface | Environmental | Open in IMG/M |
3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
3300024348 | 0.2um to 3um size fraction coassembly | Environmental | Open in IMG/M |
3300024563 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepB_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024566 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Colum_RepA_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300025585 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025732 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300026931 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T2_23-Sept-14 (SPAdes) | Environmental | Open in IMG/M |
3300027121 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepC_8h | Environmental | Open in IMG/M |
3300027123 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepA_8d | Environmental | Open in IMG/M |
3300027133 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Miss_RepB_8h | Environmental | Open in IMG/M |
3300027140 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Atlam_RepC_8h | Environmental | Open in IMG/M |
3300027144 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Cont_RepA_0h | Environmental | Open in IMG/M |
3300027145 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Law_RepA_8h | Environmental | Open in IMG/M |
3300027210 | Estuarine microbial communities from the Columbia River estuary - metaG 1449C-3 (SPAdes) | Environmental | Open in IMG/M |
3300027211 | Estuarine microbial communities from the Columbia River estuary - metaG 1449B-02 (SPAdes) | Environmental | Open in IMG/M |
3300027213 | Estuarine microbial communities from the Columbia River estuary - metaG 1449A-3 (SPAdes) | Environmental | Open in IMG/M |
3300027224 | Estuarine microbial communities from the Columbia River estuary - metaG 1449C-02 (SPAdes) | Environmental | Open in IMG/M |
3300027285 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Yuk_RepC_8d | Environmental | Open in IMG/M |
3300027286 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Yuk_RepA_8d | Environmental | Open in IMG/M |
3300027295 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Miss_RepA_8d | Environmental | Open in IMG/M |
3300027305 | Estuarine microbial communities from the Columbia River estuary - metaG 1547A-02 (SPAdes) | Environmental | Open in IMG/M |
3300027314 | Estuarine microbial communities from the Columbia River estuary - metaG 1561A-02 (SPAdes) | Environmental | Open in IMG/M |
3300027333 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Colum_RepA_8d | Environmental | Open in IMG/M |
3300027368 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Law_RepB_8d | Environmental | Open in IMG/M |
3300027375 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Atlam_RepC_8d | Environmental | Open in IMG/M |
3300027489 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepC_8d | Environmental | Open in IMG/M |
3300027538 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepB_8d | Environmental | Open in IMG/M |
3300027586 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF (SPAdes) | Environmental | Open in IMG/M |
3300027593 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Atlam_RepB_8h | Environmental | Open in IMG/M |
3300027600 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Atlam_RepA_8h | Environmental | Open in IMG/M |
3300027608 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes) | Environmental | Open in IMG/M |
3300027621 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF (SPAdes) | Environmental | Open in IMG/M |
3300027649 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ON33MSRF (SPAdes) | Environmental | Open in IMG/M |
3300027697 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.DN (SPAdes) | Environmental | Open in IMG/M |
3300027732 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DD (SPAdes) | Environmental | Open in IMG/M |
3300027753 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.741 (SPAdes) | Environmental | Open in IMG/M |
