NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F015109

Metagenome / Metatranscriptome Family F015109

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F015109
Family Type Metagenome / Metatranscriptome
Number of Sequences 257
Average Sequence Length 47 residues
Representative Sequence EIETLARQGVARVAVPVSAAAGLPAQVKTPDDVLRYGKDVIARFR
Number of Associated Samples 211
Number of Associated Scaffolds 257

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 2.16 %
% of genes near scaffold ends (potentially truncated) 86.38 %
% of genes from short scaffolds (< 2000 bps) 78.21 %
Associated GOLD sequencing projects 198
AlphaFold2 3D model prediction Yes
3D model pTM-score0.54

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (82.490 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil
(12.062 % of family members)
Environment Ontology (ENVO) Unclassified
(26.070 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(40.467 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 32.88%    β-sheet: 0.00%    Coil/Unstructured: 67.12%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.54
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 257 Family Scaffolds
PF13452MaoC_dehydrat_N 10.12
PF00296Bac_luciferase 8.17
PF00144Beta-lactamase 5.84
PF02515CoA_transf_3 5.84
PF02627CMD 3.11
PF07076DUF1344 3.11
PF13365Trypsin_2 3.11
PF13458Peripla_BP_6 2.33
PF13530SCP2_2 1.95
PF04392ABC_sub_bind 1.95
PF04909Amidohydro_2 1.95
PF01266DAO 1.95
PF01168Ala_racemase_N 1.56
PF14534DUF4440 1.56
PF13714PEP_mutase 1.56
PF01042Ribonuc_L-PSP 1.17
PF00848Ring_hydroxyl_A 1.17
PF06808DctM 1.17
PF02738MoCoBD_1 1.17
PF01425Amidase 1.17
PF05685Uma2 0.78
PF00842Ala_racemase_C 0.78
PF04366Ysc84 0.78
PF07690MFS_1 0.78
PF00005ABC_tran 0.78
PF01566Nramp 0.78
PF13561adh_short_C2 0.78
PF12200DUF3597 0.78
PF07883Cupin_2 0.78
PF13414TPR_11 0.39
PF00561Abhydrolase_1 0.39
PF12804NTP_transf_3 0.39
PF13185GAF_2 0.39
PF04991LicD 0.39
PF07973tRNA_SAD 0.39
PF01764Lipase_3 0.39
PF13683rve_3 0.39
PF13370Fer4_13 0.39
PF12697Abhydrolase_6 0.39
PF01411tRNA-synt_2c 0.39
PF02069Metallothio_Pro 0.39
PF13193AMP-binding_C 0.39
PF10518TAT_signal 0.39
PF00248Aldo_ket_red 0.39
PF00355Rieske 0.39
PF13419HAD_2 0.39
PF02368Big_2 0.39
PF02566OsmC 0.39
PF11127DUF2892 0.39
PF00042Globin 0.39
PF00805Pentapeptide 0.39
PF01738DLH 0.39
PF00892EamA 0.39
PF00903Glyoxalase 0.39
PF12399BCA_ABC_TP_C 0.39
PF10543ORF6N 0.39
PF02585PIG-L 0.39

