Basic Information | |
---|---|
Family ID | F015586 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 253 |
Average Sequence Length | 45 residues |
Representative Sequence | GGVTVNVTGGLSTSAEIGQAVVNAIRAYNRSAGPAQIQVA |
Number of Associated Samples | 171 |
Number of Associated Scaffolds | 253 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Viruses |
% of genes with valid RBS motifs | 0.82 % |
% of genes near scaffold ends (potentially truncated) | 91.70 % |
% of genes from short scaffolds (< 2000 bps) | 87.35 % |
Associated GOLD sequencing projects | 157 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.46 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Duplodnaviria (90.909 % of family members) |
NCBI Taxonomy ID | 2731341 |
Taxonomy | All Organisms → Viruses → Duplodnaviria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater (19.368 % of family members) |
Environment Ontology (ENVO) | Unclassified (49.012 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (42.292 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 27.94% β-sheet: 0.00% Coil/Unstructured: 72.06% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.46 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 253 Family Scaffolds |
---|---|---|
PF02018 | CBM_4_9 | 0.79 |
PF16778 | Phage_tail_APC | 0.40 |
PF00145 | DNA_methylase | 0.40 |
COG ID | Name | Functional Category | % Frequency in 253 Family Scaffolds |
---|---|---|---|
COG0270 | DNA-cytosine methylase | Replication, recombination and repair [L] | 0.40 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 94.47 % |
Unclassified | root | N/A | 5.53 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300002306|B570J29618_1001354 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1762 | Open in IMG/M |
3300002408|B570J29032_109034213 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 573 | Open in IMG/M |
3300002408|B570J29032_109528631 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 841 | Open in IMG/M |
3300002835|B570J40625_100199356 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2173 | Open in IMG/M |
3300002835|B570J40625_101233683 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 624 | Open in IMG/M |
3300003394|JGI25907J50239_1057845 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 780 | Open in IMG/M |
3300003413|JGI25922J50271_10004984 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3760 | Open in IMG/M |
3300003499|JGI25930J51415_1088554 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 512 | Open in IMG/M |
3300005582|Ga0049080_10290211 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 529 | Open in IMG/M |
3300005585|Ga0049084_10231113 | All Organisms → cellular organisms → Bacteria | 625 | Open in IMG/M |
3300005662|Ga0078894_10197843 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1819 | Open in IMG/M |
3300005805|Ga0079957_1088864 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1720 | Open in IMG/M |
3300005805|Ga0079957_1146446 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1208 | Open in IMG/M |
3300006637|Ga0075461_10196888 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 604 | Open in IMG/M |
3300006803|Ga0075467_10595533 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 565 | Open in IMG/M |
3300006917|Ga0075472_10468607 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 625 | Open in IMG/M |
3300006920|Ga0070748_1071162 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1353 | Open in IMG/M |
3300006920|Ga0070748_1177408 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 785 | Open in IMG/M |
3300006920|Ga0070748_1255186 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 630 | Open in IMG/M |
3300007165|Ga0079302_1023563 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1538 | Open in IMG/M |
3300007216|Ga0103961_1268569 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2430 | Open in IMG/M |
3300007276|Ga0070747_1323148 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 529 | Open in IMG/M |
3300007538|Ga0099851_1143328 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 893 | Open in IMG/M |
3300007538|Ga0099851_1155066 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 851 | Open in IMG/M |
3300007539|Ga0099849_1169876 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 834 | Open in IMG/M |
3300007540|Ga0099847_1107501 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 847 | Open in IMG/M |
3300007540|Ga0099847_1112276 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 824 | Open in IMG/M |
3300007541|Ga0099848_1031985 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2188 | Open in IMG/M |
3300007542|Ga0099846_1180752 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 750 | Open in IMG/M |
3300007542|Ga0099846_1347642 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 503 | Open in IMG/M |
3300007559|Ga0102828_1089312 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 743 | Open in IMG/M |
3300007559|Ga0102828_1092290 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 732 | Open in IMG/M |
3300007559|Ga0102828_1202831 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 509 | Open in IMG/M |
3300007640|Ga0070751_1272655 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 637 | Open in IMG/M |
3300007692|Ga0102823_1196290 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 539 | Open in IMG/M |
3300007960|Ga0099850_1149301 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 941 | Open in IMG/M |
3300007960|Ga0099850_1186052 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 822 | Open in IMG/M |
3300007960|Ga0099850_1272506 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 648 | Open in IMG/M |
3300007973|Ga0105746_1147970 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 790 | Open in IMG/M |
3300008055|Ga0108970_10595852 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 669 | Open in IMG/M |
3300008266|Ga0114363_1114240 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2293 | Open in IMG/M |
3300008266|Ga0114363_1118608 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 923 | Open in IMG/M |
3300008266|Ga0114363_1129558 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 864 | Open in IMG/M |
3300008266|Ga0114363_1159275 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 740 | Open in IMG/M |
3300008266|Ga0114363_1219568 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 565 | Open in IMG/M |
3300008448|Ga0114876_1114810 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1044 | Open in IMG/M |
3300008450|Ga0114880_1022651 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2905 | Open in IMG/M |
3300008450|Ga0114880_1085278 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1252 | Open in IMG/M |
3300008450|Ga0114880_1212493 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 637 | Open in IMG/M |
3300009026|Ga0102829_1104846 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 884 | Open in IMG/M |
3300009026|Ga0102829_1276657 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 555 | Open in IMG/M |
3300009039|Ga0105152_10386464 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 588 | Open in IMG/M |
3300009155|Ga0114968_10119591 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1591 | Open in IMG/M |
3300009159|Ga0114978_10077883 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2222 | Open in IMG/M |
3300009159|Ga0114978_10648289 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 606 | Open in IMG/M |
3300009163|Ga0114970_10280587 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 954 | Open in IMG/M |
3300009164|Ga0114975_10639034 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 565 | Open in IMG/M |
3300009168|Ga0105104_10348870 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 818 | Open in IMG/M |
3300009169|Ga0105097_10694261 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 576 | Open in IMG/M |
3300009470|Ga0126447_1130394 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 611 | Open in IMG/M |
3300009529|Ga0114919_10644720 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 723 | Open in IMG/M |
3300009529|Ga0114919_10772464 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 652 | Open in IMG/M |
3300010316|Ga0136655_1078664 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1007 | Open in IMG/M |
3300010354|Ga0129333_11090892 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 667 | Open in IMG/M |
3300010354|Ga0129333_11658975 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 521 | Open in IMG/M |
3300010368|Ga0129324_10297148 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 636 | Open in IMG/M |
3300010368|Ga0129324_10441353 | Not Available | 500 | Open in IMG/M |
3300010885|Ga0133913_10667759 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2723 | Open in IMG/M |