3300027754 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027756 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.DN (SPAdes) | Environmental | Open in IMG/M |
3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027785 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
3300027798 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
3300027804 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN (SPAdes) | Environmental | Open in IMG/M |
3300027808 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes) | Environmental | Open in IMG/M |
3300027816 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
3300028178 | Saline water microbial communities from Sakinaw Lake, British Columbia, Canada - sak_2011_5_24_36m | Environmental | Open in IMG/M |
3300028298 | Saline water microbial communities from Sakinaw Lake, British Columbia, Canada - sak_2011_5_24_40m | Environmental | Open in IMG/M |
3300029930 | Aquatic microbial communities from drinking water treatment plant in Pearl River Delta area, China - influent_20120727 | Environmental | Open in IMG/M |
3300031746 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_20 | Environmental | Open in IMG/M |
3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
3300031784 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112 | Environmental | Open in IMG/M |
3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
3300031952 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_40 | Environmental | Open in IMG/M |
3300031963 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116 | Environmental | Open in IMG/M |
3300032050 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122 | Environmental | Open in IMG/M |
3300032092 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121 | Environmental | Open in IMG/M |
3300032093 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117 | Environmental | Open in IMG/M |
3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
3300032173 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_top | Environmental | Open in IMG/M |
3300033816 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Sep2004-rr0005 | Environmental | Open in IMG/M |
3300033993 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2012-rr0037 | Environmental | Open in IMG/M |
3300033994 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME25Jul2006D11-rr0046 | Environmental | Open in IMG/M |
3300034018 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME04Jul2014-rr0021 | Environmental | Open in IMG/M |
3300034021 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME01Oct2014-rr0057 | Environmental | Open in IMG/M |
3300034061 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028 | Environmental | Open in IMG/M |
3300034071 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Oct2008D10-rr0110 | Environmental | Open in IMG/M |
3300034082 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Jun2015-rr0088 | Environmental | Open in IMG/M |
3300034101 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107 | Environmental | Open in IMG/M |
3300034102 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112 | Environmental | Open in IMG/M |
3300034103 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Sep2002-rr0119 | Environmental | Open in IMG/M |
3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
3300034117 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jun2014-rr0124 | Environmental | Open in IMG/M |
3300034283 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2003-rr0061 | Environmental | Open in IMG/M |
3300034356 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jun2014-rr0152 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
B570J29581_1110671 | 3300002274 | Freshwater | MIKLKEILLENTAPDIFVPRRMDDRLERMIGAYIRNGSKGGLNLQNKNLTVLP |
B570J29590_1103331 | 3300002278 | Freshwater | MIKLKDILLEGKXSTIFIPRRIEGRVERMIKTYIRNGSKGKL |
B570J29643_1012903 | 3300002389 | Freshwater | MIKLKDILLESTAPDIFVPRRIENRLERMIALYVRNGSKGNL |
B570J29032_1089085852 | 3300002408 | Freshwater | MIKLKDILLESTAPNIFVPRRIENRVERLIKTYIRNGNKGDLDL |