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 257 Family Scaffolds
COG2141Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase)Coenzyme transport and metabolism [H] 8.17
COG2367Beta-lactamase class ADefense mechanisms [V] 5.84
COG1804Crotonobetainyl-CoA:carnitine CoA-transferase CaiB and related acyl-CoA transferasesLipid transport and metabolism [I] 5.84
COG1686D-alanyl-D-alanine carboxypeptidaseCell wall/membrane/envelope biogenesis [M] 5.84
COG1680CubicO group peptidase, beta-lactamase class C familyDefense mechanisms [V] 5.84
COG0599Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase familyGeneral function prediction only [R] 3.11
COG2128Alkylhydroperoxidase family enzyme, contains CxxC motifInorganic ion transport and metabolism [P] 3.11
COG4638Phenylpropionate dioxygenase or related ring-hydroxylating dioxygenase, large terminal subunitInorganic ion transport and metabolism [P] 2.33
COG2984ABC-type uncharacterized transport system, periplasmic componentGeneral function prediction only [R] 1.95
COG0251Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 familyDefense mechanisms [V] 1.17
COG0154Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidaseTranslation, ribosomal structure and biogenesis [J] 1.17
COG1914Mn2+ or Fe2+ transporter, NRAMP familyInorganic ion transport and metabolism [P] 0.78
COG0787Alanine racemaseCell wall/membrane/envelope biogenesis [M] 0.78
COG2930Lipid-binding SYLF domain, Ysc84/FYVE familyLipid transport and metabolism [I] 0.78
COG4636Endonuclease, Uma2 family (restriction endonuclease fold)General function prediction only [R] 0.78
COG1357Uncharacterized conserved protein YjbI, contains pentapeptide repeatsFunction unknown [S] 0.39
COG1764Organic hydroperoxide reductase OsmC/OhrADefense mechanisms [V] 0.39
COG1765Uncharacterized OsmC-related proteinGeneral function prediction only [R] 0.39
COG1017Hemoglobin-like flavoproteinEnergy production and conversion [C] 0.39
COG2120N-acetylglucosaminyl deacetylase, LmbE familyCarbohydrate transport and metabolism [G] 0.39
COG3475Phosphorylcholine metabolism protein LicDLipid transport and metabolism [I] 0.39
COG0013Alanyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 0.39