3300012012|Ga0153799_1010277 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2085 | Open in IMG/M |
3300012012|Ga0153799_1035881 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 939 | Open in IMG/M |
3300012722|Ga0157630_1130161 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1377 | Open in IMG/M |
3300013004|Ga0164293_10340034 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1027 | Open in IMG/M |
3300013004|Ga0164293_10774063 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 610 | Open in IMG/M |
3300013004|Ga0164293_10902148 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 556 | Open in IMG/M |
3300013005|Ga0164292_10371860 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 960 | Open in IMG/M |
3300013010|Ga0129327_10893606 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 510 | Open in IMG/M |
3300013372|Ga0177922_10738847 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1039 | Open in IMG/M |
3300017697|Ga0180120_10028539 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2585 | Open in IMG/M |
3300017697|Ga0180120_10273332 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 681 | Open in IMG/M |
3300017707|Ga0181363_1061787 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 657 | Open in IMG/M |
3300017716|Ga0181350_1040738 | Not Available | 1257 | Open in IMG/M |
3300017716|Ga0181350_1063590 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 958 | Open in IMG/M |
3300017716|Ga0181350_1131105 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 596 | Open in IMG/M |
3300017716|Ga0181350_1149965 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 544 | Open in IMG/M |
3300017723|Ga0181362_1020379 | All Organisms → Viruses → Predicted Viral | 1425 | Open in IMG/M |
3300017723|Ga0181362_1074516 | Not Available | 687 | Open in IMG/M |
3300017736|Ga0181365_1095085 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 724 | Open in IMG/M |
3300017736|Ga0181365_1099957 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 703 | Open in IMG/M |
3300017736|Ga0181365_1110406 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 663 | Open in IMG/M |
3300017736|Ga0181365_1137769 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 582 | Open in IMG/M |
3300017747|Ga0181352_1080801 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 909 | Open in IMG/M |
3300017747|Ga0181352_1199830 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 514 | Open in IMG/M |
3300017761|Ga0181356_1199969 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 592 | Open in IMG/M |
3300017774|Ga0181358_1133813 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 861 | Open in IMG/M |
3300017777|Ga0181357_1234390 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 643 | Open in IMG/M |
3300017780|Ga0181346_1007206 | All Organisms → Viruses → Predicted Viral | 4816 | Open in IMG/M |
3300017780|Ga0181346_1043369 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1836 | Open in IMG/M |
3300017784|Ga0181348_1006143 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5289 | Open in IMG/M |
3300017784|Ga0181348_1063734 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1487 | Open in IMG/M |
3300017784|Ga0181348_1101968 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1120 | Open in IMG/M |
3300017784|Ga0181348_1165887 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 816 | Open in IMG/M |
3300017784|Ga0181348_1188855 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 746 | Open in IMG/M |
3300017785|Ga0181355_1112704 | All Organisms → Viruses → Predicted Viral | 1118 | Open in IMG/M |
3300017785|Ga0181355_1155729 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 920 | Open in IMG/M |
3300017785|Ga0181355_1232553 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 713 | Open in IMG/M |
3300018420|Ga0181563_10157137 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1424 | Open in IMG/M |
3300019784|Ga0181359_1175568 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 713 | Open in IMG/M |
3300019784|Ga0181359_1178455 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 704 | Open in IMG/M |
3300019784|Ga0181359_1270295 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 505 | Open in IMG/M |
3300020074|Ga0194113_10176026 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1743 | Open in IMG/M |
3300020162|Ga0211735_11209209 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 746 | Open in IMG/M |
3300020172|Ga0211729_10745881 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1170 | Open in IMG/M |
3300020200|Ga0194121_10280816 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 856 | Open in IMG/M |
3300020214|Ga0194132_10523548 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 581 | Open in IMG/M |
3300020498|Ga0208050_1015529 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 815 | Open in IMG/M |
3300020529|Ga0208233_1022423 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 815 | Open in IMG/M |
3300020548|Ga0208856_1042521 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 603 | Open in IMG/M |
3300020551|Ga0208360_1001782 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4020 | Open in IMG/M |
3300020551|Ga0208360_1002021 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3690 | Open in IMG/M |
3300020561|Ga0207934_1018033 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1184 | Open in IMG/M |
3300021141|Ga0214163_1038922 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1299 | Open in IMG/M |
3300021340|Ga0194041_10087212 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 975 | Open in IMG/M |
3300021962|Ga0222713_10234443 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1205 | Open in IMG/M |
3300021962|Ga0222713_10256662 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1136 | Open in IMG/M |
3300021962|Ga0222713_10322608 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 976 | Open in IMG/M |
3300021963|Ga0222712_10535560 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 687 | Open in IMG/M |
3300021964|Ga0222719_10287409 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1073 | Open in IMG/M |
3300022053|Ga0212030_1003686 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1637 | Open in IMG/M |
3300022053|Ga0212030_1010066 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1164 | Open in IMG/M |
3300022065|Ga0212024_1100737 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 515 | Open in IMG/M |
3300022072|Ga0196889_1073933 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 641 | Open in IMG/M |
3300022169|Ga0196903_1003994 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1963 | Open in IMG/M |
3300022190|Ga0181354_1221885 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 552 | Open in IMG/M |
3300022198|Ga0196905_1024070 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1880 | Open in IMG/M |
3300022198|Ga0196905_1133340 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 646 | Open in IMG/M |
3300022200|Ga0196901_1106589 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 972 | Open in IMG/M |
3300022200|Ga0196901_1187363 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 670 | Open in IMG/M |
3300022200|Ga0196901_1275840 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 513 | Open in IMG/M |
3300022407|Ga0181351_1134665 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 909 | Open in IMG/M |
3300022929|Ga0255752_10080144 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1859 | Open in IMG/M |
3300024289|Ga0255147_1001261 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6369 | Open in IMG/M |
3300024346|Ga0244775_10903629 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 701 | Open in IMG/M |
3300024346|Ga0244775_11148781 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 607 | Open in IMG/M |
3300024346|Ga0244775_11314399 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 559 | Open in IMG/M |
3300024357|Ga0255165_1056631 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 648 | Open in IMG/M |
3300024490|Ga0255185_1005057 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1910 | Open in IMG/M |
3300025451|Ga0208426_1038134 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 736 | Open in IMG/M |
3300025585|Ga0208546_1003676 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4411 | Open in IMG/M |
3300025655|Ga0208795_1085537 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 866 | Open in IMG/M |
3300025759|Ga0208899_1113542 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 986 | Open in IMG/M |
3300025840|Ga0208917_1064045 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1420 | Open in IMG/M |
3300025848|Ga0208005_1060943 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1172 | Open in IMG/M |
3300025896|Ga0208916_10036320 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1994 | Open in IMG/M |