B570J29032_1094809861 | 3300002408 | Freshwater | MIKLKDILLEGKPPSIFVPRRMEDRFERMIKNYIRNGSKGDLD |
B570J29032_1097976474 | 3300002408 | Freshwater | MIKLKDILLESTAPDIFIPRRIEGRVERLIRLYVKNGSKGNLSLN |
JGI25908J49247_100407281 | 3300003277 | Freshwater Lake | MIKLKDILLESTAPDIFIPRRIEGRVERLIRLYVRNGSKGGLR |
JGI25908J49247_101558822 | 3300003277 | Freshwater Lake | MIXXKDIXXEGKPPSIFVPRRMEDRVERMIKNYIRNGSKGDLD |
JGI25907J50239_10983351 | 3300003394 | Freshwater Lake | MIKLKDILLEGKPPSIFIPRRIEDRVERLIKNYIRNGSKG |
JGI25928J51866_10750262 | 3300003616 | Freshwater Lake | MIKLKDILLESTAPNIFVPRRIEDRVERLIKNYIRNGSKGDLVL |
Ga0007756_115615951 | 3300004795 | Freshwater Lake | MIKLKEILLENDAPNIFIPRRMENRVERLIKTYIRNGNKGNLNLQDLNL |
Ga0068876_102994841 | 3300005527 | Freshwater Lake | MVKLKQLLFESTAPDIFIPRRMEDRIERLIKQYIRNGSKGDLIL |
Ga0049081_100453191 | 3300005581 | Freshwater Lentic | MIKLKDILFEGKPPSIFVPRRMEDRIERMIKNYIRNGSKGDLDLSRLNLTV |
Ga0049081_101765871 | 3300005581 | Freshwater Lentic | MIKLKDILLESTAPDIFIPRRIEGRVERMIRLYVRNGSKGGLRLNRVGLTK |
Ga0049081_102396381 | 3300005581 | Freshwater Lentic | MIKLKDILFESTAPDIFIPRRIEGRVERMIRLYVRNGSKGGLRLNRVG |
Ga0049081_102671632 | 3300005581 | Freshwater Lentic | MIKLKDILLEGKPPSIFIPRRIEDRIERMIKTYIRNGNKGSLNLSDLKL |
Ga0049080_101379802 | 3300005582 | Freshwater Lentic | MIKLKDILLESTAPDIFIPRRIEGRVERMIRLYVRNGSKGGLRLNRVG |
Ga0049080_101604441 | 3300005582 | Freshwater Lentic | MIKLKQLLLESTAPDIFVPRRIEGRVERMIMLYVKNGSKGDLD |
Ga0049080_101868701 | 3300005582 | Freshwater Lentic | MIKLKQLLLENTAPDIFVPRRIEGRVERLIRLYVRNGSKGGLRLNRVGLTKL |
Ga0049082_102909281 | 3300005584 | Freshwater Lentic | MIKLKDILLESTAPDIFVPRRIEGRVERMIRLYVRNGSKGN |
Ga0049084_102255163 | 3300005585 | Freshwater Lentic | MIKLKDILLENDDPNIFIPRRIEGRVERMIRLYVRNGSKGGLRLNR |
Ga0079957_10956684 | 3300005805 | Lake | MIKLKDLLLEVKAPSIFVPRRMEDRVERMIKSYVRNGSKGTLDLG |
Ga0079957_11252631 | 3300005805 | Lake | MIKLKDILLENTAPNIFIPRRMENRLDKYIRLYIKNGSKG |
Ga0079957_13730511 | 3300005805 | Lake | MIKLKDILLENDAPNIFIPRRMENRLDKYIRLYIKNGSKG |
Ga0070743_102480422 | 3300005941 | Estuarine | MIKLKDILLESTAPDIFVPRRLEDRIERMIRLYVKNGSKGDLDLS |
Ga0073922_10136773 | 3300005955 | Sand | MIKLKDILLESTAPDIFVPRRLEDRIERMIRLYVKNGSKGDLDLSDLNLT |
Ga0070744_100941972 | 3300006484 | Estuarine | MIKLKDLLLEGKPPSIFVPRRIENRLERMIALYVRN |
Ga0075471_104962771 | 3300006641 | Aqueous | MIKLKDLLLEGKPPSIFVPRRMEDRVERMISLYVRNGSKGNL |
Ga0075473_100481125 | 3300006875 | Aqueous | MIKLKDILTEGKSPNIFVPRRMEDRVERMVITYIRNGSKGYLNLRQMN |
Ga0102877_11516713 | 3300007548 | Estuarine | MIKLKDLLLEGKPPSIFIPRRIEDRIERMIKTYIRNGNKGS |
Ga0102879_10067031 | 3300007549 | Estuarine | MIKLKDLLTEGKSPDIFIPRRIEDRVERLIKNYIRNGSKGDLVLSELPM |
Ga0102880_11419932 | 3300007550 | Estuarine | MIKLKDILLESTAPDIFVPRRLEDRIERMIRLYVKNGSKGDL |
Ga0102820_10982802 | 3300007554 | Estuarine | MIKLKDILLESTAPDIFVPRRIEGRLERLIKNYIRNGSKGNLSLNRVGL |
Ga0102821_11607612 | 3300007557 | Estuarine | MIKLKDLLLEGKPPSIFIPRRIEDRLERMISLYIRN |
Ga0102915_13097782 | 3300007562 | Estuarine | MIKLKDILLEGKPPSIFVPRRMEDRVERMIALYVRNGSKGNL |
Ga0102923_11473521 | 3300007606 | Estuarine | MIKLKDILLEGKPPSIFVPRRMEDRFERMIKTYIHNGNKGDISLIDMELT |
Ga0102896_10134585 | 3300007618 | Estuarine | MIKLKDILLEGKPPSIFIPRRIEDRVERMIRLYIRNGNKGNLNLQNL |
Ga0102896_11331121 | 3300007618 | Estuarine | MIKLKDLLLEGTAPDIFVPRRMEDRLERMISLYIRNGSKGNLVLRRMNLNE |
Ga0102863_10243291 | 3300007622 | Estuarine | MIKLKDILLESTAPDIFIPRRIEGRVERLIRLYVRNGSKGGLRLNRVG |
Ga0102894_10459781 | 3300007632 | Estuarine | MIKLKDILLESTAPDIFVPRRIEGRVERLIRLYVRNGSKGGLRLNRV |
Ga0102876_11384381 | 3300007642 | Estuarine | MIKLKDILLESTAPDIFVPRRLEDRIERMIRLYVKN |
Ga0102855_12189951 | 3300007647 | Estuarine | MIKLKDILLEAKAPSIFIPRRLEDRVERMVRIYIRNGSKGDLDLS |
Ga0102862_11518662 | 3300007670 | Estuarine | VIKLKDILLEGKPSSIFVPRRIEGRVERMIMLYVKNGNKGNLSLSDLKLT |
Ga0105748_100262471 | 3300007992 | Estuary Water | MIKLKDLLTEGKPPNIFVPRRMEDRVERLINLYIRNGSKGYLNLRQMSLNK |
Ga0105748_103624411 | 3300007992 | Estuary Water | MIKLKDILLEGKPPSIFVPRRMEDRVERMISLYVRNGSKGNLSLKE |
Ga0102893_10052341 | 3300008052 | Estuarine | MIKLKDILLEGKPPSIFIPRRMEDRDERFFRIIERKIKEYVRNGSKGDLDLTDVKFNK |
