| Basic Information | |
|---|---|
| Family ID | F015148 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 257 |
| Average Sequence Length | 39 residues |
| Representative Sequence | MDWYSPPEYKEYECTECGAEIDKPGVCSGTCHEASMI |
| Number of Associated Samples | 156 |
| Number of Associated Scaffolds | 257 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 14.01 % |
| % of genes from short scaffolds (< 2000 bps) | 73.15 % |
| Associated GOLD sequencing projects | 123 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.24 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (73.541 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous (17.121 % of family members) |
| Environment Ontology (ENVO) | Unclassified (81.323 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (79.377 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 9.23% β-sheet: 6.15% Coil/Unstructured: 84.62% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.24 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 257 Family Scaffolds |
|---|---|---|
| PF04466 | Terminase_3 | 25.68 |
| PF08291 | Peptidase_M15_3 | 1.17 |
| PF02739 | 5_3_exonuc_N | 1.17 |
| PF13481 | AAA_25 | 0.78 |
| PF14550 | Peptidase_S78_2 | 0.78 |
| PF02195 | ParBc | 0.78 |
| PF00145 | DNA_methylase | 0.39 |
| PF01555 | N6_N4_Mtase | 0.39 |
| PF05766 | NinG | 0.39 |
| PF03237 | Terminase_6N | 0.39 |
| PF13385 | Laminin_G_3 | 0.39 |
| PF02086 | MethyltransfD12 | 0.39 |
| PF12518 | DUF3721 | 0.39 |
| PF08299 | Bac_DnaA_C | 0.39 |
| COG ID | Name | Functional Category | % Frequency in 257 Family Scaffolds |
|---|---|---|---|
| COG1783 | Phage terminase large subunit | Mobilome: prophages, transposons [X] | 25.68 |
| COG0258 | 5'-3' exonuclease Xni/ExoIX (flap endonuclease) | Replication, recombination and repair [L] | 1.17 |
| COG0270 | DNA-cytosine methylase | Replication, recombination and repair [L] | 0.39 |
| COG0338 | DNA-adenine methylase | Replication, recombination and repair [L] | 0.39 |
| COG0593 | Chromosomal replication initiation ATPase DnaA | Replication, recombination and repair [L] | 0.39 |
| COG0863 | DNA modification methylase | Replication, recombination and repair [L] | 0.39 |
| COG1041 | tRNA G10 N-methylase Trm11 | Translation, ribosomal structure and biogenesis [J] | 0.39 |
| COG2189 | Adenine specific DNA methylase Mod | Replication, recombination and repair [L] | 0.39 |
| COG3392 | Adenine-specific DNA methylase | Replication, recombination and repair [L] | 0.39 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 73.54 % |
| All Organisms | root | All Organisms | 26.46 % |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 17.12% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 10.12% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 9.73% |
| Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 9.34% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 7.78% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 6.61% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 4.28% |
| Deep Ocean | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean | 3.50% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 3.50% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 3.50% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 3.50% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 2.72% |
| Saline Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water | 2.33% |
| Marine | Environmental → Aquatic → Marine → Coastal → Sediment → Marine | 1.95% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 1.95% |
| Marine Sediment | Environmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment | 1.17% |
| Sackhole Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine | 1.17% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 1.17% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 1.17% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 0.78% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine | 0.78% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.78% |
| Saline Lake | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake | 0.78% |
| Lake Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Lake Water | 0.78% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 0.39% |
| Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 0.39% |
| Marine | Environmental → Aquatic → Marine → Coastal → Sediment → Marine | 0.39% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.39% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.39% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 0.39% |
| Freshwater And Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Freshwater And Marine | 0.39% |
| Coastal Water And Sediment | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Coastal Water And Sediment | 0.39% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 0.39% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2100351011 | Marine sediment microbial communities from Arctic Ocean, off the coast from Alaska - sample from medium methane PC12-240-170cm | Environmental | Open in IMG/M |
| 3300000101 | Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010 | Environmental | Open in IMG/M |
| 3300000115 | Marine microbial communities from Delaware Coast, sample from Delaware MO Summer July 2011 | Environmental | Open in IMG/M |
| 3300000116 | Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010 | Environmental | Open in IMG/M |
| 3300000121 | Marine microbial communities from chronically polluted sediments in Tierra del Fuego - site MC sample ARG 03_11.3m | Environmental | Open in IMG/M |
| 3300000929 | Marine plume microbial communities from the Columbia River - 15 PSU | Environmental | Open in IMG/M |