3300027079|Ga0255188_1007808 | All Organisms → Viruses → Predicted Viral | 2542 | Open in IMG/M |
3300027127|Ga0255071_1005836 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2132 | Open in IMG/M |
3300027128|Ga0255099_1011403 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1810 | Open in IMG/M |
3300027141|Ga0255076_1035830 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 882 | Open in IMG/M |
3300027155|Ga0255081_1102626 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 541 | Open in IMG/M |
3300027188|Ga0208921_1068880 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 509 | Open in IMG/M |
3300027193|Ga0208800_1004628 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1710 | Open in IMG/M |
3300027193|Ga0208800_1016939 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 951 | Open in IMG/M |
3300027488|Ga0255084_1023735 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1181 | Open in IMG/M |
3300027492|Ga0255093_1062391 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 711 | Open in IMG/M |
3300027588|Ga0255101_1024123 | Not Available | 883 | Open in IMG/M |
3300027608|Ga0208974_1168519 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 545 | Open in IMG/M |
3300027631|Ga0208133_1012420 | All Organisms → Viruses → Predicted Viral | 2304 | Open in IMG/M |
3300027764|Ga0209134_10164836 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 763 | Open in IMG/M |
3300027805|Ga0209229_10301014 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 707 | Open in IMG/M |
3300027808|Ga0209354_10050039 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1684 | Open in IMG/M |
3300027956|Ga0209820_1081255 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 872 | Open in IMG/M |
3300027969|Ga0209191_1328791 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 558 | Open in IMG/M |
3300027972|Ga0209079_10198089 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 687 | Open in IMG/M |
3300027976|Ga0209702_10197634 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 858 | Open in IMG/M |
3300028083|Ga0255190_1009092 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1734 | Open in IMG/M |
3300028091|Ga0255184_1097400 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 546 | Open in IMG/M |
3300031565|Ga0307379_10594098 | All Organisms → Viruses → Predicted Viral | 1016 | Open in IMG/M |
3300031565|Ga0307379_11456653 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 549 | Open in IMG/M |
3300031566|Ga0307378_10960825 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 700 | Open in IMG/M |
3300031566|Ga0307378_11525695 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 507 | Open in IMG/M |
3300031578|Ga0307376_10220517 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1288 | Open in IMG/M |
3300031673|Ga0307377_10539640 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 843 | Open in IMG/M |
3300031673|Ga0307377_10834053 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 634 | Open in IMG/M |
3300031673|Ga0307377_10931365 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 589 | Open in IMG/M |
3300031707|Ga0315291_10564409 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1041 | Open in IMG/M |
3300031772|Ga0315288_11129447 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 683 | Open in IMG/M |
3300031857|Ga0315909_10806065 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 593 | Open in IMG/M |
3300031952|Ga0315294_11428574 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 546 | Open in IMG/M |
3300031999|Ga0315274_10306344 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1893 | Open in IMG/M |
3300031999|Ga0315274_11229939 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 738 | Open in IMG/M |
3300032053|Ga0315284_10582902 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1338 | Open in IMG/M |
3300032053|Ga0315284_11778518 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 637 | Open in IMG/M |
3300032177|Ga0315276_10448811 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1384 | Open in IMG/M |
3300032462|Ga0335396_10702118 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 619 | Open in IMG/M |
3300032462|Ga0335396_10888701 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 528 | Open in IMG/M |
3300032516|Ga0315273_12831371 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 549 | Open in IMG/M |
3300033233|Ga0334722_10252839 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1294 | Open in IMG/M |
3300033233|Ga0334722_11000022 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 589 | Open in IMG/M |
3300033981|Ga0334982_0138456 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1250 | Open in IMG/M |
3300033981|Ga0334982_0539527 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 511 | Open in IMG/M |
3300033981|Ga0334982_0551978 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 503 | Open in IMG/M |
3300033993|Ga0334994_0300003 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 816 | Open in IMG/M |
3300033993|Ga0334994_0584957 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 504 | Open in IMG/M |
3300033996|Ga0334979_0713111 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 523 | Open in IMG/M |
3300033996|Ga0334979_0725153 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 517 | Open in IMG/M |
3300034012|Ga0334986_0575656 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 540 | Open in IMG/M |
3300034012|Ga0334986_0579225 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 538 | Open in IMG/M |
3300034020|Ga0335002_0156626 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1468 | Open in IMG/M |
3300034021|Ga0335004_0135902 | All Organisms → Viruses → Predicted Viral | 1603 | Open in IMG/M |
3300034061|Ga0334987_0299070 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1068 | Open in IMG/M |
3300034062|Ga0334995_0059101 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3080 | Open in IMG/M |
3300034062|Ga0334995_0356651 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 933 | Open in IMG/M |
3300034062|Ga0334995_0359290 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 928 | Open in IMG/M |
3300034062|Ga0334995_0700701 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 570 | Open in IMG/M |
3300034064|Ga0335001_0632402 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 561 | Open in IMG/M |
3300034066|Ga0335019_0324306 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 960 | Open in IMG/M |
3300034066|Ga0335019_0630931 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 624 | Open in IMG/M |
3300034072|Ga0310127_095065 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1300 | Open in IMG/M |
3300034073|Ga0310130_0007020 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 4214 | Open in IMG/M |
3300034073|Ga0310130_0033788 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1566 | Open in IMG/M |
3300034073|Ga0310130_0179194 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 655 | Open in IMG/M |
3300034092|Ga0335010_0223169 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1131 | Open in IMG/M |
3300034095|Ga0335022_0157562 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1398 | Open in IMG/M |
3300034101|Ga0335027_0107841 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2111 | Open in IMG/M |
3300034104|Ga0335031_0170697 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1492 | Open in IMG/M |
3300034104|Ga0335031_0758412 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 549 | Open in IMG/M |
3300034106|Ga0335036_0363629 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 941 | Open in IMG/M |
3300034106|Ga0335036_0686496 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 608 | Open in IMG/M |
3300034106|Ga0335036_0725236 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 585 | Open in IMG/M |
3300034106|Ga0335036_0734908 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 580 | Open in IMG/M |
3300034112|Ga0335066_0099447 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1840 | Open in IMG/M |
3300034112|Ga0335066_0380214 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 776 | Open in IMG/M |
3300034119|Ga0335054_0021620 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3930 | Open in IMG/M |
3300034120|Ga0335056_0154177 | All Organisms → Viruses → Predicted Viral | 1362 | Open in IMG/M |
3300034121|Ga0335058_0171156 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1271 | Open in IMG/M |
3300034122|Ga0335060_0105669 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1690 | Open in IMG/M |
3300034122|Ga0335060_0339108 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 811 | Open in IMG/M |
3300034166|Ga0335016_0248388 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1123 | Open in IMG/M |