Ga0108970_116701433 | 3300008055 | Estuary | MIKLKDILLEGTAPNIFIPRRIEDRVERLIKNYIRNGSKGDLVLSELPM |
Ga0114340_10994371 | 3300008107 | Freshwater, Plankton | MIKLKDTLLENTAPNIFIPRRMENRLDKYIRLYIKNGSKGTLNL |
Ga0114340_11321871 | 3300008107 | Freshwater, Plankton | MIKLKEILLENTAPNIFIPRRMENRLDKYIRLYIKNGSKGTLNL |
Ga0114340_11464431 | 3300008107 | Freshwater, Plankton | MIKLKEILLENTAPDIFIPRRMDDRLERMISVYIRNGSKGGLNLQ |
Ga0114340_11695481 | 3300008107 | Freshwater, Plankton | MIKLKDILLEGKPPTIFVPRRMEDRIERLIKTYIRNGSKGDLNLHGLHL |
Ga0114340_11802341 | 3300008107 | Freshwater, Plankton | MIKLKDILLENKAPDIFVPRRMEDRVERLINLYIRNGSKGYLNLRQMNLNKL |
Ga0114340_11847713 | 3300008107 | Freshwater, Plankton | MIKLKDILLEAKSPSIFIPRRTDDRVERMIKSYIRNG |
Ga0114340_12156091 | 3300008107 | Freshwater, Plankton | MIKLKEILLENTAPDIFIPRRMDDRLERMISVYIRNG |
Ga0114341_103276651 | 3300008108 | Freshwater, Plankton | MIKLKDILLESTAPDSFIPRRIENRHERMISLYVRNGSKGNLNLSNYKLT |
Ga0114343_11117303 | 3300008110 | Freshwater, Plankton | MIKLKQILLENTAPDVFVPRRMEDRVERMIKNYIRNGNKGNLDLSDLKL |
Ga0114344_12220161 | 3300008111 | Freshwater, Plankton | MIKLKQILLEGKAPKIFIPRRMEDRVERMIKNYIRNGSKGD |
Ga0114346_11901061 | 3300008113 | Freshwater, Plankton | MIKLKQILLESTAPDIFIPRRMDDRLERMISVYIRNGSKGGLNLQNKNL |
Ga0114346_12384991 | 3300008113 | Freshwater, Plankton | MIKLKEILLESKPSTIFVPRRIEDRTERLISLYIRNGNKGDLDLSGL |
Ga0114346_12490121 | 3300008113 | Freshwater, Plankton | MIKLKNILLENEAPDIFVPRRIEDRFERLIKNYIRDH |
Ga0114350_11084542 | 3300008116 | Freshwater, Plankton | MIKLKEILLENTAPDVFVPRRMEDRVERMISLYIRNGNKGELNLSMMN |
Ga0114350_11630572 | 3300008116 | Freshwater, Plankton | MIKLKDLLLESTAPDIFVPRRMDDRLERMISLYIRNGSKGNLVLRL |
Ga0114351_12107861 | 3300008117 | Freshwater, Plankton | MIKLKQILLENTAPNIFIPRRMENRVERLIKTYIRNGNKGNLNLQDLNL |
Ga0114355_11788903 | 3300008120 | Freshwater, Plankton | MIKLKDLLLEGTAPDIFVPRRIEDRLERMIRLYIRNGSKGNLVL* |
Ga0114355_11978933 | 3300008120 | Freshwater, Plankton | MIKLKDILLEAKSPSIFIPRRTDDRVERMIKSYIR |
Ga0114363_12303362 | 3300008266 | Freshwater, Plankton | MIKLKEILLENDAPNIFIPRRMENRVERLIKTYIRNGNKGNLNLQD |
Ga0114876_11765381 | 3300008448 | Freshwater Lake | MIKLKDILLENTAPDIFIPRRMDDRLERMISVYIRNGS |
Ga0114876_11838581 | 3300008448 | Freshwater Lake | MIKLKDILLENKAPDIFVPRRMEDRVERLINLYIRNGSKGYLNLRQM |
Ga0104241_10162541 | 3300008953 | Freshwater | MIKLKQILLEGKAPKIFIPRRMENRVERLISLYIRN |
Ga0104242_10555822 | 3300008962 | Freshwater | MIKLKQILLENTAPDIFVPRRMDDRLERMISVYIRNGSKGGLNLQNKNLTVLH |
Ga0104242_10639651 | 3300008962 | Freshwater | MIKLKQILLESTAPDIFIPRRMDDRLERMISVYIRNGSKGGLNLQNKNLTVLH |
Ga0102829_11967811 | 3300009026 | Estuarine | MIKLKDILLESTAPNIFVPRRIEGRVERMIMLYVKNGSKGDLKLTGLDLTKLPD |
Ga0102830_10109971 | 3300009059 | Estuarine | MIKLKDILLEGKPPSIFVPRRIEDRFERMIRLYIRNGNK |
Ga0114973_103234663 | 3300009068 | Freshwater Lake | MIKLKDILLEGKPPSIFVPRRMEDRFERMIKIYIRNG |
Ga0102814_104590813 | 3300009079 | Estuarine | MIKLKDILLESTAPNIFIPRRIEDRVERLIKNYIRNGSKGDLVLS |
Ga0102812_100932051 | 3300009086 | Estuarine | MIKLKDILLEGKPPSIFIPRRMEDRVERMISVYIRNGNKGNL |
Ga0105091_101424563 | 3300009146 | Freshwater Sediment | MIKLKDLLLENEAPDIFIPRRIEDRNGRFINNLIRQY |
Ga0114980_103056021 | 3300009152 | Freshwater Lake | MIKLKDILLESTAPDIFIPRRIEDRVERLIKNYIRNGCEGDLVLSE |
Ga0114968_101796611 | 3300009155 | Freshwater Lake | MIKLKDILLVNTAPDIFVPRRIEDRLERMIRLYIRNGS |
Ga0114981_103900952 | 3300009160 | Freshwater Lake | MIKLKDILLESTAPDIFVPRRMEDRIERMIKNYIRN |
Ga0114970_103885141 | 3300009163 | Freshwater Lake | MIKLKDILLEGKPPSIFIPRRMEDRIERMIKNYIRNGSKGDLDLSRLN |
Ga0114975_100148171 | 3300009164 | Freshwater Lake | MIKLKDLLLEGTVPDIFVPRRMEDRVERMISLYIR |
Ga0105096_107438332 | 3300009170 | Freshwater Sediment | MIKLKDLLLESTAPNIFVPRRIENRLERMITLYVRNGSKGNLDLSNLK |
Ga0114979_105745963 | 3300009180 | Freshwater Lake | MIKLKDILLEGKPPSIFIPRRIEGRFERMIRIYVRNGSKGNLNL |
Ga0114969_103465683 | 3300009181 | Freshwater Lake | MIKLKQLLLENTAPDIFVPRRIEGRVERLIRLYVRNGSKGGL |
Ga0114976_103825001 | 3300009184 | Freshwater Lake | MIKLKDILLEGKPPSIFVPRRIEGRVERMIKTYIRNGN |