| 3300001344 | Pelagic Microbial community sample from North Sea - COGITO 998_met_02 | Environmental | Open in IMG/M |
| 3300001347 | Pelagic Microbial community sample from North Sea - COGITO 998_met_06 | Environmental | Open in IMG/M |
| 3300001351 | Pelagic Microbial community sample from North Sea - COGITO 998_met_03 | Environmental | Open in IMG/M |
| 3300001460 | Marine viral communities from the Pacific Ocean - LP-28 | Environmental | Open in IMG/M |
| 3300001472 | Marine viral communities from the Pacific Ocean - LP-32 | Environmental | Open in IMG/M |
| 3300001589 | Marine viral communities from the Pacific Ocean - LP-40 | Environmental | Open in IMG/M |
| 3300004279 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI075_LV_DNA_10m | Environmental | Open in IMG/M |
| 3300004448 | Marine viral communities from Newfoundland, Canada BC-1 | Environmental | Open in IMG/M |
| 3300005589 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd47.2 | Environmental | Open in IMG/M |
| 3300005609 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd00.1 | Environmental | Open in IMG/M |
| 3300005936 | Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UKS | Environmental | Open in IMG/M |
| 3300005939 | Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UKX | Environmental | Open in IMG/M |
| 3300006029 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006165 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG006-DNA | Environmental | Open in IMG/M |
| 3300006190 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG058-DNA | Environmental | Open in IMG/M |
| 3300006191 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG104-DNA | Environmental | Open in IMG/M |
| 3300006193 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG029-DNA | Environmental | Open in IMG/M |
| 3300006352 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG108-DNA | Environmental | Open in IMG/M |
| 3300006467 | Coastal sediment microbial communities from Rhode Island, USA: Combined Assembly of Gp0121717, Gp0123912, Gp0123935 | Environmental | Open in IMG/M |
| 3300006484 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 | Environmental | Open in IMG/M |
| 3300006752 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006803 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 | Environmental | Open in IMG/M |
| 3300006920 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 | Environmental | Open in IMG/M |
| 3300006947 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG017-DNA | Environmental | Open in IMG/M |
| 3300007229 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007276 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 | Environmental | Open in IMG/M |
| 3300007538 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007540 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007972 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460ABC_3.0um | Environmental | Open in IMG/M |
| 3300009002 | Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.573 | Environmental | Open in IMG/M |
| 3300009026 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575 | Environmental | Open in IMG/M |
| 3300009074 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100430 | Environmental | Open in IMG/M |
| 3300009076 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100511 | Environmental | Open in IMG/M |
| 3300009149 | Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG | Environmental | Open in IMG/M |
| 3300009172 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154 | Environmental | Open in IMG/M |
| 3300009426 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100420 | Environmental | Open in IMG/M |
| 3300009428 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_55 | Environmental | Open in IMG/M |
| 3300009434 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110516 | Environmental | Open in IMG/M |
| 3300009436 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M Metagenome | Environmental | Open in IMG/M |
| 3300009440 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110512 | Environmental | Open in IMG/M |
| 3300009441 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M Metagenome | Environmental | Open in IMG/M |
| 3300009467 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110530 | Environmental | Open in IMG/M |
| 3300009495 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120531 | Environmental | Open in IMG/M |
| 3300009507 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607 | Environmental | Open in IMG/M |
| 3300009512 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_88 | Environmental | Open in IMG/M |
| 3300009599 | Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M1_3um Metatranscriptome (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009606 | Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M2_3um Metatranscriptome (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009785 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130 | Environmental | Open in IMG/M |
| 3300010150 | Marine viral communities from the Subarctic Pacific Ocean - 17B_ETSP_OMZ_AT15314_CsCl metaG | Environmental | Open in IMG/M |
| 3300010392 | Coastal sediment microbial communities from Rhode Island, USA. Combined Assembly of Gp0121717, Gp0123912, Gp0123935, Gp0139423, Gp0139424, Gp0139388, Gp0139387, Gp0139386, Gp0139385 | Environmental | Open in IMG/M |
| 3300010883 | western Arctic Ocean co-assembly | Environmental | Open in IMG/M |
| 3300011126 | Marine sediment microbial communities from Japan Sea near Toyama Prefecture, Japan - 2015_1, 0.02 | Environmental | Open in IMG/M |
| 3300011128 | Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2014_2, 0.02 | Environmental | Open in IMG/M |