3300034200|Ga0335065_0653265 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 607 | Open in IMG/M |
3300034200|Ga0335065_0845789 | Not Available | 509 | Open in IMG/M |
3300034280|Ga0334997_0226595 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1222 | Open in IMG/M |
3300034283|Ga0335007_0580214 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 653 | Open in IMG/M |
3300034283|Ga0335007_0693927 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 571 | Open in IMG/M |
3300034284|Ga0335013_0809604 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 523 | Open in IMG/M |
3300034356|Ga0335048_0421775 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 657 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 19.37% |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 15.02% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 14.62% |
Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 5.14% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 4.35% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 3.95% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 3.56% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 3.56% |
Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 3.56% |
Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 3.16% |
Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 3.16% |
Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 1.98% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 1.98% |
Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 1.98% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 1.19% |
Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 1.19% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 1.58% |
Freshwater | Environmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater | 1.58% |
Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 1.58% |
Fracking Water | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water | 1.58% |
Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 0.79% |
Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 0.79% |
Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 0.79% |
Lake | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Lake | 0.40% |
Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 0.40% |
Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 0.40% |
Lake Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Lake Sediment | 0.40% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 0.40% |
Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.40% |
Meromictic Pond | Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Meromictic Pond | 0.40% |
Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 0.40% |
Estuary | Host-Associated → Plants → Leaf → Unclassified → Unclassified → Estuary | 0.40% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300002306 | Freshwater microbial communities from Lake Mendota, WI - 31AUG2012 deep hole epilimnion | Environmental | Open in IMG/M |
3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
3300002476 | Freshwater microbial communities from San Paulo Zoo lake, Brazil - NOV 2012 | Environmental | Open in IMG/M |
3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
3300003394 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN | Environmental | Open in IMG/M |
3300003413 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD | Environmental | Open in IMG/M |
3300003499 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.DN | Environmental | Open in IMG/M |
3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
3300005585 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ON33MSRF | Environmental | Open in IMG/M |
3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
3300006637 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNA | Environmental | Open in IMG/M |
3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
3300006803 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNA | Environmental | Open in IMG/M |
3300006917 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNA | Environmental | Open in IMG/M |
3300006920 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 | Environmental | Open in IMG/M |
3300007165 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_16 | Environmental | Open in IMG/M |
3300007212 | Combined Assembly of cyanobacterial bloom in Punggol water reservoir, Singapore (Diel cycle-Bottom layer) 7 sequencing projects | Environmental | Open in IMG/M |
3300007214 | Combined Assembly of cyanobacterial bloom in Punggol water reservoir, Singapore (Diel cycle-Surface layer) 9 sequencing projects | Environmental | Open in IMG/M |
3300007216 | Combined Assembly of cyanobacterial bloom in Punggol water reservoir, Singapore (Diel cycle-Surface and Bottom layer) 16 sequencing projects | Environmental | Open in IMG/M |
3300007276 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 | Environmental | Open in IMG/M |
3300007538 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG | Environmental | Open in IMG/M |
3300007539 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG | Environmental | Open in IMG/M |
3300007540 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG | Environmental | Open in IMG/M |
3300007541 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG | Environmental | Open in IMG/M |
3300007542 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG | Environmental | Open in IMG/M |
3300007559 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541 | Environmental | Open in IMG/M |
3300007640 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 | Environmental | Open in IMG/M |
3300007692 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.743 | Environmental | Open in IMG/M |
3300007960 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG | Environmental | Open in IMG/M |
3300007973 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460A_0.2um | Environmental | Open in IMG/M |
3300008055 | Metatranscriptomes of the Eelgrass leaves and roots. Combined Assembly of Gp0128390, Gp0128391, Gp0128392, and Gp0128393 | Host-Associated | Open in IMG/M |
3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
3300009026 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575 | Environmental | Open in IMG/M |
3300009039 | Lake sediment microbial communities from Lake Baikal, Russia to study Microbial Dark Matter (Phase II) - Lake Baikal sediment 0-5 cm | Environmental | Open in IMG/M |
3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
3300009161 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG | Environmental | Open in IMG/M |
3300009163 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG | Environmental | Open in IMG/M |
3300009164 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG | Environmental | Open in IMG/M |
3300009168 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
3300009169 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
3300009470 | Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, surface; DNA IDBA-UD | Environmental | Open in IMG/M |
3300009529 | Deep subsurface microbial communities from Black Sea to uncover new lineages of life (NeLLi) - Black_00105 metaG | Environmental | Open in IMG/M |
3300010316 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.8_DNA | Environmental | Open in IMG/M |
3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
3300010368 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNA | Environmental | Open in IMG/M |
3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
3300012012 | Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 879 - Top - Depth 1m | Environmental | Open in IMG/M |
3300012722 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES163 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
3300013005 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG | Environmental | Open in IMG/M |
3300013010 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.8_DNA | Environmental | Open in IMG/M |
3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
3300017697 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_DNA (version 2) | Environmental | Open in IMG/M |
3300017707 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MLB.S.N | Environmental | Open in IMG/M |
3300017716 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.DCM.D | Environmental | Open in IMG/M |
3300017723 | Freshwater viral communities from Lake Michigan, USA - Su13.ND.MM110.S.N | Environmental | Open in IMG/M |
3300017736 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N | Environmental | Open in IMG/M |
3300017747 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.S.N | Environmental | Open in IMG/M |
3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
3300018420 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300020074 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015017 Mahale Deep Cast 200m | Environmental | Open in IMG/M |