Ga0129333_104062573 | 3300010354 | Freshwater To Marine Saline Gradient | MIKLKDLLTEGKSPNIFVPRRMEDRVERMVVTYIRNGSKGYLNLRQM |
Ga0129333_104982703 | 3300010354 | Freshwater To Marine Saline Gradient | MIKLKEILLENTAPDIFIPRRMDDRLERMISVYIRNGSKGGLNL |
Ga0129333_105841251 | 3300010354 | Freshwater To Marine Saline Gradient | MIKLKDILLESTAPDIFIPRRMDDRLERMISAYIRNGSKGGLNLQNKNLTVL |
Ga0129333_107171341 | 3300010354 | Freshwater To Marine Saline Gradient | MIKLKQILLESTAPDIFIPRRMDDRLERMISVYIRNGSKGGLNLQNKNLT |
Ga0129333_113470641 | 3300010354 | Freshwater To Marine Saline Gradient | MIKLKEILLENTAPDIFIPRRMDDRLERMISVYIR |
Ga0129336_103620851 | 3300010370 | Freshwater To Marine Saline Gradient | MIKLKDILLEGKPPTILVPRRTDDRVERLINLYIRNGNKGDLNL |
Ga0129336_104154291 | 3300010370 | Freshwater To Marine Saline Gradient | MIKLKDILLEGKPPSIFVPRRMEDRVERMIALYVRNGSK |
Ga0133913_130224901 | 3300010885 | Freshwater Lake | MIKLKDILLESTAPNIFIPRRIEDRVERLIKNYIRNGSKGDLVLSE |
Ga0153800_10075811 | 3300011995 | Freshwater | MIKLKDLLLEGTAPDIFVPRRIEDRFERMIRLYIRNGSKGNL |
Ga0153799_10383231 | 3300012012 | Freshwater | MIKLKQLLLESTAPDIFVPRRMEDRVERMIRLYVRNGSKGGLRLNR |
Ga0153799_10608213 | 3300012012 | Freshwater | MIKLKDILFESTAPDIFIPRRIEGRVERMIRLYVRNGSKGGLRLNR |
Ga0153805_10617042 | 3300012013 | Surface Ice | MIKLKQLLLENTAPDIFVPRRLEDRVERMIRLYVRNGSKGGLRLN |
Ga0153801_10559071 | 3300012017 | Freshwater | MIKLKDILLEGKPPSIFVPRRMEDRVERMIKNYIRNGSKGDLD |
(restricted) Ga0172366_107582501 | 3300013128 | Sediment | MIKLVDILFESTAPDIFIPRRLGDRVERLVKLYIRN |
(restricted) Ga0172364_100377361 | 3300013129 | Sediment | MIKLKDILLESTAPDIFIPRRLGDRVERLVKQYIRNGSKGNLNLSSMN |
(restricted) Ga0172364_105210542 | 3300013129 | Sediment | MIKLKDILFESTAPDIFIPRRLGDRVERLVKLYIRNGSKGDLDLSGMNLDELP |
(restricted) Ga0172362_100238081 | 3300013133 | Sediment | MIKLVDILFESTAPDIFIPRRLGDRVERLVKQYIRNGSKGNLD |
Ga0119952_10759632 | 3300014050 | Freshwater | MIKLKQILLEGKPSTIFIPRRIEDRTERLISLYIHNGN |
Ga0119954_10393191 | 3300014819 | Freshwater | MIKLKDILTEGKSPNIFVPRRMEDRVERMVITYIRNGSKGYLNLR |
Ga0181347_12125532 | 3300017722 | Freshwater Lake | MIKLKDILLESTAPDIFVPRRIEGRVERMIMLYVKNGSKGDLDLSDL |
Ga0181365_10682301 | 3300017736 | Freshwater Lake | VIKLKDILLESTAPDIFIPRRIEGRVERMIKTYIRNGSKGDLS |
Ga0181365_11661001 | 3300017736 | Freshwater Lake | MIKLKEILLENTAPDIFIPRRMEDRIERMISLYVKNGSKGDLDLSDLNLT |
Ga0181352_10965542 | 3300017747 | Freshwater Lake | MIKLKNILLESTAPDIFVPRRTDDRVERMIKTYIR |
Ga0181356_11439321 | 3300017761 | Freshwater Lake | MIKLKDILLESTAPDIFIPRRIEGRVERLIRLYVRNGSKGGLRLNRVGL |
Ga0181356_11740921 | 3300017761 | Freshwater Lake | MIKLKDILLENTAPDIFVPRRLEDRLERLVMLYVKNGSK |
Ga0181357_11865691 | 3300017777 | Freshwater Lake | MIKLKDILLESTAPDIFIPRRIEGRVERLIRLYVRNGSKG |
Ga0181349_12166421 | 3300017778 | Freshwater Lake | MIKLKDILLESTAPDIFVPRRIEGRVERLIRLYVRNGSKGGLRLNRVGLTK |
Ga0181348_10938643 | 3300017784 | Freshwater Lake | MIKLKDILLESTAPDIFVPRRIEGRVERMIMLYVKNGSKGDLDLSDLKLT |
Ga0181348_11972711 | 3300017784 | Freshwater Lake | MIKLKDILLESTAPDIFVPRRLEDRLERLVMLYVKN |
Ga0181348_12815891 | 3300017784 | Freshwater Lake | MIKLKDILLENDDPNIFIPRRIEGRVERMIKIYIRN |
Ga0181355_12631313 | 3300017785 | Freshwater Lake | MIKLKDILLEGKPPSIFIPRRMEDRVERMISLYIRNGSKGD |
Ga0181355_13747832 | 3300017785 | Freshwater Lake | MIKLKDILLEGKPPSIFIPRRIEDRIERMIKTYIRNGNKGSL |
Ga0181606_106198512 | 3300018048 | Salt Marsh | MIKLKNILLENDDIFVPRRMEDRVERMISVYIRNGN |
Ga0181359_10400325 | 3300019784 | Freshwater Lake | MIKLKDILLESTAPDIFIPRRIEGRVERLIRLYVRNGSN |
Ga0181359_11945301 | 3300019784 | Freshwater Lake | MIKLKQLLLESTAPDIFVPRRLEDRLERLVMLYVKNGSK |
Ga0181359_12463962 | 3300019784 | Freshwater Lake | MIKLKDILLESTAPDIFVPRRLEDRLERLVMLYVKNGSK |
Ga0194111_104731012 | 3300020083 | Freshwater Lake | MIKLKNLLKAKSTDIFIPRRMEDRVERLIKNYVRNGSKG |
Ga0194112_101563111 | 3300020109 | Freshwater Lake | MIKLKDLLFESEVPDIFVSRRMDDRVERMIKNYVRNGS |
Ga0211732_12214241 | 3300020141 | Freshwater | MIKLKDILFESTVPDIFVPRRVEDRLERMIKQYIRNGSKGNLSLSEMELTVLPD |
Ga0211732_12620813 | 3300020141 | Freshwater | MIKLKDILFESTAPDIFIPRRVEDRVERYIKDYIRNGSQGDLRI |