| 3300011129 | Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2014_4, 0.02 | Environmental | Open in IMG/M |
| 3300011253 | Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2014_2, permeate | Environmental | Open in IMG/M |
| 3300012522 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017714 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 35 SPOT_SRF_2012-08-15 | Environmental | Open in IMG/M |
| 3300017719 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21 | Environmental | Open in IMG/M |
| 3300017724 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 11 SPOT_SRF_2010-05-17 | Environmental | Open in IMG/M |
| 3300017725 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 21 SPOT_SRF_2011-04-29 | Environmental | Open in IMG/M |
| 3300017752 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 23 SPOT_SRF_2011-06-22 | Environmental | Open in IMG/M |
| 3300017758 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 32 SPOT_SRF_2012-05-30 | Environmental | Open in IMG/M |
| 3300017770 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15 (version 2) | Environmental | Open in IMG/M |
| 3300017773 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 9 SPOT_SRF_2010-03-24 | Environmental | Open in IMG/M |
| 3300020166 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160426_1 | Environmental | Open in IMG/M |
| 3300020169 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160419_1 | Environmental | Open in IMG/M |
| 3300020185 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160517_1 | Environmental | Open in IMG/M |
| 3300020187 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160512_1 | Environmental | Open in IMG/M |
| 3300020253 | Marine microbial communities from Tara Oceans - TARA_B100000780 (ERX555982-ERR598945) | Environmental | Open in IMG/M |
| 3300020335 | Marine microbial communities from Tara Oceans - TARA_B100000768 (ERX556030-ERR599035) | Environmental | Open in IMG/M |
| 3300020347 | Marine microbial communities from Tara Oceans - TARA_B100000497 (ERX556109-ERR598994) | Environmental | Open in IMG/M |
| 3300020382 | Marine microbial communities from Tara Oceans - TARA_B100000780 (ERX556058-ERR599059) | Environmental | Open in IMG/M |
| 3300020595 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160412_1 | Environmental | Open in IMG/M |
| 3300021085 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 30m 12015 | Environmental | Open in IMG/M |
| 3300021185 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 40m 12015 | Environmental | Open in IMG/M |
| 3300021375 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO132 | Environmental | Open in IMG/M |
| 3300021378 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO131 | Environmental | Open in IMG/M |
| 3300021442 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 200m 12015 | Environmental | Open in IMG/M |
| 3300021957 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18D | Environmental | Open in IMG/M |
| 3300022053 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (v2) | Environmental | Open in IMG/M |
| 3300022061 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (v2) | Environmental | Open in IMG/M |
| 3300022072 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (v3) | Environmental | Open in IMG/M |
| 3300022164 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (v2) | Environmental | Open in IMG/M |
| 3300022169 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022178 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (v3) | Environmental | Open in IMG/M |
| 3300022200 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022848 | Saline water microbial communities from Ace Lake, Antarctica - #866 | Environmental | Open in IMG/M |
| 3300022851 | Saline water microbial communities from Ace Lake, Antarctica - #1237 | Environmental | Open in IMG/M |
| 3300022857 | Saline water microbial communities from Ace Lake, Antarctica - #419 | Environmental | Open in IMG/M |
| 3300023085 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_oxic_5_MG | Environmental | Open in IMG/M |
| 3300023112 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_2_MG | Environmental | Open in IMG/M |
| 3300023210 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_4_MG | Environmental | Open in IMG/M |
| 3300023229 | Saline water microbial communities from Ace Lake, Antarctica - #551 | Environmental | Open in IMG/M |
| 3300023236 | Saline water microbial communities from Ace Lake, Antarctica - #547 | Environmental | Open in IMG/M |
| 3300023245 | Saline water microbial communities from Ace Lake, Antarctica - #423 | Environmental | Open in IMG/M |
| 3300023271 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_oxic_1_MG | Environmental | Open in IMG/M |
| 3300023276 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_1_MG | Environmental | Open in IMG/M |
| 3300024338 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_9 | Environmental | Open in IMG/M |
| 3300024518 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_2 | Environmental | Open in IMG/M |
| 3300024520 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_1 | Environmental | Open in IMG/M |
| 3300025120 | Marine viral communities from the Pacific Ocean - LP-28 (SPAdes) | Environmental | Open in IMG/M |
| 3300025137 | Marine viral communities from the Pacific Ocean - LP-32 (SPAdes) | Environmental | Open in IMG/M |
| 3300025138 | Marine viral communities from the Pacific Ocean - LP-40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025237 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_38 (SPAdes) | Environmental | Open in IMG/M |