3300020162 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_201 megahit1 | Environmental | Open in IMG/M |
3300020172 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1 | Environmental | Open in IMG/M |
3300020200 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015020 Mahale Deep Cast 50m | Environmental | Open in IMG/M |
3300020214 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015054 Kigoma Offshore 80m | Environmental | Open in IMG/M |
3300020498 | Freshwater microbial communities from Lake Mendota, WI - 13JUN2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020529 | Freshwater microbial communities from Lake Mendota, WI - 07SEP2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020548 | Freshwater microbial communities from Lake Mendota, WI - 13JUL2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020551 | Freshwater microbial communities from Lake Mendota, WI - 27JUL2010 deep hole epilimnion ns (SPAdes) | Environmental | Open in IMG/M |
3300020561 | Freshwater microbial communities from Lake Mendota, WI - 22APR2009 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300021141 | Freshwater microbial communities from Lake Mendota, WI - Practice 15JUN2010 epilimnion | Environmental | Open in IMG/M |
3300021340 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L442-9m | Environmental | Open in IMG/M |
3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
3300021964 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_34D | Environmental | Open in IMG/M |
3300022053 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (v2) | Environmental | Open in IMG/M |
3300022065 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (v2) | Environmental | Open in IMG/M |
3300022072 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (v3) | Environmental | Open in IMG/M |
3300022169 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (v3) | Environmental | Open in IMG/M |
3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
3300022198 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v3) | Environmental | Open in IMG/M |
3300022200 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3) | Environmental | Open in IMG/M |
3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300022929 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG | Environmental | Open in IMG/M |
3300024289 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepA_8h | Environmental | Open in IMG/M |
3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
3300024357 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepB_8d | Environmental | Open in IMG/M |
3300024490 | Freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Cont_RepB_0h | Environmental | Open in IMG/M |
3300025451 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025585 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025655 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
3300025759 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (SPAdes) | Environmental | Open in IMG/M |
3300025840 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025848 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025889 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes) | Environmental | Open in IMG/M |
3300025896 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300027079 | Freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Cont_RepB_8h | Environmental | Open in IMG/M |
3300027127 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Miss_RepC_8h | Environmental | Open in IMG/M |
3300027128 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Colum_RepA_8d | Environmental | Open in IMG/M |
3300027141 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepB_8h | Environmental | Open in IMG/M |
3300027155 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Colum_RepA_8h | Environmental | Open in IMG/M |
3300027188 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.709 (SPAdes) | Environmental | Open in IMG/M |
3300027193 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541 (SPAdes) | Environmental | Open in IMG/M |
3300027488 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepA_8d | Environmental | Open in IMG/M |
3300027492 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepA_8d | Environmental | Open in IMG/M |
3300027588 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Colum_RepC_8d | Environmental | Open in IMG/M |
3300027608 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes) | Environmental | Open in IMG/M |
3300027631 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 (SPAdes) | Environmental | Open in IMG/M |
3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027764 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MLB.SN (SPAdes) | Environmental | Open in IMG/M |
3300027805 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes) | Environmental | Open in IMG/M |
3300027808 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes) | Environmental | Open in IMG/M |
3300027832 | Freshwater microbial communities from Lake Bonney liftoff mats and glacier meltwater in Antarctica - BON-02 (SPAdes) | Environmental | Open in IMG/M |
3300027956 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 (SPAdes) | Environmental | Open in IMG/M |
3300027969 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027972 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 (SPAdes) | Environmental | Open in IMG/M |
3300027976 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-01 (SPAdes) | Environmental | Open in IMG/M |
3300028083 | Freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Miss_RepA_8h | Environmental | Open in IMG/M |
3300028091 | Freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Cont_RepA_0h | Environmental | Open in IMG/M |
3300031565 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-2 | Environmental | Open in IMG/M |
3300031566 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-1 | Environmental | Open in IMG/M |
3300031578 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-2 | Environmental | Open in IMG/M |
3300031673 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-3 | Environmental | Open in IMG/M |
3300031707 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_20 | Environmental | Open in IMG/M |
3300031772 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_20 | Environmental | Open in IMG/M |
3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
3300031952 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_40 | Environmental | Open in IMG/M |
3300031999 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20 | Environmental | Open in IMG/M |
3300032053 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_16 | Environmental | Open in IMG/M |
3300032177 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_0 | Environmental | Open in IMG/M |
3300032462 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-02 (spades assembly) | Environmental | Open in IMG/M |
3300032516 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0 | Environmental | Open in IMG/M |
3300033233 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_bottom | Environmental | Open in IMG/M |
3300033981 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Aug2014-rr0011 | Environmental | Open in IMG/M |
3300033993 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2012-rr0037 | Environmental | Open in IMG/M |
3300033996 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004 | Environmental | Open in IMG/M |
3300034012 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Aug2017-rr0027 | Environmental | Open in IMG/M |
3300034020 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2015-rr0055 | Environmental | Open in IMG/M |
3300034021 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME01Oct2014-rr0057 | Environmental | Open in IMG/M |
3300034061 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028 | Environmental | Open in IMG/M |
3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
3300034064 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME14Nov2013-rr0054 | Environmental | Open in IMG/M |
3300034066 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Jul2017-rr0087 | Environmental | Open in IMG/M |
3300034072 | Fracking water microbial communities from deep shales in Oklahoma, United States - MC-3-A | Environmental | Open in IMG/M |
3300034073 | Fracking water microbial communities from deep shales in Oklahoma, United States - MC-6-XL | Environmental | Open in IMG/M |
3300034092 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2012-rr0069 | Environmental | Open in IMG/M |
3300034095 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Feb2014D0-rr0091 | Environmental | Open in IMG/M |