Ga0211732_15754981 | 3300020141 | Freshwater | MIKLKDILLEAKAPSIFIPRRMEDRVERMVKQYIRNGSKESLELSSM |
Ga0211736_101352813 | 3300020151 | Freshwater | MIKLKDILFESTAPDIFVPRRTEDRLERMIKQYIRNGSKGNLSLSEMELTVLPD |
Ga0211736_109175531 | 3300020151 | Freshwater | MIKLKDILLENTAPDIFVPRRVEDRLERMIKQYIRNGSKGN |
Ga0211734_100717351 | 3300020159 | Freshwater | MIKLKQLLFEGKPPSIFVPRRIEDRLERMIKIYIR |
Ga0211734_102253803 | 3300020159 | Freshwater | MIKLKDLLLESTAPDIFIPRRMEDRIERLIKQYIRNGSKGNL |
Ga0211734_102468072 | 3300020159 | Freshwater | MIKLKDILFESTAPDIFIPRRTEDRLERMIKQYIRNGSKGNLSLSEMELTVL |
Ga0211733_100741842 | 3300020160 | Freshwater | MIKLKDLLLEAKAPDIFIPRRMEDRVERMVKQYIRNGSKESLELSSMN |
Ga0211733_110067263 | 3300020160 | Freshwater | MIKLKDILFESTAPNIFVPRRVEDRVERYIKDYIRNGSQGDLRINQLDLI |
Ga0211729_102858393 | 3300020172 | Freshwater | MIKLKDILLEGKPPSIFIPRRMEDRIERMIKSYIRNG |
Ga0211729_103732511 | 3300020172 | Freshwater | MIKLKDLLLESTAPDIFIPRRMEDRIERLIKQYIRNGSKG |
Ga0211729_106213831 | 3300020172 | Freshwater | MIKLKDILLEGKPPNIFIPRRMEDRVERLIKQYIRNGSRNELDLSD |
Ga0211729_107818961 | 3300020172 | Freshwater | MIKLKQLLLESTAPDIFIPRRMEDRVSRYINSLIKQY |
Ga0194115_100322863 | 3300020183 | Freshwater Lake | MIKLKDILLESKAPDIFIPRRTEDRLERYIKAFIKNDLDNPE |
Ga0211731_100453802 | 3300020205 | Freshwater | MIKLKDLLLESTAPDIFIPRRMEDRVERMIKDYIRN |
Ga0211731_101739071 | 3300020205 | Freshwater | MIKLKDILLEGKPPSIFIPRRMEDRIERMVKQYIRNGS |
Ga0194127_106790202 | 3300020221 | Freshwater Lake | MIKLKDLLFESEVPDIFVSRRMDDRVERMIKNYVRNGSKGNLNLIRK |
Ga0208359_10527831 | 3300020541 | Freshwater | MIKLKDILLEGKPPSILVPRRTDDRVDRLINLYIRNGNKGDLNLSSV |
Ga0207942_10335821 | 3300020549 | Freshwater | MIKLKDILLESTALDIFVPRRIDDRVERLISRYVRNGSKGNLDLR |
Ga0208486_10373902 | 3300020556 | Freshwater | MIKLKDILLESTAPNIFVPRRIKDRFERLIKNYIRN |
Ga0208485_10712271 | 3300020573 | Freshwater | VIKLKDILLEGKPPTIFVPRRLEDRVERMIKNYIRNGNKGNLSL |
Ga0194126_105101331 | 3300020603 | Freshwater Lake | LKDILLESKAPDIFIPRRTEDRLERYIKAFIRNDLDNPE |
Ga0194117_100526337 | 3300021424 | Freshwater Lake | MIKLKDILLESKAPDIFIPRRTEDRLERYIKAFIRNDLDNPE |
Ga0194117_103047001 | 3300021424 | Freshwater Lake | MIKLKDLLFENEAPDIFVSRRMDDRVERMIKNYVRN |
Ga0222713_102369591 | 3300021962 | Estuarine Water | MIKLKEILLENTAPNIFIPRRMENRLDKYIRLYIKNGSKGKLS |
Ga0222713_103921601 | 3300021962 | Estuarine Water | MIKLKDILLENTAPNIFIPRRMENRLDKYIRLYIKNGSKGKLSL |
Ga0222712_102873723 | 3300021963 | Estuarine Water | MIKLKDILLESTAPNIFIPRRTEDRLERLIKLYIRNGSKGNLIL |
Ga0181354_11901911 | 3300022190 | Freshwater Lake | MIKLKDILLESTAPDIFVPRRLEDRLERLVMLYVKNGSKGDLKLIQLD |
Ga0244775_112794662 | 3300024346 | Estuarine | MIKLKDILLESTTPDIFIPRRIENRLERMIRLYIKNGSKG |
Ga0244775_113480462 | 3300024346 | Estuarine | MIKLKQLLLENTAPDIFVPRRIEGRVERMIMLYVKNGSKGDLDLSDLNL |
Ga0244776_101231431 | 3300024348 | Estuarine | VIKLKDILLESTAPDIFIPRRIEGRVERLIRLYVRNGSKGGLRLNREG |
Ga0244776_105472101 | 3300024348 | Estuarine | MINLKQILLENTAPNIFIPRRMENRLDKYIRLYIKNGSKGT |
Ga0255236_10384253 | 3300024563 | Freshwater | MIKLKDLLLENEAPDIFIPRRIEDRVERMIKTYIHNGN |
Ga0256309_10641071 | 3300024566 | Freshwater | MIKLKEILLENTAPDIFVPRRMDDRLERMISVYIRNGSKGGLN |
Ga0256309_11719682 | 3300024566 | Freshwater | MIKLKDILLENTAPDIFVPRRMEDRLERLIMLYVKNGSK |
Ga0208546_11076662 | 3300025585 | Aqueous | MIKLKEILLESTAPDIFIPRRMDDRLERMISVYIRNGSKGGLNLQNKNLTVL |
Ga0208784_10204944 | 3300025732 | Aqueous | MIKLKDILTEGKPPNIFVPRRMEDRVERMVVTYIRNGSKGYLNLRQMNLN |
Ga0209850_10228102 | 3300026931 | Sand | MIKLKDILLESTTPDIFIPRRIENRLERMIRLYIK |
Ga0255074_10120373 | 3300027121 | Freshwater | MIKLKDLLLEGKPPSIFIPRRIEDRLERMISLYIRNGSKGN |
Ga0255090_10346361 | 3300027123 | Freshwater | MIKLKDILLEGKPPTIFVPRRLEDRVERMIKNYIRNGNKGNL |
Ga0255090_10348783 | 3300027123 | Freshwater | MIKLKQLLLESTAPDIFIPRRVEGRVERMIKTYIRNGNK |
Ga0255070_10455771 | 3300027133 | Freshwater | MIKLKDILLEGKPPSIFIPRRIEDRVERMIKNYIRNG |
Ga0255080_100085612 | 3300027140 | Freshwater | MIKLKDLLLEGTAPDIFVPRRIEDRLERMIRLYIR |
Ga0255102_10765251 | 3300027144 | Freshwater | MIKLKDILLEGKPPSIFVPRRMEDRVERMIKNYIRNGSKGDLDLSRLNLTV |