| 3300025266 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_66 (SPAdes) | Environmental | Open in IMG/M |
| 3300025276 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_55 (SPAdes) | Environmental | Open in IMG/M |
| 3300025483 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - Saanich Inlet SI074_LV_120m_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025508 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025543 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025570 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025577 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100423 (SPAdes) | Environmental | Open in IMG/M |
| 3300025590 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100420 (SPAdes) | Environmental | Open in IMG/M |
| 3300025594 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100430 (SPAdes) | Environmental | Open in IMG/M |
| 3300025620 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110516 (SPAdes) | Environmental | Open in IMG/M |
| 3300025621 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100511 (SPAdes) | Environmental | Open in IMG/M |
| 3300025632 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100413 (SPAdes) | Environmental | Open in IMG/M |
| 3300025645 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (SPAdes) | Environmental | Open in IMG/M |
| 3300025652 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (SPAdes) | Environmental | Open in IMG/M |
| 3300025654 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110509 (SPAdes) | Environmental | Open in IMG/M |
| 3300025661 | Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UKS (SPAdes) | Environmental | Open in IMG/M |
| 3300025698 | Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UKX (SPAdes) | Environmental | Open in IMG/M |
| 3300025704 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120524 (SPAdes) | Environmental | Open in IMG/M |
| 3300025849 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607 (SPAdes) | Environmental | Open in IMG/M |
| 3300025876 | Pelagic Microbial community sample from North Sea - COGITO 998_met_06 (SPAdes) | Environmental | Open in IMG/M |
| 3300027320 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575 (SPAdes) | Environmental | Open in IMG/M |
| 3300027413 | Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - CAN11_54_BLW_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300027506 | Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - CAN11_66_BLW_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300027522 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG058-DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027668 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG104-DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027672 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG029-DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027758 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd00.1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027780 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_90 (SPAdes) | Environmental | Open in IMG/M |
| 3300027788 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_88 (SPAdes) | Environmental | Open in IMG/M |
| 3300027791 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130 (SPAdes) | Environmental | Open in IMG/M |
| 3300027810 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M Metagenome (SPAdes) | Environmental | Open in IMG/M |
| 3300027833 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M Metagenome (SPAdes) | Environmental | Open in IMG/M |
| 3300027996 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_6_MG | Environmental | Open in IMG/M |
| 3300028045 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_10_MG | Environmental | Open in IMG/M |
| 3300028197 | Marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2015_P26_10m | Environmental | Open in IMG/M |
| 3300031167 | Marine microbial communities from water near the shore, Antarctic Ocean - #418 | Environmental | Open in IMG/M |
| 3300031519 | Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 0.2 | Environmental | Open in IMG/M |
| 3300031569 | Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 1.2 | Environmental | Open in IMG/M |
| 3300031578 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-2 | Environmental | Open in IMG/M |
| 3300031589 | Marine microbial communities from David Island wharf, Antarctic Ocean - #35 | Environmental | Open in IMG/M |
| 3300031628 | Marine microbial communities from water near the shore, Antarctic Ocean - #229 | Environmental | Open in IMG/M |
| 3300031645 | Marine microbial communities from Ellis Fjord, Antarctic Ocean - #129 | Environmental | Open in IMG/M |
| 3300031658 | Marine microbial communities from Ellis Fjord, Antarctic Ocean - #78 | Environmental | Open in IMG/M |
| 3300031687 | Marine microbial communities from water near the shore, Antarctic Ocean - #125 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| ASMM170b_02818690 | 2100351011 | Coastal Water And Sediment | MVNLKQNIMDWYSTPDYPEYECPVCGDTTENEGVCSNTCFEADMM |
| DelMOSum2010_1000277631 | 3300000101 | Marine | MDWYSTPEYPEYECTECGADIDKPGVCSGTCHEASMI* |
| DelMOSum2010_100559905 | 3300000101 | Marine | MDWYSPPEYKDYECTECGADIDHEGVCSGACHEASMI* |
| DelMOSum2010_100942091 | 3300000101 | Marine | MDWYSPPDYPEYECTECGAEIEKAGVCSGTCHEASMI* |
| DelMOSum2010_101348013 | 3300000101 | Marine | MNWYSPPEYKDYECTECGADIDKPGVCSGTCHEASMI* |
| DelMOSum2010_101420632 | 3300000101 | Marine | MDWYSPPEYKEYECTECGAEIEREGVCSGTCHEASMI* |
| DelMOSum2010_101595656 | 3300000101 | Marine | MNWYETPDYPEYECTECGADIDKPGVCSGTCHEASMI* |
| DelMOSum2010_101983655 | 3300000101 | Marine | MDWYSTPDYPEYECTECGADIDKPGVCSGTCHEASMI* |