3300034101 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107 | Environmental | Open in IMG/M |
3300034104 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120 | Environmental | Open in IMG/M |
3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
3300034112 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Aug2014-rr0191 | Environmental | Open in IMG/M |
3300034119 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME21Jul2015-rr0166 | Environmental | Open in IMG/M |
3300034120 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2014-rr0172 | Environmental | Open in IMG/M |
3300034121 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19May2015-rr0174 | Environmental | Open in IMG/M |
3300034122 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2014-rr0181 | Environmental | Open in IMG/M |
3300034166 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Sep2012-rr0079 | Environmental | Open in IMG/M |
3300034200 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2013-rr0190 | Environmental | Open in IMG/M |
3300034280 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME10Aug2009-rr0048 | Environmental | Open in IMG/M |
3300034283 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2003-rr0061 | Environmental | Open in IMG/M |
3300034284 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jul2016-rr0075 | Environmental | Open in IMG/M |
3300034356 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jun2014-rr0152 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
B570J29618_10013541 | 3300002306 | Freshwater | SNVTVNVNGGLSTSAEIGQAVVNSIRAYTRTAGPAQLDIAPL* |
B570J29032_1090342132 | 3300002408 | Freshwater | TGGGVTINVTGGLATSAEIGESVVNALRAYSRSAGPLQLQVA* |
B570J29032_1095286311 | 3300002408 | Freshwater | DVNINVTGGLATSAEIGQSVVNALRAYSRSAGPLALNIA* |
metazooDRAFT_108352041 | 3300002476 | Lake | REGGNFTVNVEGGLATSAEIGRAVVDAIKQYTNVSGPAAIAVA* |
B570J40625_1001993561 | 3300002835 | Freshwater | KMGSGGGDVNINVTGGLATSAEIGQSVVNALRAYSRSAGPLALNIA* |
B570J40625_1012336831 | 3300002835 | Freshwater | AGPEAVVPLDRMATGGGVTINVTGGLATSAEIGESVVNALRAYSRSAGPLALNIA* |
JGI25907J50239_10578451 | 3300003394 | Freshwater Lake | VPLSKMSAASGGDVNINVAGGLSTSAEIGQSIVNALRAYSRSAGPLALNIA* |
JGI25922J50271_100049849 | 3300003413 | Freshwater Lake | AGPEAVVPLDRMNSGGGVTVNVTGGLSTSAEIGQAVVNALRAYSRSAGPLALNIA* |
JGI25930J51415_10885542 | 3300003499 | Freshwater Lake | VVPLNKMGAMGGVTVNVNGGLATSAEIGQAVVNAIRAYNRSAGPANIQVA* |
Ga0049080_102902111 | 3300005582 | Freshwater Lentic | TPITVNVNGGLATSADIGRAVVNSIKAMNRVDGPAQIQVA* |
Ga0049084_102311131 | 3300005585 | Freshwater Lentic | EAVVPLGRGGGMGNVTVNVTGGLSTSAEIGQAVVNAIRAYNRSAGPAQIQVA* |
Ga0078894_101978433 | 3300005662 | Freshwater Lake | EAVVPLERMNNGGGITINVTGGLATSAEIGESVVNALRAYSRSAGPLQLQVA* |
Ga0079957_10888642 | 3300005805 | Lake | PLSKMGGMGGAITVNVTGGLATSAEIGQAVVNAIRAYNRSAGPANIQVA* |
Ga0079957_11464462 | 3300005805 | Lake | MGGGVTVNVTGGLSTSAEIGQAVVNAIRAYNRSAGPAQIQVA* |
Ga0075461_101968882 | 3300006637 | Aqueous | MLDNITVNVNGGLATSAEIGQAVVDSIRAYNRSAGPARIEVSGYV* |
Ga0070749_105156981 | 3300006802 | Aqueous | GMGITVNVEGGLATSAEIGRAVVDAIKQYTNVSGPADIAVA* |
Ga0075467_105955331 | 3300006803 | Aqueous | DRMKNNGGQNITVNITGGISTSADIGRAVVTAIKAMNRVDGPAQIQVA* |
Ga0075472_104686072 | 3300006917 | Aqueous | ERIANRGDITINVTGGLATSAEIGESVVNSLLAYQRVSGPLDLQIAI* |
Ga0070748_10711621 | 3300006920 | Aqueous | TINVTGGLSTSAEIGQAVVNALRAYSRSAGPLALNIA* |
Ga0070748_11774081 | 3300006920 | Aqueous | NQGGQNITINITGGISTSADIGRAVVNAIKAMNRVDGPAQIQVA* |
Ga0070748_12551861 | 3300006920 | Aqueous | AMGGVTVNVNGGLATSAEIGQAVVNAIRAYNRSAGPANIQVA* |
Ga0079302_10235633 | 3300007165 | Deep Subsurface | GPEAVVPLDRMATGGGVTINVTGGLATSAEIGESVVNALRAYSRSAGPLALNIA* |
Ga0103958_11508441 | 3300007212 | Freshwater Lake | DITVNVTGGLATSADIGAAVVDAIKQYTNVSGPADIAVR* |
Ga0103959_11945422 | 3300007214 | Freshwater Lake | RAREGGNLTVNINGGLATSADIGAAVVDAIKQYSNVSGPVDIAVR* |
Ga0103961_12685691 | 3300007216 | Freshwater Lake | NVTINVSGGISTSAEIGQAVVDSIRAYNRSAGPARIEVSGYV* |
Ga0070747_13231481 | 3300007276 | Aqueous | ITVNVNGGLATSADIGRAVVNSIKAMNRVDGPAQIQVA* |
Ga0099851_11433281 | 3300007538 | Aqueous | EAVVPLDRMQNGGGITINVTGGLATSAEIGESVVNALRAYSRSAGPLQLQVA* |
Ga0099851_11550662 | 3300007538 | Aqueous | EVGPEAVVPLDRMSTGGGITINVTGGLTTSAEIGESVVNALRAYSRSAGPLQLQVA* |
Ga0099849_11698762 | 3300007539 | Aqueous | GDVTINVTGGIATSAEIGESVVNALRAYSRSAGPLQLQVA* |
Ga0099847_11075011 | 3300007540 | Aqueous | KLGKMGGGNITINVTGGLATSAEIGESVVNALRAYSRSAGPLQLQVA* |
Ga0099847_11122762 | 3300007540 | Aqueous | VTVNVTGGLSTSAEIGQSVVNALRAYSRTAGPLQLNVA* |
Ga0099848_10319851 | 3300007541 | Aqueous | GGDVNISVNGGLATSAEIGQAVVDSIRAYNRSAGPARIEVSGYV* |
Ga0099846_11807521 | 3300007542 | Aqueous | TINVTGGLATSAEIGESVVNALRAYSRSAGPLQLQVA* |
Ga0099846_13476422 | 3300007542 | Aqueous | PEAIVPLGRGGGVGGVTVNVTGGLSTSAEIGQAVVNAIRAYNRSAGPAQIQVA* |
Ga0102828_10893122 | 3300007559 | Estuarine | VPLDRMNTGGQVTVNVTGGLSTSAEIGQAVVNALRAYSRSAGPLALNIA* |
Ga0102828_10922902 | 3300007559 | Estuarine | FGYLRVTLNVTGGFATSAETGQAVVHALRAYNRSAGPAQIQVA* |
Ga0102828_12028312 | 3300007559 | Estuarine | VTVNVTGGLATSAEIGQAVVNAIRAYNRSAGPAQIQVA* |
Ga0070751_12726551 | 3300007640 | Aqueous | TVNVMGGLATSAEIGQAVVNAIRAYNRSAGPAQIAVA* |
Ga0102823_11962902 | 3300007692 | Estuarine | GPEAVIPLSKMGGMGGGITVNVNGGLATSAEIGQAVVNAIRAYNRSAGPANIQVA* |
Ga0099850_11493011 | 3300007960 | Aqueous | DYWAGLPGGDVNISVNGGLATSAEIGQAVVDSIRAYNRSAGPARIEVSGYV* |
Ga0099850_11860522 | 3300007960 | Aqueous | GGNITINVTGGLATSAEIGESVVNALRAYSRSAGPLQLQVA* |
Ga0099850_12725062 | 3300007960 | Aqueous | GGMGAGGITVNVTGGLSTSAEIGQAVVNAIRAYNRSAGPANIQVA* |
Ga0105746_11479701 | 3300007973 | Estuary Water | LIGEKGPEAVVPLGRGDGMGNVTVNVTGGLSTSAEIGQAVVNAIRAYNRSAGPAQIQVA* |
Ga0108970_105958522 | 3300008055 | Estuary | VPLDRLNSGGGVTINVTGGLATSAEIGESVVNALRAYSRSAGPLQLQVA* |
Ga0114363_11142403 | 3300008266 | Freshwater, Plankton | VPLERLNTGGGVTINVTGGLATSAEIGESVVNALRAYSRSAGPLQLQVA* |
Ga0114363_11186081 | 3300008266 | Freshwater, Plankton | TVNVTGGLATSAEIGQAVINAIRAYNRTGGPANIQVA* |
Ga0114363_11295581 | 3300008266 | Freshwater, Plankton | LERLNTGGGVTINVTGGLATSAEIGESVVNALRAYSRSAGPLQLSVA* |
Ga0114363_11592751 | 3300008266 | Freshwater, Plankton | RMNTGGGVTINVTGGLATSAEIGESVVNALRAYSRSAGPLQISVA* |
Ga0114363_12195682 | 3300008266 | Freshwater, Plankton | NVTGGLATSAEIGESVVNALRAYSRSAGPLQISVA* |
Ga0114876_11148102 | 3300008448 | Freshwater Lake | VERGTPITVNVNGGLATSADIGRAVVNSIKAMNRVDGPAQIQVA* |
Ga0114880_10226511 | 3300008450 | Freshwater Lake | PEAVVPLSKMNSGGGDVNINVNGGLATSAEIGQSVVNALRAYSRSAGPLALNIA* |
Ga0114880_10852782 | 3300008450 | Freshwater Lake | NVTGGLATSAEIGESVVNALRAYSRSAGPLQLQVA* |
Ga0114880_12124932 | 3300008450 | Freshwater Lake | GPEAVVPLDRMQTGGGITINVTGGLATSAEIGESVVNALRAYSRSAGPLQLQVA* |
Ga0102829_11048461 | 3300009026 | Estuarine | MGNMGGGGVTVNVTGGLATSAEIGQAVVNAIRAYNRSAGPAQIQVA* |
Ga0102829_12766572 | 3300009026 | Estuarine | AVVPLDKMNTGGGVTINVTGGLSTSAEIGQAVVNALRAYSRSAGPLALNIA* |
Ga0105152_103864641 | 3300009039 | Lake Sediment | NVNGGLSTSADIGEAVVNALRAYNRSAGPLQLEIA* |
Ga0114968_101195911 | 3300009155 | Freshwater Lake | EAVVPLSKMGGMGGGITVNVNGGLATSAEIGQAVVNAIRAYNRSAGPANIQVA* |
Ga0114978_100778833 | 3300009159 | Freshwater Lake | MGNYTINITGGLGSSAEIGTAVVNAIRAFNRQNGPANIQVA* |
Ga0114978_106482892 | 3300009159 | Freshwater Lake | GAGMGGGGGVTINVTGGLSTSAEIGQAVVNALRAYNRSAGPANIQVA* |
Ga0114966_107767272 | 3300009161 | Freshwater Lake | NYTINITGGLGSSAEIGTAVVNAIRAFNRQNGPANIAVA* |
Ga0114970_102805872 | 3300009163 | Freshwater Lake | VNVTGGLATSAEIGGAVVNALRAYNRSSGPAQFEIA* |
Ga0114975_106390341 | 3300009164 | Freshwater Lake | MTVNVNGGLSSSADIGEAVVNALRAYNRSAGPLQLEIA* |
Ga0105104_103488702 | 3300009168 | Freshwater Sediment | MADPTTQAAMNVTINVEGGLATSADIGESVVNALRQYNQVQGPIPVAVA* |
Ga0105097_106942612 | 3300009169 | Freshwater Sediment | GDVHINVNGGLATSADIGQSVLNALRAYSRSAGPLALNIA* |
Ga0126447_11303942 | 3300009470 | Meromictic Pond | EAVVPLDRMQSGGGNITINVTGGLATSAEIGESVVNALRAYSRSAGPLQLQVA* |
Ga0114919_106447201 | 3300009529 | Deep Subsurface | TVNVTGGLSTSAEIGQAVVNAIRAYNRSAGPANIQVA* |
Ga0114919_107724642 | 3300009529 | Deep Subsurface | VPLNRASGVGGVTVNVTGGLATSAEIGASVVNAIRAYNRSAGPAQIQVA* |
Ga0136655_10786641 | 3300010316 | Freshwater To Marine Saline Gradient | NVTGGLSTSAEIGQAVVNAIRAYNRSAGPANIQVA* |
Ga0129333_110908922 | 3300010354 | Freshwater To Marine Saline Gradient | GGMGNVTVNVTGGLSTSAEIGQAVVNAIRAYNRSAGPAQIQVA* |
Ga0129333_116589752 | 3300010354 | Freshwater To Marine Saline Gradient | AVVPLDRLNSGGGVTINVTGGLATSAEIGESVVNALRAYSRSAGPLQLQVA* |
Ga0129324_102971481 | 3300010368 | Freshwater To Marine Saline Gradient | VNVNGGLATSAEIGQAVVDSIRAYNRSAGPARIEVSGYV* |
Ga0129324_104413531 | 3300010368 | Freshwater To Marine Saline Gradient | EGGQSEAVIPLDKLGKMGGGDIIINVTGGLATSAEIGESVVNALRAYSRSAGPLQLQVA* |
Ga0133913_106677596 | 3300010885 | Freshwater Lake | GGGVTVNVTGGLSTSAEIGQAVVNALRAYSRSAGPLALNIA* |