Ga0255114_10226583 | 3300027145 | Freshwater | MIKLKDILLEGKPPSIFIPRRIEGRIERMIMLYVRNGSKGDLDLSGFN |
Ga0255114_10290833 | 3300027145 | Freshwater | MIKLKDILLESTAPDIFVPRRIEGRVERMIRLYVRNGSKGGLRLN |
Ga0208802_10213993 | 3300027210 | Estuarine | VIKLKDILLESTAPDIFIPRRIEGRVERLIRLYVRNGSKGGLRLNRVGL |
Ga0208802_10270671 | 3300027210 | Estuarine | MIKLKDILLESTAPDIFVPRRIEGRVERMIMLYVKNGSKGDLDLSDLKLTVL |
Ga0208307_10046701 | 3300027211 | Estuarine | MIKLKDILLESTAPDIFIPRRIEGRVERLIRLYVRNGSKGGLRLNR |
Ga0208307_10173291 | 3300027211 | Estuarine | MIKLKDLLTEGKPPNIFVPRRMEDRVERLINLYIRNGSKGYLNLRQMS |
Ga0208555_10263201 | 3300027213 | Estuarine | MIKLKDILLESTAPDIFIPRRIEGRVERLIRLYVRNGSKGGLRLN |
Ga0208164_10127733 | 3300027224 | Estuarine | MIKLKDILLESTAPDIFIPRRIEGRVERLIRLYVRNGSK |
Ga0255131_10134085 | 3300027285 | Freshwater | MIKLKDILLEGKPPSIFVPRRMEDRVERMIKNYIRNGSKGDLDLSRLNLT |
Ga0255129_10567192 | 3300027286 | Freshwater | MIKLKDILLEGKPPSIFIPRRIEDRVERMIKNYIRNGSKGDLDLRRMNLT |
Ga0255126_10429571 | 3300027295 | Freshwater | MIKLKDILLEGKPPSIFVPRRMEDRFERMIKNYIRNGSKGDLDLSR |
Ga0208168_11058812 | 3300027305 | Estuarine | MIKLKDLLTEGKSPDIFIPRRIEDRVERLIKNYIRNG |
Ga0208811_10320763 | 3300027314 | Estuarine | MIKLKDILLESTTPDIFIPRRIENRLERMIRLYIKN |
Ga0255138_10395883 | 3300027333 | Freshwater | MIKLKDILLEGKPPSIFVPRRMEDRIERMIKNYIRNGSK |
Ga0255133_10663432 | 3300027368 | Freshwater | MIKLKDILLEGKPPSIFIPRRIEDRVERMIRLYIRNGNKGNLNLQNLH |
Ga0255137_10516011 | 3300027375 | Freshwater | MIKLKDILFEGKPPSIFVPRRMEDRIERMIKNYIRNGSKGD |
Ga0255095_10522511 | 3300027489 | Freshwater | MIKLKDILLESTAPDIFIPRRIENRLERMIALYVRNGSKGDLNLRQMSLNKL |
Ga0255085_10892582 | 3300027538 | Freshwater | MIKLKDLLLENEAPDIFIPRRIEDRVERMISLYVRNGSKGNLSLK |
Ga0208966_10070891 | 3300027586 | Freshwater Lentic | MIKLKDILLENSAPDIFVPRRLEDRLERLVMLYVKNGSKGDLKLIQLDLTEL |
Ga0208966_11475092 | 3300027586 | Freshwater Lentic | MIKLKDLLFENEAPNIFIPRRIEDRVERLIKNYIRN |
Ga0255118_10151004 | 3300027593 | Freshwater | MIKLKDILLEGKPPSIFIPRRIEDRVERMIKTYIRN |
Ga0255118_10631812 | 3300027593 | Freshwater | MIKLKDLLLESTAPNIFVPRRIEGRIERMIKTYIRNG |
Ga0255117_10269663 | 3300027600 | Freshwater | MIKLKDILLEGKPPSIFVPRRMEDRFERMIKNYIRNGSKGDLDLS |
Ga0208974_10974262 | 3300027608 | Freshwater Lentic | MIKLKDILLESTAPDIFIPRRIEGRVERMIRLYVRNGSKGGLR |
Ga0208974_11550471 | 3300027608 | Freshwater Lentic | MIKLKDILLEGTAPDIFVPRRIEDRVERLIKNYIRN |
Ga0208951_10496151 | 3300027621 | Freshwater Lentic | MIKLKDILLENSAPDIFVPRRLEDRLERLVMLYVKNGSKGDLKLIQLD |
Ga0208960_10136256 | 3300027649 | Freshwater Lentic | MIKLKDLLFENEAPNIFIPRRIEDRVERLIKNYIRNGS |
Ga0209033_11638781 | 3300027697 | Freshwater Lake | MIKLKEILLENTAPNIFIPRRMENRVERLIKTYIRNGNKGNLN |
Ga0209442_12803251 | 3300027732 | Freshwater Lake | MIKLKQLLLESTAPDIFVPRRLEDRLERLVMLYVKNGSKGDLKLIQL |
Ga0208305_102742262 | 3300027753 | Estuarine | MIKLKDILLENDAPNIFIPRRMENRVERLIKTYIRNGNKGNLNLQ |
Ga0209596_10181458 | 3300027754 | Freshwater Lake | MIKLKDILLEGKPPSIFIPRRIEDRVERMIRLYIRNGNKGNLNLQNLHL |
Ga0209596_13080492 | 3300027754 | Freshwater Lake | MIKLKDLLLEGKPPSIFIPRRIEGRIERMIKTYIRNGNKGSLNLSDLKLT |
Ga0209444_101739391 | 3300027756 | Freshwater Lake | MIKLKDLLLEGKPPSIFIPRRIEDRVERLISLYIRNGSKG |
Ga0209296_11184133 | 3300027759 | Freshwater Lake | MIKLKDLLLENTAPDIFVPKRMDDRLERMIRLYVRNGSKGDLKLTG |
Ga0209246_100246891 | 3300027785 | Freshwater Lake | MIKLKDILLEGKPPSIFIPRRIEDRVERMIKNYIRN |
Ga0209353_101289121 | 3300027798 | Freshwater Lake | MIKLKDLLLEGKPPSIFIPRRIEDRIERMIKTYIRNGNKGSLNLSD |
Ga0209353_104188801 | 3300027798 | Freshwater Lake | MIKLKDILLEGKPPSIFIPRRMEDRVERMISLYIRNGSK |
Ga0209358_100580341 | 3300027804 | Freshwater Lake | MIKLKDLLLESTAPDIFVPRRMDDRLERMISLYIR |
Ga0209354_100079371 | 3300027808 | Freshwater Lake | MIKLKDILLESTAPNIFIPRRIEDRVERLIKNYIRNGS |
Ga0209354_103918272 | 3300027808 | Freshwater Lake | MIKLKDLLLEGKPPSIFIPRRIEDRIERMIKTYIRNGNKGSLNLSDLKL |
Ga0209990_103227432 | 3300027816 | Freshwater Lake | MIKLKDILLEAKSPSIFIPRRTDDRVERMIKSYIRNGI |
Ga0265593_10531793 | 3300028178 | Saline Water | MIKLKDILLESTAPDIFVPRRLEDRVERLIMLYVKNGSKGDLRINQLD |