| DelMOSum2011_100314531 | 3300000115 | Marine | MDWYSPPEYKEYECTECGADIDHEGVCSGTCHEASML* |
| DelMOSum2011_101471903 | 3300000115 | Marine | MNWYETPDYPEYECTECGADIDKPGVCXGTCHXASML* |
| DelMOSpr2010_100848001 | 3300000116 | Marine | MDWYSTPEYAEYECTECGAEISKPGVCSGTCHEASMI* |
| DelMOSpr2010_102043313 | 3300000116 | Marine | MVNLKQNIMDWYSTPDYPDYECTECGADIDKPGVCSGTCHEASMI* |
| TDF_OR_ARG04_113mDRAFT_10022472 | 3300000121 | Marine | MDWYSPPEYKDYECTECGAEIDNPGVCSGACHEASMI* |
| TDF_OR_ARG04_113mDRAFT_10079592 | 3300000121 | Marine | MDWYSPPEYKDYECTECGAEIDNPGVCSGTCHEASMI* |
| NpDRAFT_100956691 | 3300000929 | Freshwater And Marine | MDWYSPPEYKDYECTECGAEIDSPGVCSGTCHEASML* |
| JGI20152J14361_100620164 | 3300001344 | Pelagic Marine | MDWYSPPEYKEYECTECGAEIEKPGVCSGTCHEASMI* |
| JGI20156J14371_100376002 | 3300001347 | Pelagic Marine | MDWYSPPEYKEYECTECGAEIDHEGVCSGTCHEASMI* |
| JGI20156J14371_100588542 | 3300001347 | Pelagic Marine | MDWYSPPEYKDYECTECGAEIDSPGVCSGTCHEASMI* |
| JGI20156J14371_101164481 | 3300001347 | Pelagic Marine | MVNLKQNIMDWYSPPEYKDYECTECGADIDHEGVCSGTCHEASMI* |
| JGI20153J14318_100883651 | 3300001351 | Pelagic Marine | MDWYSTPDYPEYECTECGADIDKPGVCSGTCHXASMI* |
| JGI20153J14318_101203571 | 3300001351 | Pelagic Marine | MDWYSPPEYKEYECTECGADIEKPGVCSGTCHEASMI* |
| JGI24003J15210_101477282 | 3300001460 | Marine | MVNLKQNIMDWYNPPEYKEYECTECGEEIDKPGVCSGTCHEASMI* |
| JGI24004J15324_100051526 | 3300001472 | Marine | MDWYNPPEYKEYECTECGEEIDKPGVCSGTCHEASMI* |
| JGI24005J15628_100021283 | 3300001589 | Marine | MDWYNAPEYKEYECSECGEEIDSPGVCSGTCHEASML* |
| Ga0066605_101137982 | 3300004279 | Marine | MVNLKQNIMDWYSPPDYPEYECTECGAEIEKAGVCSGTCHEASMI* |
| Ga0065861_10318462 | 3300004448 | Marine | MVNLKQNIMDWYSPPEYKDYECTECGADIDKPGVCSGTCHEASMI* |
| Ga0070729_107052693 | 3300005589 | Marine Sediment | MDWYSPPEYAEYECTECGAEIEKAGVCSGTCHEASMI* |
| Ga0070724_101974422 | 3300005609 | Marine Sediment | MDWYSPPEYPEYECTECGADIDKPGVCSGTCHEASMI* |
| Ga0075124_101374274 | 3300005936 | Lake Water | MVNLKQNIMDWYSPPEYKDYECTECGAEIDHEGVCSGTCHEASMI* |
| Ga0075123_100433505 | 3300005939 | Saline Lake | MDWYSPPEYKDYECTECGTEIDKPGVCSGTCHEASMI* |
| Ga0075466_100530011 | 3300006029 | Aqueous | MDWYSPPEYKEYECTECGADIDSPGVCSGTCHEASMI* |
| Ga0075466_10591315 | 3300006029 | Aqueous | MDWYSTPDYPEYECTECGADIDKPGVCSGTCHEASML* |
| Ga0075466_10968801 | 3300006029 | Aqueous | MDWYSPPEYKEYECTECGADIDKPGVCSGTCHEASMI* |
| Ga0075466_11015933 | 3300006029 | Aqueous | MDWYSTPDYPEYECPVCGDTTEKEGVCSNTCFEADMM* |
| Ga0075466_11157041 | 3300006029 | Aqueous | MVNLKQNIMDWYSTPDYPEYECTECGADIDKPGVCSGTCHEASMI* |
| Ga0075443_100689014 | 3300006165 | Marine | MDWYSQEEHKEYECTECGTEIDKPGVCSGACHEASMI* |
| Ga0075446_100502431 | 3300006190 | Marine | MDWYSPEEYKEYECTECGTEIDKAGVCSRACHEASMI* |
| Ga0075446_100722072 | 3300006190 | Marine | MDWYSPEEYKEYECTECGTEIDKAGVCSRACHDASMI* |
| Ga0075447_102321671 | 3300006191 | Marine | MVNLKQNIMDWYSPEEYKEYECTECGTEIDKAGVCSRACHEASMI* |
| Ga0075447_102615523 | 3300006191 | Marine | MDWYSPEEYKEYECTECGTEIDKPGVCSGACHEASMI* |
| Ga0075445_100827123 | 3300006193 | Marine | MDWYSPEEHKEYECTECGTEIDKPGVCSGACHEASMI* |
| Ga0075445_101294972 | 3300006193 | Marine | MVNLKQNIMDWYNPEEHKEYECTECGTEIDKPGVCSGACHEASMI* |
| Ga0075445_103269084 | 3300006193 | Marine | MVNLKQNIMDWYSPPEYKDYECTECGTEIDHEGVCSGACHEASMI* |
| Ga0075448_102071281 | 3300006352 | Marine | MVNLKQNIMDWYNPEEYKDYECTECGTEIDKPGVCSGACHEASMI* |
| Ga0099972_129156092 | 3300006467 | Marine | MDWYETPDYPEYECTECGADIDHEGVCSGTCHEASLI* |
| Ga0099972_131827091 | 3300006467 | Marine | MDWYSTPDYPEYECTECGAEIEKAGVCSGTCHEASMI* |
| Ga0070744_101170553 | 3300006484 | Estuarine | MVNLKQNIMDWYSTPEYPEYECTECGADIDKPGVCSGTCHEASMI* |
| Ga0098048_10107932 | 3300006752 | Marine | MDWYSPPEYKDYECTECGTEIDHEGVCSGACHEASMI* |
| Ga0070749_102142351 | 3300006802 | Aqueous | MDWYSPPEYKEYECTECGADIDHEGVCSGTCHEASMI* |
| Ga0075467_101925781 | 3300006803 | Aqueous | MVNLKQNIMDWYSPPDYPEYECTECGAEIDSPGVCSGTCHEASMI* |
| Ga0075467_105961521 | 3300006803 | Aqueous | IMDWYSTPDYPEYECPVCGDTTEKEGVCSNTCFEADMM* |
| Ga0070754_101126443 | 3300006810 | Aqueous | MDWYSPPEYKDYECTECGAEIEREGVCSGTCHEASMI* |
| Ga0070748_10427312 | 3300006920 | Aqueous | MDWYSPPEYKDYECSECGEEIDSPGVCSGACHEASMI* |
| Ga0070748_10663405 | 3300006920 | Aqueous | MVNLKQNIMDWYSPPEYAEYECTECGADIDSPGVCSGTCHEASMI* |
| Ga0070748_12419551 | 3300006920 | Aqueous | MVNLKQNIMDWYSPPDYPDYECTECGADIDHEGVCSGTCHEASMI* |
| Ga0070748_13135462 | 3300006920 | Aqueous | MNWYETPDYPEYECTECGADIDKPGVCSGTCHEASML* |
| Ga0075444_101773972 | 3300006947 | Marine | MVNLKQNIMDWYSPPEYYRVYECTECGTEIDKPGVCSGACHEASMI* |
| Ga0075444_101965533 | 3300006947 | Marine | MVNLKQNIMDWYSPEEYKEYECTECGTEIDKPGVCSGACHEASMI* |
| Ga0075444_102823901 | 3300006947 | Marine | MVNLKQNIMDWYSPEEHKEYECTECGTEIDKPGVCSGACHEASMI* |
| Ga0075444_103716991 | 3300006947 | Marine | TVMVNLKQNIMDWYSQEEHKEYECTECGTEIDKPGVCSGACHEASMI* |
| Ga0075468_101653423 | 3300007229 | Aqueous | MVNLKQNIMDWYSPPEYAEYECTECGAEIEKAGVCSGTCHEASMI* |
| Ga0070747_12531741 | 3300007276 | Aqueous | QNIMDWYSTPDYPEYECTECGADIDKPGVCSGTCHEASMI* |
| Ga0070747_12588781 | 3300007276 | Aqueous | MDWYNPPEYKEYECTECGAEIDHEGVCSGACHEASMI* |
| Ga0070747_13023552 | 3300007276 | Aqueous | MVNLKQNIMDWYSPPDYPEYECTECGAEIDKPGVCSGTCHEASMI* |
| Ga0070747_13051304 | 3300007276 | Aqueous | MDWYETPDYPEYECTECGADIDKPGVCSGTCHEASMI* |
| Ga0099851_10567325 | 3300007538 | Aqueous | MDWYSPPEYKDYECTECGADIDHEGVCSGTCHEASMI* |
| Ga0099851_11867651 | 3300007538 | Aqueous | MVNLKQNIMDWYSPPEYKDYECTECGAEIEREGVCSGTCHEASMI* |
| Ga0099847_10037375 | 3300007540 | Aqueous | MDWYSPPEYKDYECTECGAEIDNPGVCSGTCHEASML* |
| Ga0099847_11769371 | 3300007540 | Aqueous | MDWYSTPDYPEYECTECGADIDKPGVCSGTCHEASM |