Ga0153799_10102773 | 3300012012 | Freshwater | GGGGITVNVMGGLATSAEIGQAVVNAIRAYNRSAGPANIAVA* |
Ga0153799_10358811 | 3300012012 | Freshwater | NQGGQNITVNITGGISTSADIGRAVVNAIKAMNRVDGPAQIQVA* |
Ga0157630_11301611 | 3300012722 | Freshwater | ITINVTGGLATSAEIGESVVNALRAYSRSAGPLQLQVA* |
Ga0164293_103400341 | 3300013004 | Freshwater | VIPLSQMGNMGGGGVTINVAGGLSTSAEIGQSVVNALRAYSRTAGPLQLNVA* |
Ga0164293_107740631 | 3300013004 | Freshwater | PKGPEAVVPLGRGGGMGNVTVNVTGGLSTSAEIGQAVVNAIRAYNRSAGPAQIQVA* |
Ga0164293_109021482 | 3300013004 | Freshwater | RGTPITVNVNGGLATSADIGRAVVNSIKAMNRVDGPAQIQVA* |
Ga0164292_103718601 | 3300013005 | Freshwater | PEAVVPLDRMNNGGGITINVTGGLATSAEIGESVVNALRAYSRSAGPLQLQVA* |
Ga0129327_108936062 | 3300013010 | Freshwater To Marine Saline Gradient | AVIPLDKLGKMGGGNITINVTGGLATSAEIGESVVNALRAYSRSAGPLQLQVA* |
Ga0177922_107388471 | 3300013372 | Freshwater | GMGNVTVNVTGGLSTSAEIGQAVVNAIRAYNRSAGPAQIQVA* |
Ga0180120_100285391 | 3300017697 | Freshwater To Marine Saline Gradient | INVNGGLATSAEIGQSVLNALRAYSRSAGPLALNIA |
Ga0180120_102733322 | 3300017697 | Freshwater To Marine Saline Gradient | SGVGGVTVNVTGGLATSAEIGQAVVNAIRAYNRSAGPAQIQVA |
Ga0181363_10617871 | 3300017707 | Freshwater Lake | GPEAVVPLDRMATGGGVTINVTGGLATSAEIGESVVNALRAYSRSAGPLALNIA |
Ga0181350_10407381 | 3300017716 | Freshwater Lake | MGGMGGGVTVNVTGGLSTSAEIGQAVVNALRAYNRSAGPANIQVA |
Ga0181350_10635902 | 3300017716 | Freshwater Lake | LNRAGGFGGGLTVNVTGGLSTSAEIGQAVVNAIRAYNRSAGPAQIQVA |
Ga0181350_11311051 | 3300017716 | Freshwater Lake | AGPEAVVPLDRMNTGGGVTINVTGGLATSAEIGESVVNAIRAYNRSAGPANIAVA |
Ga0181350_11499651 | 3300017716 | Freshwater Lake | LNQMGNMGGGITVNVTGGLATSAEIGQAVVNAIRAYNRSAGPAQIQVA |
Ga0181362_10203791 | 3300017723 | Freshwater Lake | ITINVNGGLATSADIGKAVVNSIRQFNLLNGPANIQVA |
Ga0181362_10745162 | 3300017723 | Freshwater Lake | GSGGPGGNSITVNVNGGLATSADIGKAVVNSIRQFNLLNGPANIQVA |
Ga0181365_10950851 | 3300017736 | Freshwater Lake | TGPNAGAGISGGGGVTVNVTGGLATSAEIGQAVVNALRAYNRSAGPANIQVA |
Ga0181365_10999572 | 3300017736 | Freshwater Lake | GSGLTVNVTGGLATSSEIGQAIVNAIRAYNRSAGPANIQVA |
Ga0181365_11104062 | 3300017736 | Freshwater Lake | VTVNVTGGLSTSAEIGQAVVNALRAYNRSAGPANIQVA |
Ga0181365_11377692 | 3300017736 | Freshwater Lake | PNAGAGISGGGGVTVNVTGGLATSAEIGQAVVNAMRAYNRSAGPANIQVA |
Ga0181352_10808011 | 3300017747 | Freshwater Lake | AGPEAVVPLDRMNTGGGVTVNVTGGLSTSAEIGQAVVNALRAYSRSAGPLALNIA |
Ga0181352_11998301 | 3300017747 | Freshwater Lake | VVPLNKMGAMGGVTVNVNGGLATSAEIGQAVVNAIRAYNRSAGPANIQVA |
Ga0181356_11999692 | 3300017761 | Freshwater Lake | NVTGGLSTSAEIGQAVVNAIRAYNRSAGPAQIQVA |
Ga0181358_11338131 | 3300017774 | Freshwater Lake | GGGVTVNVTGGLATSSEIGQAVVNAIRAYNRSAGPAQIQVA |
Ga0181357_12343902 | 3300017777 | Freshwater Lake | GGGVTVNVTGGLATSIEIGQAIVNAIRAYNRSAGPANIQVA |
Ga0181346_10072061 | 3300017780 | Freshwater Lake | NVNGGLSTSADIGEAVVNALRAYNRSAGPLQLEIA |
Ga0181346_10433691 | 3300017780 | Freshwater Lake | TVNVTGGLATSAEIGQAVVNAIRAYNRSAGPAQIQVA |
Ga0181348_10061431 | 3300017784 | Freshwater Lake | EVTGGLATSSEIGQAIVNAIRAYNRSAGPANIQVA |
Ga0181348_10637342 | 3300017784 | Freshwater Lake | PLSQMGGMGGGVTVNVTGGLATRAEIGQAVVNAIRAYNRSAGPAQIQVA |
Ga0181348_11019682 | 3300017784 | Freshwater Lake | GGVTVNVTGGLSTSAEIGQAVVNAIRAYNRSAGPAQIQVA |
Ga0181348_11658872 | 3300017784 | Freshwater Lake | GMGGGVTVNVTGGLATSAEIGQAVVNTIRAYNRSAGPAQIQVA |
Ga0181348_11888552 | 3300017784 | Freshwater Lake | ALIGEKGPEAVVPLGRGGGMGNVTVNVTGGLSTSAEIGQAVVNAIRAYNRSAGPAQIQVA |
Ga0181355_11127042 | 3300017785 | Freshwater Lake | PLSQMGNMGGSGVTINVAGGLSTSAEIGQSVVNALRAYSRTAGPLQLNVA |
Ga0181355_11557292 | 3300017785 | Freshwater Lake | LTGPNAGAGMGAGGGVTVNVTGGLATSAEIGQAVVNALRAYNRSAGPANIQVA |
Ga0181355_12325532 | 3300017785 | Freshwater Lake | PGYGGPGGGVTVNVSGGISTSAEIGEAVVNAIRAYNRAAGPANIQVG |
Ga0181563_101571371 | 3300018420 | Salt Marsh | SGVGGITVNVNGGLSTSAEIGQAVVNAIRAYNRSAGPAQIQVA |
Ga0181359_11755681 | 3300019784 | Freshwater Lake | GPEAVVPLNQMGNMGGGITVNVTGGLATSAEIGQAVVNAIRAYNRSAGPAQIQVA |
Ga0181359_11784552 | 3300019784 | Freshwater Lake | GPEAVVPLSKMGGMGGGGDVNINVNGGMATSAEIGQSILNALRAYQRSAGPLNLNIA |
Ga0181359_12702951 | 3300019784 | Freshwater Lake | SGGGMGNVTVNVTGGLSTSAEIGQAVVNAIRAYNRSAGPAQIQVA |
Ga0194113_101760261 | 3300020074 | Freshwater Lake | NITINVTGGLATSAEIGQSVVNAIRAYNRSAGPAQIQVA |
Ga0211735_112092092 | 3300020162 | Freshwater | IGERGPEAVVPLNQMSNMGGGITVNVTGGLATSAEIGQAVVNAIRAYNRSAGPAQIQVA |
Ga0211729_107458811 | 3300020172 | Freshwater | LGKGIGGGGVTVNVTGGLSTSAEIGQAVVNALRAYNRSAGPANIQVA |
Ga0194121_102808161 | 3300020200 | Freshwater Lake | VPLKRAGNVGGVTVNVTGGLATGAEIGQAVVNAIRAYNRSTGPAQIQVA |
Ga0194132_105235482 | 3300020214 | Freshwater Lake | PLKRAGNVGGVTVNVTGGLATGAEIGQAVVNAIRAYNRSTGPAQIQVA |
Ga0208050_10155292 | 3300020498 | Freshwater | PEAVVPLDRLNNGGGVTINVTGGLATSAEIGESVVNALRAYSRSAGPLQLQVA |
Ga0208233_10224231 | 3300020529 | Freshwater | VNVNGGLSTSAEIGQAVVNSIRAYTRTAGPAQLDIAPL |
Ga0208856_10425212 | 3300020548 | Freshwater | RNQGGQNITVNITGGISTSADIGRAVVNAIKAMNRVDGPAQIQVA |
Ga0208360_10017821 | 3300020551 | Freshwater | VPLDRMGTGGGVTINVTGGLATSAEIGESVVNALRAYSRSAGPLALNIA |
Ga0208360_10020211 | 3300020551 | Freshwater | VPLDRMATGGGVTINVTGGLSTSAEIGQAVVNALRAYSRSAGPLALNIA |
Ga0207934_10180331 | 3300020561 | Freshwater | SVNVNGGLASSAEVGNAVVNAIRAFNRQNGPADIAVA |
Ga0214163_10389222 | 3300021141 | Freshwater | INVTGGLATSAEIGESVVNALRAYSRSAGPLQLQVA |
Ga0194041_100872121 | 3300021340 | Anoxic Zone Freshwater | GGTGGITVNVNGGFSTSAEIGQAVVNALRAFNRQQGAASIAVTGYA |
Ga0222713_102344432 | 3300021962 | Estuarine Water | VNVTGGLATSSEIGQAIVNAIRAYNRSAGPANIQVA |
Ga0222713_102566621 | 3300021962 | Estuarine Water | SEAVIPLDKLGKMGGGDIIINVTGGLATSAEIGESVVNALRAYSRSAGPLQLQVA |
Ga0222713_103226082 | 3300021962 | Estuarine Water | ITVNVNGGLATSADIGRAVVNSIKAMNRVDGPAQIQVA |
Ga0222712_105355602 | 3300021963 | Estuarine Water | ITVNVNGGLATSAEIGQAVVDSIRAYNRSAGPARIEVSGYV |
Ga0222719_102874092 | 3300021964 | Estuarine Water | TYNIPVNGGISNSADIGQAVVNAIRAYNRTSGPARISVA |
Ga0212030_10036862 | 3300022053 | Aqueous | IINVTGGLATSAEIGESVVNALRAYSRSAGPLQLQVA |
Ga0212030_10100662 | 3300022053 | Aqueous | NVTGGLSTSAEIGQAVVNAIRAYNRSAGPANIQVA |
Ga0212024_11007371 | 3300022065 | Aqueous | NVMGGLATSAEIGQAVVNAIRAYNRSAGPAQIAVA |
Ga0196889_10739331 | 3300022072 | Aqueous | YTINITGGLGSSAEIGTAVVNAIRAFNRQNGPANIAVA |
Ga0196903_10039941 | 3300022169 | Aqueous | GGGDVNINVNGGLATSAEIGQSVLNALRAYSRSAGPLALNIA |
Ga0181354_12218851 | 3300022190 | Freshwater Lake | SGAVTVNVSGGISTSAEIGEAVVNAIRAYNRAAGPANIAVV |
Ga0196905_10240701 | 3300022198 | Aqueous | GNAGLATSAEIGQAVVDSIRAYNRSAGPARIEVSGYV |
Ga0196905_11333402 | 3300022198 | Aqueous | IIPLSQYNRGGGDIHININGGLATSAEIGQAVLNSLRAYSRSAGPLELSIA |
Ga0196901_11065892 | 3300022200 | Aqueous | TYNITVNGGISNSADIGQAVVNAIRAYNRTSGPARISVA |
Ga0196901_11873632 | 3300022200 | Aqueous | GGGITINVTGGLATSAEIGESVVNALRAYSRSAGPLQLQVA |
Ga0196901_12758401 | 3300022200 | Aqueous | NVTGGLATSAEIGESVVNALRAYSRSAGPLQLQVA |
Ga0181351_11346651 | 3300022407 | Freshwater Lake | INVTGGLATSAEIGQAVVNALRAYNRSAGPANIQVA |
Ga0255752_100801443 | 3300022929 | Salt Marsh | NRNNGVGGITVNVNGGLSTSAEIGQAVVNAIRAYNRSAGPAQIQVA |
Ga0255147_10012611 | 3300024289 | Freshwater | NAMLDNITVNVNGGLATSAEIGQAVVDSIRAYNRSAGPARIEVSGYV |
Ga0244775_109036292 | 3300024346 | Estuarine | LSQLGGMGGGGVTVNVTGGLATSAEIGQAVVNAIRAYNRSAGPAQIQVA |
Ga0244775_111487812 | 3300024346 | Estuarine | FMVERGTPITVNVNGGLATSADIGRAVVNSIKAMNRVDGPAQIQVA |
Ga0244775_113143992 | 3300024346 | Estuarine | IPLSQLGSMNGGGVTVNVTGGLATSAEIGQAVVNAIRAYNRSAGPAQIQVA |
Ga0255165_10566311 | 3300024357 | Freshwater | RNAMLDNITVNVNGGLATSAEIGQAVVDSIRAYNRSAGPARIEVSGYV |
Ga0255185_10050574 | 3300024490 | Freshwater | VGGVTVNVTGGLSTSAEIGQAVVNAIRAYNRSAGPAQIQVA |
Ga0208426_10381342 | 3300025451 | Aqueous | GFGDMNINISGGIGTSAEIGEAVVNAIRAYNRAAGPANIAVA |
Ga0208546_100367611 | 3300025585 | Aqueous | GGLATSAEIGQAVVDSIRAYNRSAGPARIEVSGYV |
Ga0208795_10855371 | 3300025655 | Aqueous | NNGGGITINVTGGLATSAEIGESVVNALRAYSRSAGPLQLQVA |
Ga0208899_11135421 | 3300025759 | Aqueous | PLNRGMGAGSITVNVMGGLATSAEIGQAVVNAIRAYNRSAGPAQIAVA |
Ga0208917_10640452 | 3300025840 | Aqueous | NRGMGAGSITVNVMGGLATSAEIGQAVVNAIRAYNRSAGPAQIAVA |
Ga0208005_10609431 | 3300025848 | Aqueous | LENITVNVNGGLATSAEIGQAVVDSIRAYNRSAGPARIEVSGYV |
Ga0208644_10871331 | 3300025889 | Aqueous | REGGNLTVNVNGGLATSAEIGRAVVDAIKQYTNVSGPADIAVA |
Ga0208916_100363201 | 3300025896 | Aqueous | NRAGGFGGGLTINVTGGLSTSAEIGQAVVNAIRAYNRSAGPAQIQVA |
Ga0255188_10078081 | 3300027079 | Freshwater | NVTGGLATSAEIGQAVVNAIRAYNRSAGPAQIQVA |
Ga0255071_10058361 | 3300027127 | Freshwater | GGGVTVNVTGGLSTSAEIGQAVVNALRAYSRSAGPLALNIA |
Ga0255099_10114033 | 3300027128 | Freshwater | TVNVMGGLATSAEIGQAVVNAIRAYNRSAGPANIAVA |
Ga0255076_10358301 | 3300027141 | Freshwater | ITINVTGGLSTSAEIGESVVNALRAYSRSAGPLQLQVA |
Ga0255081_11026261 | 3300027155 | Freshwater | ITVNVTGGLATSAEIGQAVVNAIRAYNRSAGPANIQVA |