Ga0268280_10372703 | 3300028298 | Saline Water | MIKLKDLLLEGKPPSIFVPRRMEDRVERMISLYIRNGSKGNLSLNHMNLTV |
Ga0119944_10292221 | 3300029930 | Aquatic | MIKLKDILFEQEVPDIFIPRRTEDRAERYIKNYIRSGSKGKL |
Ga0315293_108423931 | 3300031746 | Sediment | MIKLKDILLESTAPDIFVPRRLEDRLERLVMLYVKNGSKGDLR |
Ga0315907_100969966 | 3300031758 | Freshwater | MIKLKNILLENEAPDIFVPRRIKDRFERLIKNYIRDH |
Ga0315907_105712412 | 3300031758 | Freshwater | MIKLKDILLESTAPDIFIPRRMDDRLERMISVYIRN |
Ga0315899_104905461 | 3300031784 | Freshwater | MIKLKEILLENTAPDIFIPRRMDDRLERMISVYIRNGSKGGLNLQNKNLTVLP |
Ga0315899_108654443 | 3300031784 | Freshwater | MIKLKQILLEGKPSTIFIPRRIEDRIERLIGLYIRDGSKGNLRLA |
Ga0315900_105172021 | 3300031787 | Freshwater | MVKLKQLLFESTAPDIFIPRRMEDRIERLIKQYIRNGSKGDLILRELPMKLTKLP |
Ga0315909_101474751 | 3300031857 | Freshwater | MIKLKDILLEGKPSSIFVPRRLEDRVERMIKNYIRNG |
Ga0315909_104537861 | 3300031857 | Freshwater | MIKLKQILLESTAPDIFIPRRMDDRLERMISVYIRNGSKG |
Ga0315909_104551211 | 3300031857 | Freshwater | MIKLKDLLTEGKPPNIFVPRRMEDRVERLINLYIRNGSKGYLNLRQMSLNKLP |
Ga0315909_106849103 | 3300031857 | Freshwater | MIKLKNILLENDDIFVPRRIEDRFERLIKNYLRDH |
Ga0315904_111978831 | 3300031951 | Freshwater | MIKLKEILLENDAPNIFIPRRMENRVERLIKTYIRNG |
Ga0315294_104736781 | 3300031952 | Sediment | MIKLKDILLESTAPDIFVPRRLEDRLERLVMLYVKNGSKGDLRINQLD |
Ga0315901_109477811 | 3300031963 | Freshwater | MIKLKNILLENETPDIFVPRRIEDRFERLIKNYIRDHS |
Ga0315906_106132193 | 3300032050 | Freshwater | MIKLKQILLEGKAPKIFIPRRMEDRVERLINLYIRNGSKGYLNLRQMSLN |
Ga0315906_107029292 | 3300032050 | Freshwater | MIKLKEILLENTAPDIFIPRRMDDRLERMISVYIRNGSKG |
Ga0315905_105071201 | 3300032092 | Freshwater | MIKLKQILLEGKAPKIFIPRRMEDRVERLINLYIRNGSKGYLNL |
Ga0315905_114152772 | 3300032092 | Freshwater | MIKLKDLLTEGKSPNIFVPRRMEDRVERMVVTYIRNGSKGYLNLRQ |
Ga0315902_102960461 | 3300032093 | Freshwater | MIKLKDILLESTAPDIFIPRRMDDRLERMISVYIRNGSKGN |
Ga0315903_106358631 | 3300032116 | Freshwater | MIKLKDILLEGKPPSIFVPRRMEDRVERMISLYVRNGSKGN |
Ga0315903_106907783 | 3300032116 | Freshwater | MIKLKQILLEGKAPKIFIPRRMDNRVERMISLYIRNGSKGNLD |
Ga0315268_127183561 | 3300032173 | Sediment | MIKLKDLLLEGKPPSIFIPRRIEDRIERMIKTYIRNGNKG |
Ga0334980_0060105_1484_1600 | 3300033816 | Freshwater | MIKLKDLLTEGKSPDIFIPRRMEDRVERMVVTYIRNGSK |
Ga0334994_0214421_876_1031 | 3300033993 | Freshwater | MIKLKDILLESTALDIFVPRRIDDRVERLISRYVRNGSKGNLDLRRMNLTKL |
Ga0334996_0314371_2_148 | 3300033994 | Freshwater | MIKLKDILLEGKPPSILVPRRMEDRVERLINLYIRNGSKGYLNLRQMSL |
Ga0334985_0216053_1135_1254 | 3300034018 | Freshwater | MIKLKDLLLEGKPPSIFVPRRIENRLERMIALYVRNGSKG |
Ga0335004_0299644_833_949 | 3300034021 | Freshwater | MIKLKDILLEGKPPSILVPRRMEDRVERLINLYIRNGSK |
Ga0334987_0060862_3_122 | 3300034061 | Freshwater | MIKLKDLLTEGKSPDIFIPRRMEDRVERMVVTYIRNGSKG |
Ga0335028_0035086_3_143 | 3300034071 | Freshwater | MIKLKQILLENTAPDIFVPRRMDDRLERMISVYIRNGSKGGLNLQNK |
Ga0335028_0715872_380_520 | 3300034071 | Freshwater | MIKLKEILLENTAPDIFVPRRMDDRLERMISVYIRNGSKGGLNLQNK |
Ga0335020_0456523_3_116 | 3300034082 | Freshwater | MIKLKDILLEGKPPTIFVPRRLEDRVERMIKNYIRNGN |
Ga0335027_0497397_618_764 | 3300034101 | Freshwater | MIKLKDILTEGKPPNIFVPRRMEDRVERLINLYIRNGSKGYLNLRQMSL |
Ga0335029_0710561_1_150 | 3300034102 | Freshwater | MIKLKDILLESTTPDIFIPRRIENRLERMISLYVRNGSKGDLNLSGMNLT |
Ga0335030_0334803_882_1001 | 3300034103 | Freshwater | MIKLKEILLENTAPDIFVPRRMDDRLERMISVYIRNGSKG |
Ga0335036_0564217_572_697 | 3300034106 | Freshwater | MIKLKDILLEGKPPSILVPRRMEDRVERLINLYIRNGSKGYL |
Ga0335033_0063981_3_113 | 3300034117 | Freshwater | MIKLKDLLLEGKPPSIFIPRRIEDRLERMISLYIRNG |
Ga0335033_0155258_1_135 | 3300034117 | Freshwater | MIKLKDILLEGKPPSIFIPRRIEDRVERLIKNYIRNGSKGDLVLS |
Ga0335007_0431610_1_156 | 3300034283 | Freshwater | MIKLKEILLENTAPDIFVPRRMDDRLERMISVYIRNGSKGGLNLQNKNLTVL |
Ga0335007_0577557_496_654 | 3300034283 | Freshwater | MIKLKDLLTEGKSPDVFVPRRTDDRVDRLINLYIRNGNKGDLNLSSVDITQLP |
Ga0335048_0411146_560_667 | 3300034356 | Freshwater | MIKLKDILLEGKPPSIFIPRRIEDRVERLIKNYIRN |
Ga0335048_0425584_1_162 | 3300034356 | Freshwater | MIKLKQLLLENTAPDIFIPRRIEGRVERMIRLYVRNGSKGGLRLNRVGLTKLPD |
⦗Top⦘ |