| Ga0105745_13341761 | 3300007972 | Estuary Water | MNWDTPPEYKDYECTECGADIDKPGVCSGTCHEASMI* |
| Ga0102810_12731571 | 3300009002 | Estuarine | NIMDWYSTPEYPEYECTECGADIDKPGVCSGTCHEASMI* |
| Ga0102829_10151995 | 3300009026 | Estuarine | MDWYDTPYYPEYECTECGAEIDKPGVCSGTCHEASMI* |
| Ga0115549_11999212 | 3300009074 | Pelagic Marine | MDWYSPPEYAEYECTECGADIDKPGVCSGTCHEASMI* |
| Ga0115549_12037392 | 3300009074 | Pelagic Marine | MDWYSPPEYKEYECTECGAEIEKAGVCSGTCHEASMI* |
| Ga0115549_12048611 | 3300009074 | Pelagic Marine | MVNLKQNIMDWYSTPDYPEYECPVCGDTTEKEGVCSNTCFEADMM* |
| Ga0115549_12637432 | 3300009074 | Pelagic Marine | MNWYETPDYPEYECTECGADIDKPGVCSGICHEASMI* |
| Ga0115549_13022591 | 3300009074 | Pelagic Marine | MDWYSPPEYKDYECSECGAEIDSPGVCSGTCHEASMI* |
| Ga0115550_10430555 | 3300009076 | Pelagic Marine | MDWYNPPEYKEYECSECGADIDKPGVCSGTCHEASMI* |
| Ga0114918_104646121 | 3300009149 | Deep Subsurface | KQNIMDWYETPDYPEYECTECGADIDKPGVCSGTCHEASMI* |
| Ga0114995_102806721 | 3300009172 | Marine | MDWYNPPEYKDYECSECGEEIDSPGVCSGTCHEASMI* |
| Ga0115547_12489691 | 3300009426 | Pelagic Marine | MVNLKQNIMDWYSPPEYKDYECTECGAEIEKAGVCSGTCHEASMI* |
| Ga0114915_10181255 | 3300009428 | Deep Ocean | MDWYSPPEYKDYECTECGTEIDKPGVCSGACHEASMI* |
| Ga0114915_10325066 | 3300009428 | Deep Ocean | MDWYSPPEYKDYECTECGAEIDHEGVCSGACHEASMI* |
| Ga0114915_11546924 | 3300009428 | Deep Ocean | MDWYNPEEYKEYECTECGTEIDKPGVCSGACHEASMI* |
| Ga0114915_11777641 | 3300009428 | Deep Ocean | NIMDWYSPEEYKEYECTECGTEIDKPGVCSGACHEASMI* |
| Ga0114915_11887052 | 3300009428 | Deep Ocean | MNWDTPPEYKEYECTECGTEIDKPGVCSGACHEASMI* |
| Ga0115562_10614665 | 3300009434 | Pelagic Marine | MDWYSTPDYPEYECTECGAEIEREGVCSGTCHEASMI* |
| Ga0115562_10848055 | 3300009434 | Pelagic Marine | MDWYSPPEYKEYECTECGAEIDHEGVCSGACHEASMI* |
| Ga0115008_1004349511 | 3300009436 | Marine | MDWYSPPEYKEFECTECGADIDHEGVCSGTCHEASMI* |
| Ga0115561_13199871 | 3300009440 | Pelagic Marine | MVNLKQNIMDWYSTPDYPEYECTECGAEIEREGVCSGTCHEASMI* |
| Ga0115007_103212144 | 3300009441 | Marine | MDWYSPPDYPEYECPVCGDTTEKEGVCSNTCFEADMM* |
| Ga0115565_104797152 | 3300009467 | Pelagic Marine | MDWYSPPEFKDYECSECGEEIDSPGVCSGACHEASMI* |
| Ga0115571_10518301 | 3300009495 | Pelagic Marine | MDWYSPPEYKDYECSECGAEIEKPGVCSGTCHEASMI* |
| Ga0115571_10925831 | 3300009495 | Pelagic Marine | YETPDYPEYECTECGADIDKPGVCSGICHEASMI* |
| Ga0115572_106479561 | 3300009507 | Pelagic Marine | NIMNWYETPDYPEYECTECGADIDKPGVCSGICHEASMI* |
| Ga0115003_103406593 | 3300009512 | Marine | MDWYNPPEYKEYECTECGEEIDKTGVCSGTCHEASMI* |
| Ga0115103_15144463 | 3300009599 | Marine | MNWYEAPEYPEYECTECGADIDKPGVCSGTCHEASMI* |
| Ga0115103_16227153 | 3300009599 | Marine | MVNLKQNIMDWYSPPDYPEYECTECGADIDKPGVCSGTCHEASMI* |
| Ga0115102_103044993 | 3300009606 | Marine | MDWYSPPEYKDYECTECGADIDSPGVCSGTCHEASML* |
| Ga0115001_106059741 | 3300009785 | Marine | MDWYSPPDYPEYECTECGAEIEKEGVCSGTCHEASMI* |
| Ga0098056_13276694 | 3300010150 | Marine | MDWYSPPEYKDYECTECGTEIDHEGVCSGACHEAS |
| Ga0118731_1021728215 | 3300010392 | Marine | MDWYSPPEYAEYECTECGAEIDKPGVCSGTCHEASMI* |
| Ga0118731_1113131254 | 3300010392 | Marine | MDWYSPPEYKDYECSECGEEIDSPGVCSGTCHEASML* |
| Ga0118731_1117689671 | 3300010392 | Marine | MDWYSTPEYAEYECTECGAEIEKAGVCSGTCHEASMI* |
| Ga0133547_119019101 | 3300010883 | Marine | MVNLKQNIMDWYSPPDYPEYECTECGAEIEKEGVCSGTCHEASMI* |
| Ga0151654_10677782 | 3300011126 | Marine | MNWYETPEYKEYECTECGADIDNPGVCSGTCHEASMI* |
| Ga0151669_1010082 | 3300011128 | Marine | MDWYSTPEYAEYECTECGAEIDKPGVCSGTCHEASMI* |
| Ga0151669_1201412 | 3300011128 | Marine | MDWYSPPDYPEYECTECGAEIDKPGVCSGTGHDSK* |
| Ga0151672_10027549 | 3300011129 | Marine | MDWYSPPEYKEYECSECGAEIDSPGVCSGTCHEASMI* |
| Ga0151671_10043741 | 3300011253 | Marine | NIMDWYSTPEYAEYECTECGAEIDKPGVCSGTCHEASMI* |
| Ga0151671_10209492 | 3300011253 | Marine | NIMDWYSPPEYAEYECTECGADIDKPGVCSGTCHEASMI* |
| Ga0129326_11329275 | 3300012522 | Aqueous | MDWYSPPEYKDYECTECGAEIEKAGVCSGTCHEASMI* |
| Ga0181412_10024665 | 3300017714 | Seawater | MDWYSPPEYAEYECTECGAEIDKPGVCSGTCHEASMI |
| Ga0181390_10039474 | 3300017719 | Seawater | MDWYSPPDYPEYDCTECGADIDKPGVCSGTCHEASMI |
| Ga0181388_100213510 | 3300017724 | Seawater | MDWYSPPEYKEYECTECGAEIERAGVCSGTCHESSMI |
| Ga0181398_10599152 | 3300017725 | Seawater | MDWYSTPDYPEYECTECGAEINKPGVCSGTCHEASMI |
| Ga0181400_10810111 | 3300017752 | Seawater | ITVMVNLKQNIMDWYSPPEYKEYECTECGADIDKPGVCSGTCHEASMI |
| Ga0181409_10338803 | 3300017758 | Seawater | MVNLKQNIMDWYSPPEYAEYECTECGAEIDKPGVCSGTCHEASMI |
| Ga0187217_10239165 | 3300017770 | Seawater | MDWYSPPEYKEYECTECGAEIDKPGVCSGACHEASMI |
| Ga0181386_11084654 | 3300017773 | Seawater | MNWYTPPEYKDYECSECGEPIDKPGVCSGTCHEASM |
| Ga0206128_10092626 | 3300020166 | Seawater | MDWYSPPEYKEYECTECGADIEKPGVCSGTCHEASMI |
| Ga0206128_101153712 | 3300020166 | Seawater | MDWYSPPEYAEYECTECGADIDKPGVCSGTCHEASMI |
| Ga0206128_101407711 | 3300020166 | Seawater | MDWYSTPDYPEYECTECGADIDKPGLCSGTCHEASMI |
| Ga0206128_10141587 | 3300020166 | Seawater | MDWYSPPEYKDYECTECGADIDHEGVCSGTCHEASMI |
| Ga0206128_10229907 | 3300020166 | Seawater | MNWYETPDYPEYECTECGADIDKPGVCSGTCHEASMI |
| Ga0206128_10372314 | 3300020166 | Seawater | MDWYSPPEYKEYECTECGADIDKPGVCSGTCHEASMI |
| Ga0206128_10733985 | 3300020166 | Seawater | MDWYSPPEYKDYECTECGADIDSPGVCSGTCHEASMI |
| Ga0206128_11411361 | 3300020166 | Seawater | MDWYSPPEYKEYECTECGAEIDHEGVCSGACHEASMI |
| Ga0206128_11998012 | 3300020166 | Seawater | MDWYSPPEYKEYECTECGAEIEKPGVCSGTCHEASMI |
| Ga0206128_12425052 | 3300020166 | Seawater | MNWYETPDYPEYECTECGADIDKPGVCSGICHEASMI |
| Ga0206127_10184617 | 3300020169 | Seawater | MDWYSTPDYPEYECTECGADIDKPGVCSGTCHEASMI |
| Ga0206127_10552723 | 3300020169 | Seawater | MDWYSPPEYKDYECTECGAEIEREGVCSGTCHEASMI |
| Ga0206127_11229825 | 3300020169 | Seawater | MDWYSPPEYKEYECTECGAEIDHEGVCSGACHEASM |