Ga0208921_10688802 | 3300027188 | Estuarine | NVTGGLATSAEIGESVVNALRAYSRSAGPLQIPVA |
Ga0208800_10046281 | 3300027193 | Estuarine | PEAIIPLSQLGGMGGGGVTVNVTGGLATSAEIGQAVVNAIRAYNRSAGPAQIQVA |
Ga0208800_10169391 | 3300027193 | Estuarine | GPGVTVNVQGGINTSAEIGEAVVNAIRAYNRAAGPANIQVG |
Ga0255084_10237351 | 3300027488 | Freshwater | TGGGVTVNVTGGLSTSAEIGQAVVNALRAYSRSAGPLALNIA |
Ga0255093_10623911 | 3300027492 | Freshwater | VPLNKMGAMGGVTVNVNGGLATSAEIGQAVVNAIRAYNRSAGPANIQVA |
Ga0255101_10241231 | 3300027588 | Freshwater | MNTGGGVTVNVTGGLSTSAEIGQAVVNALRAYSRSAGPLALNIA |
Ga0208974_11685191 | 3300027608 | Freshwater Lentic | EAVIPLNRLGGGGGITVNVMGGLATSAEIGQAVVNAIRAYNRSAGPANIAVA |
Ga0208133_10124204 | 3300027631 | Estuarine | SKMGGMGGGVTVNVTGGLATSAEIGQAVVNAIRAYNRSAGPAQIQVA |
Ga0209296_10844871 | 3300027759 | Freshwater Lake | RIASMTVNVNGGLSSSADIGEAVVNALRAYNRSAGPLQLEIA |
Ga0209134_101648362 | 3300027764 | Freshwater Lake | GGSGVTINVAGGLSTSAEIGQSVVNALRAYSRTAGPLQLNVA |
Ga0209229_103010141 | 3300027805 | Freshwater And Sediment | NVNGGLATSADIGRAVVNSIKAMNRVDGPAQIQVA |
Ga0209354_100500391 | 3300027808 | Freshwater Lake | GGGLTINVTGGLSTSAEIGQAVVNAIRAYNRSAGPAQIQVA |
Ga0209491_102181143 | 3300027832 | Freshwater | VTINVNGGLATSAEIGQSITNALRAYVRTNGPLQLAIA |
Ga0209820_10812552 | 3300027956 | Freshwater Sediment | GITVNVTGGLATGPEIGEAVVNAIRSFNTVHGPANIAVG |
Ga0209191_13287912 | 3300027969 | Freshwater Lake | MTVNVNGGLSSSADIGEAVVNALRAYNRSAGPLQLEIA |
Ga0209079_101980892 | 3300027972 | Freshwater Sediment | RMQSGGGITINVTGGLATSAEIGESVVNALRAYSRSAGPLQLQVA |
Ga0209702_101976342 | 3300027976 | Freshwater | PEAVVPLSQYNRGSGGSGVTINVNGGLATSAEIGQSITNALRAYVRTNGPLQLAIA |
Ga0255190_10090923 | 3300028083 | Freshwater | GRGGGMGNVTVNVTGGLSTSAEIGQAVVNAIRAYNRSAGPAQIQVA |
Ga0255184_10974002 | 3300028091 | Freshwater | TVNVTGGLATGPEIGEAVVNAIRAYNRTSGPAAIAVA |
Ga0307379_105940982 | 3300031565 | Soil | VIPLSKMGNMGGITVNINGGLSTSADIGRAVVDSIRSFNRANGPAAISVSGY |
Ga0307379_114566531 | 3300031565 | Soil | PEAIIPLSQYNRGGGDIHININGGLATSAEIGQAVLNSLRAYSRSAGPLELSIA |
Ga0307378_109608252 | 3300031566 | Soil | RMSTGGGITINVTGGLATSAEIGESVVNALRAYSRSAGPLQLQVA |
Ga0307378_115256952 | 3300031566 | Soil | VPLDRMQNGGGITINVTGGLATSAEIGESVVNALRAYSRSAGPLQLQVA |
Ga0307376_102205171 | 3300031578 | Soil | LDRMQNGGGITINVTGGLATSAEIGESVVNALRAYSRSAGPLQLQVA |
Ga0307377_105396402 | 3300031673 | Soil | GQSEAVIPLDKLGKMGGGNITINVTGGLATSAEIGESVVNALRAYSRSAGPLQLQVA |
Ga0307377_108340531 | 3300031673 | Soil | LDRMSTGGGITINVTGGLATSAEIGESVVNALRAYSRSAGPLQLQVA |
Ga0307377_109313651 | 3300031673 | Soil | LAMIGERGPEAVVPLNRASGVGGVTVNVTGGLATSAEIGQAVVNSIRAYNRSAGPAQIQV |
Ga0315291_105644092 | 3300031707 | Sediment | VTVNVTGGLATSAEIGQAVVNAIRAYNRSAGPAQIQVA |
Ga0315288_111294472 | 3300031772 | Sediment | GVTVNVSGGISTSAEIGEAVVNAIRAYNRAAGPANIAVA |
Ga0315909_108060652 | 3300031857 | Freshwater | PEAVVPLDRMQTGGGITINVTGGLATSAEIGESVVNALRAYSRSAGPLQLQVA |
Ga0315294_114285741 | 3300031952 | Sediment | RGTPITVNVNGGLATSADIGRAVVNSIKAMNRVDGPAQIQVA |
Ga0315274_103063441 | 3300031999 | Sediment | QMGNMGGGITVNVTGGLATSAEIGQAVVNAIRAYNRSAGPAQIQVA |
Ga0315274_112299392 | 3300031999 | Sediment | GTPITVNVNGGLATSADIGRAVVNSIKAMNRVDGPAQIQVA |
Ga0315284_105829021 | 3300032053 | Sediment | NVTGGLSTSAEIGQSVVNALRAYSRTAGPLQLNVA |
Ga0315284_117785182 | 3300032053 | Sediment | GPEAIIPLSQMGGMGGGLTVNVTGGLSTSAEIGQAVVNAIRAYNRSAGPAQIQVA |
Ga0315276_104488111 | 3300032177 | Sediment | GGGLTVNVTGGLATSSEIGQAIVNAIRAYNRSAGPANIQVA |
Ga0335396_107021182 | 3300032462 | Freshwater | SQYNRGNGGSGVTINVNGGLATSAEIGQSITNALRAYVRTNGPLQLAIA |
Ga0335396_108887011 | 3300032462 | Freshwater | EAVVPLSQYNRGSGGSGVTINVNGGLATSAEIGQSITNALRAYVRTNGPLQLAIA |
Ga0315273_128313711 | 3300032516 | Sediment | INITGGISTSAEIGESVVNAIRAYNRAAGPANIQVG |
Ga0334722_102528391 | 3300033233 | Sediment | ERGPEAVVPLNQMGNMGGGITVNVTGGLATSAEIGQAVVNAIRAYNRSAGPAQIQVA |
Ga0334722_110000222 | 3300033233 | Sediment | SGPNAGNFGGGGVTVNVTGGLATSSEIGQAIVNAIRAYNRSAGPANIQVA |
Ga0334982_0138456_2_142 | 3300033981 | Freshwater | MKNGGGQNITVNITGGISTSADIGRAVVNAIKAMNRVDGPAQIQVA |
Ga0334982_0539527_236_418 | 3300033981 | Freshwater | MIGERGPEAVVPLSKMGGMGGGVTVNVTGGLATSAEIGQAVVNAIRAYNRSAGPAQIQVA |
Ga0334982_0551978_3_113 | 3300033981 | Freshwater | VNVTGGLATSAEVGQAVVNSIRAYNRSAGPANIQVG |
Ga0334994_0300003_74_211 | 3300033993 | Freshwater | MNSGGGDVNINVTGGLATSAEIGQSVVNALRAYSRSAGPLALNIA |
Ga0334994_0584957_7_144 | 3300033993 | Freshwater | MVERGTPITVNVNGGLATSADIGRAVVNSIKAMNRVDGPAQIQVA |
Ga0334979_0713111_368_505 | 3300033996 | Freshwater | MLENITVNVNGGLATSAEIGQAVVDSIRAYNRSAGPARIEVSGYV |
Ga0334979_0725153_350_517 | 3300033996 | Freshwater | KGPEAVVPLGRGGGMGNVTVNVTGGLSTSAEIGQAVVNAIRAYNRSAGPAQIQVA |
Ga0334986_0575656_375_539 | 3300034012 | Freshwater | PEAVVPLSKMGGMGGGVTVNVTGGLATSAEIGQAVVNAIRAYNRSAGPAQIQVA |
Ga0334986_0579225_375_536 | 3300034012 | Freshwater | PEAVVPLDRMNTGGGVTVNVTGGLSTSAEIGQAVVNALRAYSRSAGPLALNIA |
Ga0335002_0156626_1344_1466 | 3300034020 | Freshwater | GGVTINVTGGLSTSAEIGQAVVNALRAYSRSAGPLALNIA |
Ga0335004_0135902_1471_1602 | 3300034021 | Freshwater | ERGTPITVNVNGGLATSADIGRAVVNSIKAMNRVDGPAQIQVA |
Ga0334987_0299070_3_113 | 3300034061 | Freshwater | VNITGGISTSADIGRAVVNAIKAMNRVDGPAQIQVA |
Ga0334995_0037863_29_151 | 3300034062 | Freshwater | MGFTINVNGGLATSAEIGNAVVDAIKQYTNVSGPADIAIR |
Ga0334995_0059101_2902_3078 | 3300034062 | Freshwater | EAGPEAVIPLSQMGNMGGSGVTINVAGGLSTSAEIGQSVVNALRAYSRTAGPLQLNVA |
Ga0334995_0356651_1_159 | 3300034062 | Freshwater | VIPLSQMSNMGGSGVTINVAGGLSTSAEIGQSVVNALRAYSRTAGPLQLNVA |
Ga0334995_0359290_768_926 | 3300034062 | Freshwater | VIPLSQMGNMGGSGVTINVAGGLSTSAEIGQSVVNALRAYSRTAGPLQLNVA |
Ga0334995_0700701_463_570 | 3300034062 | Freshwater | NVAGGLSTSAEIGQSVVNALRAYSRTAGPLQLNVA |
Ga0335001_0632402_350_532 | 3300034064 | Freshwater | MIGERGPEAVVPLNRAGGFGGGLTVNVTGGLSTSAEIGQAVVNAIRAYNRSAGPAQIQVA |
Ga0335019_0324306_845_958 | 3300034066 | Freshwater | TINVTGGLATSAEIGQSVVNALRAYSRSAGPLALNIA |
Ga0335019_0630931_2_151 | 3300034066 | Freshwater | PLSKMGGMGGGVTVNVTGGLATSAEIGQAVVNAIRAYNRSAGPAQIQVA |
Ga0310127_095065_29_166 | 3300034072 | Fracking Water | MLENITVNVNGGLATSAEIGQAVVDSIRAYNRSAGPARIEVSGYI |
Ga0310130_0007020_4092_4214 | 3300034073 | Fracking Water | TEITVNINGGLATSAEIGEAVVNSIRSFNTVNGPADILVG |
Ga0310130_0033788_1_123 | 3300034073 | Fracking Water | GGVTINVTGGLATSAEIGESVVNALRAYSRSAGPLALNIA |
Ga0310130_0179194_61_177 | 3300034073 | Fracking Water | VTVNVTGGLATSAEIGQAVINAIRAYNRTGGPANIQVA |
Ga0335010_0223169_2_121 | 3300034092 | Freshwater | PITVNVNGGLATSADIGRAVVNSIKAMNRVDGPAQIQVA |
Ga0335022_0157562_1234_1398 | 3300034095 | Freshwater | PEAVVPLNRAGGFGGGLTVNVTGGLSTSAEIGQAVVNAIRAYNRSAGPAQIQVA |
Ga0335027_0107841_1999_2109 | 3300034101 | Freshwater | NGGLATSAEIGQAVVDSIRAYNRSAGPARIEVSGYV |
Ga0335031_0170697_1350_1487 | 3300034104 | Freshwater | MVERSTPITVNVNGGLATSADIGRAVVNSIKAMNRVDGPAQIQVA |
Ga0335031_0758412_423_548 | 3300034104 | Freshwater | GGDVNINVNGGLATSAEIGQTVLNALRAYQRSAGPLNLNIA |
Ga0335036_0363629_808_939 | 3300034106 | Freshwater | QGGQNITVNITGGISTSADIGRAVVNAIKAMNRVDGPAQIQVA |
Ga0335036_0686496_478_606 | 3300034106 | Freshwater | TGGGVTINVTGGLATSAEIGESVVNALRAYSRSAGPLALNIA |
Ga0335036_0725236_3_116 | 3300034106 | Freshwater | NINVTGGLATSAEIGQSVVNALRAYSRSAGPLALNIA |
Ga0335036_0734908_454_579 | 3300034106 | Freshwater | GSGVTINVAGGLSTSAEIGQSVVNALRAYSRTAGPLQLNVA |
Ga0335066_0099447_3_122 | 3300034112 | Freshwater | GLTVNVQGGINTSAEIGEAVVNAIRAYNRAAGPANIAVG |
Ga0335066_0380214_1_165 | 3300034112 | Freshwater | GPEAVVPLDRMNTGGGVTINVTGGLATSAEIGESVVNALRAYSRSAGPLQLQVA |
Ga0335054_0021620_2_166 | 3300034119 | Freshwater | GPEAVIPLDRMNTGGGVTVNVTGGLSTSAEIGQAVVNALRAYSRSAGPLALNIA |
Ga0335056_0154177_1_111 | 3300034120 | Freshwater | INITGGISTSAEIGESVVNAIRAYNRAAGPANIAVS |
Ga0335058_0171156_1_135 | 3300034121 | Freshwater | NNGGQNITVNITGGISTSADIGRAVVNAIKAMNRVDGPAQIQVA |
Ga0335060_0105669_2_154 | 3300034122 | Freshwater | VIPLNRLGGGGGITVNVMGGLATSAEIGQAVVNAIRAYNRSAGPANIAVA |
Ga0335060_0339108_648_809 | 3300034122 | Freshwater | AVIPLSQMGNMGGSGVTINVAGGLSTSAEIGQSVVNALRAYSRTAGPLQLNVA |
Ga0335016_0248388_984_1121 | 3300034166 | Freshwater | KNNGGQNITVNITGGISTSADIGRAVVNAIKAMNRVDGPAQIQVA |
Ga0335065_0653265_482_607 | 3300034200 | Freshwater | GGDVNINVNGGMATSAEIGQSILNALRAYQRSAGPLNLNIA |
Ga0335065_0845789_5_145 | 3300034200 | Freshwater | MKNNGGQNITVNITGGISTSADIGRAVVNAIKAMNRVDGPAQIQVA |
Ga0334997_0226595_1110_1220 | 3300034280 | Freshwater | INVTGGLSTSAEIGQSVVNALRAYSRSAGPLALNIA |
Ga0335007_0580214_503_646 | 3300034283 | Freshwater | MGGMGGGGDININVNGGMATSAEIGQSILNALRAYQRSAGPLNLNIA |
Ga0335007_0693927_431_571 | 3300034283 | Freshwater | MGNMGGSGVTINVAGGLSTSAEIGQSVVNALRAYSRTAGPLQLNVA |
Ga0335013_0809604_334_474 | 3300034284 | Freshwater | MKNGNGQNITVNITGGISTSADIGRAVVNAIKAMNRVDGPAQIQVA |
Ga0335048_0421775_1_147 | 3300034356 | Freshwater | QMGNMGNGGGVTINVTGGLATSAEIGQSVVNALRAYSRTAGPLQLQVA |
⦗Top⦘ |