| Ga0206127_11339421 | 3300020169 | Seawater | MDWYNPPEYKEYECTECGAEIDSPGVCSGTCHEASMI |
| Ga0206127_11499192 | 3300020169 | Seawater | MDWYSPPEYKDYECSECGEEIDSPGVCSGACHEASMI |
| Ga0206127_11923572 | 3300020169 | Seawater | MDWYSPPEYKDYECTECGADIDKPGVCSGTCHEASMI |
| Ga0206131_100678074 | 3300020185 | Seawater | MDWYSPPEYKDYECTECGAEIDNPGVCSGTCHEASML |
| Ga0206131_101722095 | 3300020185 | Seawater | MDWYSPPEYAEYECTECGADIDKPGVCSGTCHEAS |
| Ga0206130_101357303 | 3300020187 | Seawater | LKQNIMDWYSTPDYPEYECTECGADIDKPGVCSGTCHEASMI |
| Ga0206130_102003423 | 3300020187 | Seawater | MVNLKQNIMDWYSPPDYPEYECTECGAEIEKAGVCSGTCHEASMI |
| Ga0206130_102027061 | 3300020187 | Seawater | MNWYETPDYPEYECTECGADIDKPGVCSGICHEAS |
| Ga0206130_104115391 | 3300020187 | Seawater | MNWYETPDYSEYECTECGADIDKPGVCSGTCHEASMI |
| Ga0211685_10264503 | 3300020253 | Marine | MDWYSPEEYKEYECTECGTEIDKPGVCSGACHEASMI |
| Ga0211690_100168718 | 3300020335 | Marine | MDWYSPPEYKDYECTECGAEIDKPGVCSGTCHEASMI |
| Ga0211504_10128052 | 3300020347 | Marine | MDWYSPPEYKDYECTECGAEIDHEGVCSGACHEASMI |
| Ga0211686_100017041 | 3300020382 | Marine | MDWYSPEEYKEYECTECGTEIDKAGVCSRACHDASMI |
| Ga0206126_100057524 | 3300020595 | Seawater | MDWYSPPEYKDYECSECGAEIEREGVCSGTCHEASMI |
| Ga0206126_1001253112 | 3300020595 | Seawater | MDWYSPPEYKDYECTECGADIDSPGVCCGTCHEASMI |
| Ga0206677_1000226736 | 3300021085 | Seawater | MDWYSPPEYKDYECSECGAEIDNPGVCSGTCHEASML |
| Ga0206677_1000701417 | 3300021085 | Seawater | MDWYSPPEYKEYECTECGAEIERAGVCSGTCHEASMI |
| Ga0206677_100099324 | 3300021085 | Seawater | MDWYSPPEYKDYECTECGTEIDKPGVCSGTCHEASML |
| Ga0206677_100620076 | 3300021085 | Seawater | MDWYSPPEYKEYECTECGADIDSPGVCSGTCHEASMI |
| Ga0206677_102566931 | 3300021085 | Seawater | VMVNLKQNIMDWYSPPDYPEYECTECGAEIDKPGVCSGTCHEASMI |
| Ga0206682_100069521 | 3300021185 | Seawater | MDWYSPPEYKEYECTECGAEIDKPGVCSGTCHEASMI |
| Ga0206682_100398807 | 3300021185 | Seawater | MDWYSPPEYKDYECSECGAEIDSPGVCSGTCHEASML |
| Ga0206682_102380142 | 3300021185 | Seawater | MDWYSPPEYKEYECTECGAEIEKAGVCSGTCHEASMI |
| Ga0213869_100083619 | 3300021375 | Seawater | MDWYSPPDYPEYECTECGADIEKAGVCSGTCHEASMI |
| Ga0213861_103961182 | 3300021378 | Seawater | MDWYSTPEYAEYECTECGAEISKPGVCSGTCHEASMI |
| Ga0206685_100940262 | 3300021442 | Seawater | MVNLKQNIMDWYSPPEYKEYECTECGAEIERAGVCSGTCHEASMI |
| Ga0222717_100907424 | 3300021957 | Estuarine Water | MDWYSTPDYPEYECTECGAEIDKPGVCSGTCHEASMI |
| Ga0222717_101533383 | 3300021957 | Estuarine Water | MDWYSTPDYPEYECTECGEPMRKPGVCSGTCHEASMI |
| Ga0212030_10152081 | 3300022053 | Aqueous | MDWYSPPDYPEYECTECGAEIEKAGVCSGTCHEASMI |
| Ga0212030_10297832 | 3300022053 | Aqueous | MDWYSTPEYPEYECTECGADIDKPGVCSGTCHEASMI |
| Ga0212023_10009662 | 3300022061 | Aqueous | MDWYSTPDYPEYECPVCGDTTEKEGVCSNTCFEADMM |
| Ga0212023_10016055 | 3300022061 | Aqueous | MDWYSTPDYPEYECTECGADIDKPGVCSGTCHEASML |
| Ga0212023_10021221 | 3300022061 | Aqueous | MDWYSPPEYAEYECTECGAEIEKAGVCSGTCHEASMI |
| Ga0212023_10054585 | 3300022061 | Aqueous | MVNLKQNIMDWYSPPDYPEYECTECGAEIDSPGVCSGTCHEASMI |
| Ga0212023_10070941 | 3300022061 | Aqueous | MDWYSPPDYPEYECTECGADIDHEGVCSGTCHEASMI |
| Ga0196889_10295122 | 3300022072 | Aqueous | MNWYSPPEYKDYECTECGADIDKPGVCSGTCHEASMI |
| Ga0212022_10330882 | 3300022164 | Aqueous | MVNLKQNIMDWYSTPDYPEYECPVCGDTTEKEGVCSNTCFEADMM |
| Ga0212022_10447352 | 3300022164 | Aqueous | MDWYSPPEYKEYECTECGADIDHEGVCSGTCHEASMI |
| Ga0196903_10364391 | 3300022169 | Aqueous | MVNLKQNIMDWYSPPEYKDYECTECGAEIEREGVCSGTCHEASMI |
| Ga0196887_10072942 | 3300022178 | Aqueous | MDWYSPPDYPEYECTECGAEIDSPGVCSGTCHEASMI |
| Ga0196887_10111801 | 3300022178 | Aqueous | MDWYETPDYPEYECTECGADIDKPGVCSGTCHEASMI |
| Ga0196887_11238662 | 3300022178 | Aqueous | NIMDWYSTPDYPEYECPVCGDTTEKEGVCSNTCFEADMM |
| Ga0196901_12536392 | 3300022200 | Aqueous | LKQNIMDWYSPPDYPEYECTECGAEIEKAGVCSGTCHEASMI |
| Ga0222674_100158713 | 3300022848 | Saline Water | MDWYNPPEYKEYECTECGTEIDHEGVCSGACHEASML |
| Ga0222691_10067928 | 3300022851 | Saline Water | MDWYSPPEYKEYECTECGAEIDSPGVCSGTCHEASMI |
| Ga0222653_10505111 | 3300022857 | Saline Water | MDWYSPPEYKDYECTECGTEIDHEGVCSGACHEASML |
| (restricted) Ga0233406_100611542 | 3300023085 | Seawater | MVNLKQNIMDWYSPPEYAEYECTECGAEIEKEGVCSGTCHEASMI |
| (restricted) Ga0233411_101036882 | 3300023112 | Seawater | MDWYDTPYYPEYECTECGAEIERAGVCSGTCHEASMI |
| (restricted) Ga0233411_101221472 | 3300023112 | Seawater | MDWYSPPDYPEYECTECGAEIERAGVCSGTCHEASMI |
| (restricted) Ga0233412_102781263 | 3300023210 | Seawater | MDWYSPPEYKDYECTECGAEIEKAGVCSGTCHEASMI |
| (restricted) Ga0233412_105586382 | 3300023210 | Seawater | NTMNWYETPEYKEYECTECGAEIEKAGVCSGTCHEASMI |
| Ga0222661_10099101 | 3300023229 | Saline Water | MVNLKQNIMDWYSPPEYKEYECTECGAEIDSPGVCSGTCHEASMI |
| Ga0222659_10087781 | 3300023236 | Saline Water | NIMDWYSPPEYKDYECTECGTEIDHEGVCSGACHEASML |
| Ga0222655_10078246 | 3300023245 | Saline Water | IMDWYSPPEYKEYECTECGAEIDSPGVCSGTCHEASMI |
| (restricted) Ga0233403_100865063 | 3300023271 | Seawater | MVNLKQNIMDWYSPPEYAEYECTECGAEIEKAGVCSGTCHEASMI |
| (restricted) Ga0233403_102165102 | 3300023271 | Seawater | ITVMVNLKQNIMDWYSPPEYKDYECTECGADIDNPGVCSGTCHEASMI |
| (restricted) Ga0233410_102792983 | 3300023276 | Seawater | MDWYSPPEYAEYECTECGAEIEKEGVCSGTCHEASMI |
| (restricted) Ga0255043_100745312 | 3300024338 | Seawater | MVNLKQNIMDWYSPPDYPEYECTECGADIDKPGVCSGTCHEASMI |
| (restricted) Ga0255048_100317958 | 3300024518 | Seawater | MNWYETPDYPEYECTECGAEIDKPGVCSGTCHEASMI |
| (restricted) Ga0255048_100537565 | 3300024518 | Seawater | MNWYETPEYAEYECTECGADIDKPGVCSGTCHEASMI |
| (restricted) Ga0255048_101516746 | 3300024518 | Seawater | MDWYSPPEYKDYECTECGADIDNPGVCSGTCHEASMI |
| (restricted) Ga0255047_100384914 | 3300024520 | Seawater | MDWYSPPDYPDYECTECGAEIDNPGVCSGTCHEASMI |
| (restricted) Ga0255047_102773533 | 3300024520 | Seawater | MDWYSTPEYKEYECTECGAEIDKPGVCSGTCHEASMI |
| Ga0209535_100635315 | 3300025120 | Marine | MDWYNPPEYKEYECTECGEEIDKPGVCSGTCHEASMI |
| Ga0209336_100256684 | 3300025137 | Marine | KQNIMDWYNPPEYKEYECTECGEEIDKPGVCSGTCHEASMI |
| Ga0209634_10017242 | 3300025138 | Marine | MVNLKQNIMDWYSPPEYKEYECTECGADIDKPGVCSGTCHEASMI |
| Ga0209634_10037422 | 3300025138 | Marine | MDWYNAPEYKEYECSECGEEIDSPGVCSGTCHEASML |
| Ga0208031_10031153 | 3300025237 | Deep Ocean | MDWYSQEEHKEYECTECGTEIDKPGVCSGACHEASMI |
| Ga0208032_100035932 | 3300025266 | Deep Ocean | MDWYNPEEYKEYECTECGTEIDKPGVCSGACHEASMI |
| Ga0208814_10009406 | 3300025276 | Deep Ocean | MDWYSPPEYKDYECTECGTEIDKPGVCSGACHEASMI |
| Ga0208814_11115252 | 3300025276 | Deep Ocean | MVNLKQSIMDWYSPPEYKDYECTECGAEIDHEGVCSGACHEASMI |
| Ga0209557_10084878 | 3300025483 | Marine | MDWYSPPEYKEYECTECGAEIDHEGVCSGTCHEASMI |
| Ga0208148_11321021 | 3300025508 | Aqueous | ITVMVNLKQNIMDWYSPPEYKDYECTECGADIDHEGVCSGACHEASMI |
| Ga0208303_10441853 | 3300025543 | Aqueous | MDWYSPPEYKEYECTECGAEIEREGVCSGTCHEASMI |
| Ga0208660_10433402 | 3300025570 | Aqueous | MDWYSPPEYKEFECTECGADIDKPGVCSGTCHEASMI |
| Ga0209304_10056496 | 3300025577 | Pelagic Marine | MDWYNPPEYKEYECSECGADIDKPGVCSGTCHEASMI |
| Ga0209195_10186194 | 3300025590 | Pelagic Marine | MDWYSPPEYKEYECTECGADIDHEGVCSGTCHEASML |
| Ga0209195_10379663 | 3300025590 | Pelagic Marine | MVNLKQNIMDWYSPPEYKDYECTECGADIDKPGVCSGTCHEASMI |
| Ga0209195_10996503 | 3300025590 | Pelagic Marine | MVNLKQNIMDWYSPPEYKEYECTECGADIEKPGVCSGTCHEASMI |
| Ga0209094_10713784 | 3300025594 | Pelagic Marine | MNWYETPDYPEYECTECGADIDSPGVCSGTCHEASMI |
| Ga0209405_10428315 | 3300025620 | Pelagic Marine | MDWYSTPDYPEYECTECGAEIEREGVCSGTCHEASMI |
| Ga0209504_10284511 | 3300025621 | Pelagic Marine | MVNLKQNIMDWYSPPEYKEYECTECGAEIEKAGVCSGTCHEASMI |
| Ga0209194_11691714 | 3300025632 | Pelagic Marine | MDWYSPPEYKDYECSECGAEIDSPGVCSGTCHEASMI |
| Ga0208643_11330562 | 3300025645 | Aqueous | MVNLKQNIMDWYSPPEYKDYECTECGADIDHEGVCSGACHEASMI |
| Ga0208643_11344754 | 3300025645 | Aqueous | MDWYSPPDYPEYECTECGAEIEREGVCSGTCHEASMI |
| Ga0208134_10304412 | 3300025652 | Aqueous | MVNLKQNIMDWYSTPDYPEYECTECGADIDKPGVCSGTCHEASMI |
| Ga0209196_10626222 | 3300025654 | Pelagic Marine | MDWYSPPDYPEYECSECGADIEKPGVCSGTCHEASMI |
| Ga0208905_11954131 | 3300025661 | Lake Water | MDWYSPPEYKDYECTECGAEIDHEGVCSGTCHEASMI |
| Ga0208771_10100149 | 3300025698 | Saline Lake | MDWYSPPEYKDYECTECGTEIDKPGVCSGTCHEASMI |
| Ga0209602_10061669 | 3300025704 | Pelagic Marine | MDWYSPPEYKDYECSECGAEIEKPGVCSGTCHEASMI |
| Ga0209603_13216062 | 3300025849 | Pelagic Marine | KQNIMDWYSPPEYKDYECTECGADIDHEGVCSGTCHEASMI |
| Ga0209223_1000274438 | 3300025876 | Pelagic Marine | MDWYSPPEYKDYECTECGAEIDSPGVCSGTCHEASMI |
| Ga0208923_10953632 | 3300027320 | Estuarine | MDWYDTPYYPEYECTECGAEIDKPGVCSGTCHEASMI |
| Ga0208950_10065886 | 3300027413 | Marine | MDWYSTPEYKDYECTECGAEIDHEGVCSGTCHEASMI |
| Ga0208973_10286542 | 3300027506 | Marine | MNWDTPPEYKDYECTECGAEIDKPGVCSGTCHEASMI |
| Ga0209384_10413692 | 3300027522 | Marine | MDWYSPEEYKEYECTECGTEIDKAGVCSRACHEASMI |
| Ga0209482_10399205 | 3300027668 | Marine | MDWYNPEEYKDYECTECGTEIDKPGVCSGACHEASMI |
| Ga0209383_10125918 | 3300027672 | Marine | MDWYNPEEHKEYECTECGTEIDKPGVCSGACHEASMI |
| Ga0209383_10578631 | 3300027672 | Marine | MDWYSPPEYKDYECTECGTEIDHEGVCSGACHEASMI |
| Ga0209383_11915751 | 3300027672 | Marine | MVNLKQNIMDWYSPEEYKEYECTECGTEIDKAGVCSRACHEASMI |
| Ga0209379_102445724 | 3300027758 | Marine Sediment | MDWYSTPEYAEYECTECGADIDKPGVCSGTCHEASMI |
| Ga0209502_102591414 | 3300027780 | Marine | MDWYNPPEYKEYECTECGEEIDKTGVCSGTCHEASMI |
| Ga0209711_100939003 | 3300027788 | Marine | MDWYSPPEYKEYECTECGEEIDKTGVCSGTCHEASMI |
| Ga0209830_101555193 | 3300027791 | Marine | MDWYNPPEYKEYECTECGAEIEKEGVCSGTCHEASMI |
| Ga0209302_102836232 | 3300027810 | Marine | MDWYSPPDYPEYECPVCGDTTEKEGVCSNTCFEADMM |
| Ga0209092_100010963 | 3300027833 | Marine | MDWYSPPEYKEFECTECGADIDHEGVCSGTCHEASMI |
| (restricted) Ga0233413_102701743 | 3300027996 | Seawater | MVNLKQNIMDWYSPPDYPEYECTECGAEIERAGVCSGTCHEASMI |
| (restricted) Ga0233413_104828422 | 3300027996 | Seawater | MVNLKQNIMDWYSPPEYPEYECTECGAEIERAGVCSGTCHEASMI |
| (restricted) Ga0233414_106280502 | 3300028045 | Seawater | NIMDWYSPPEYADYECTECGAEIDKPGVCSGTCHEASMI |
| (restricted) Ga0233414_106367693 | 3300028045 | Seawater | MDWYSPPEYKDYECTECGADIDYEGVCSGTCHEASMI |
| Ga0257110_10738402 | 3300028197 | Marine | MVNLKQNIMDWYNPPEYKEYECTECGEEIDKPGVCSGTCHEASMI |
| Ga0308023_100007711 | 3300031167 | Marine | MNWDTPPEYKEHECSECGTPIDNAGVCSGACHEASML |
| Ga0308023_10676762 | 3300031167 | Marine | MVNLKQNIMDWYSPEEYKDYECTECGTEIDKPGVCSGACHEASML |
| Ga0307488_105375701 | 3300031519 | Sackhole Brine | MNWYETPDYPEYECTECGAEIEKAGVCSGTCHEASML |
| Ga0307489_100077906 | 3300031569 | Sackhole Brine | MDWYSPPEYKDYECTECGADIDKPGVCSGTCHEASML |
| Ga0307489_113404471 | 3300031569 | Sackhole Brine | MVNLKQNIMDWYETPDYPEYECTECGADIDKPGVCSGTCHEASMI |
| Ga0307376_108928513 | 3300031578 | Soil | MDWYETPEYPEYECTECGADIDKPGVCSGTCHEASMI |
| Ga0307996_10244441 | 3300031589 | Marine | MDWYNPPEYKEYECTECGTEIDHEGVCSGTCHEASMI |
| Ga0308014_10104782 | 3300031628 | Marine | MDWYSPEEYKDYECTECGTEIDKPGVCSGACHEASML |
| Ga0308014_10558122 | 3300031628 | Marine | TAMVNLKQNIMDWYSPEEHKEYECTECGTEIDKPGVCSGACHEASMI |
| Ga0307990_11511054 | 3300031645 | Marine | MDWYSPPEYKDYECTECGAEIDKPGVCSGACHEASMI |
| Ga0307990_12187133 | 3300031645 | Marine | MDWYNPEEHKEYECTECGTEIDKPGVCSGACHEASML |
| Ga0307984_10166031 | 3300031658 | Marine | MDWYNPPEYKDYECTECGTEIDHEGVCSGACHEASMM |
| Ga0308008_10156225 | 3300031687 | Marine | MDWYNPPEYKDYECTECGAEIDNPGVCSGACHEASMI |
| ⦗Top⦘ |