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms82.49 %
UnclassifiedrootN/A17.51 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000033|ICChiseqgaiiDRAFT_c1991521All Organisms → cellular organisms → Bacteria614Open in IMG/M
3300000364|INPhiseqgaiiFebDRAFT_100626108All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1905Open in IMG/M
3300000891|JGI10214J12806_11059739All Organisms → cellular organisms → Bacteria633Open in IMG/M
3300000891|JGI10214J12806_11359034All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium722Open in IMG/M
3300000953|JGI11615J12901_10757524All Organisms → cellular organisms → Bacteria507Open in IMG/M
3300000955|JGI1027J12803_107564473Not Available629Open in IMG/M
3300002121|C687J26615_10153996Not Available581Open in IMG/M
3300002911|JGI25390J43892_10081876All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria729Open in IMG/M
3300003371|JGI26145J50221_1006279All Organisms → cellular organisms → Bacteria993Open in IMG/M
3300003911|JGI25405J52794_10143090All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium544Open in IMG/M
3300004114|Ga0062593_100222293All Organisms → cellular organisms → Bacteria1529Open in IMG/M
3300004114|Ga0062593_100269921Not Available1423Open in IMG/M
3300004114|Ga0062593_101196318All Organisms → cellular organisms → Bacteria → Proteobacteria797Open in IMG/M
3300004268|Ga0066398_10056569All Organisms → cellular organisms → Bacteria809Open in IMG/M
3300004268|Ga0066398_10149278All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium585Open in IMG/M
3300004281|Ga0066397_10006213All Organisms → cellular organisms → Bacteria1371Open in IMG/M
3300005093|Ga0062594_101256924Not Available739Open in IMG/M
3300005159|Ga0066808_1020841All Organisms → cellular organisms → Bacteria → Proteobacteria643Open in IMG/M
3300005167|Ga0066672_10697649All Organisms → cellular organisms → Bacteria651Open in IMG/M
3300005167|Ga0066672_10912847All Organisms → cellular organisms → Bacteria543Open in IMG/M
3300005172|Ga0066683_10913403All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium502Open in IMG/M
3300005174|Ga0066680_10177827All Organisms → cellular organisms → Bacteria1339Open in IMG/M
3300005176|Ga0066679_10987502Not Available525Open in IMG/M
3300005183|Ga0068993_10061829All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1120Open in IMG/M
3300005186|Ga0066676_10355389All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium981Open in IMG/M
3300005289|Ga0065704_10346125All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium816Open in IMG/M
3300005294|Ga0065705_10257913All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1171Open in IMG/M
3300005294|Ga0065705_10954180All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium560Open in IMG/M
3300005295|Ga0065707_10300849All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1004Open in IMG/M
3300005332|Ga0066388_100128122All Organisms → cellular organisms → Bacteria3077Open in IMG/M
3300005332|Ga0066388_105571578All Organisms → cellular organisms → Bacteria637Open in IMG/M
3300005335|Ga0070666_11041698All Organisms → cellular organisms → Bacteria607Open in IMG/M
3300005440|Ga0070705_100575369All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium867Open in IMG/M
3300005440|Ga0070705_101547366All Organisms → cellular organisms → Bacteria557Open in IMG/M
3300005444|Ga0070694_100021877All Organisms → cellular organisms → Bacteria → Proteobacteria4092Open in IMG/M
3300005446|Ga0066686_10052992All Organisms → cellular organisms → Bacteria2483Open in IMG/M
3300005450|Ga0066682_10347469All Organisms → cellular organisms → Bacteria956Open in IMG/M
3300005458|Ga0070681_10963277All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium773Open in IMG/M
3300005458|Ga0070681_10975225All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium767Open in IMG/M
3300005468|Ga0070707_100216269All Organisms → cellular organisms → Bacteria1867Open in IMG/M
3300005468|Ga0070707_102033098All Organisms → cellular organisms → Bacteria542Open in IMG/M
3300005518|Ga0070699_100328363All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1375Open in IMG/M
3300005536|Ga0070697_100916860All Organisms → cellular organisms → Bacteria → Proteobacteria778Open in IMG/M
3300005536|Ga0070697_100955162All Organisms → cellular organisms → Bacteria761Open in IMG/M
3300005555|Ga0066692_10369138All Organisms → cellular organisms → Bacteria910Open in IMG/M
3300005556|Ga0066707_10632552All Organisms → cellular organisms → Bacteria → Proteobacteria679Open in IMG/M
3300005557|Ga0066704_10669642All Organisms → cellular organisms → Bacteria657Open in IMG/M
3300005569|Ga0066705_10047556All Organisms → cellular organisms → Bacteria2395Open in IMG/M
3300005576|Ga0066708_10243781All Organisms → cellular organisms → Bacteria1141Open in IMG/M
3300005577|Ga0068857_101674519All Organisms → cellular organisms → Bacteria622Open in IMG/M
3300005713|Ga0066905_100052130All Organisms → cellular organisms → Bacteria2513Open in IMG/M
3300005713|Ga0066905_101836326All Organisms → cellular organisms → Bacteria560Open in IMG/M
3300005719|Ga0068861_101521373All Organisms → cellular organisms → Bacteria657Open in IMG/M
3300005719|Ga0068861_102380662All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium532Open in IMG/M
3300005764|Ga0066903_108077612All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium539Open in IMG/M
3300005764|Ga0066903_108148112All Organisms → cellular organisms → Bacteria537Open in IMG/M
3300005841|Ga0068863_102714892All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium504Open in IMG/M
3300005983|Ga0081540_1015064All Organisms → cellular organisms → Bacteria → Proteobacteria4907Open in IMG/M
3300006034|Ga0066656_10329767All Organisms → cellular organisms → Bacteria986Open in IMG/M
3300006046|Ga0066652_101683014All Organisms → cellular organisms → Bacteria579Open in IMG/M
3300006058|Ga0075432_10462525All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium559Open in IMG/M
3300006237|Ga0097621_100642352All Organisms → cellular organisms → Bacteria973Open in IMG/M
3300006796|Ga0066665_10150136All Organisms → cellular organisms → Bacteria1767Open in IMG/M
3300006796|Ga0066665_10344747All Organisms → cellular organisms → Bacteria1213Open in IMG/M
3300006852|Ga0075433_10118652All Organisms → cellular organisms → Bacteria2348Open in IMG/M
3300006853|Ga0075420_100196508All Organisms → cellular organisms → Bacteria1762Open in IMG/M
3300006871|Ga0075434_101720029All Organisms → cellular organisms → Bacteria635Open in IMG/M
3300006880|Ga0075429_100136026All Organisms → cellular organisms → Bacteria2151Open in IMG/M
3300006880|Ga0075429_100673760All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium906Open in IMG/M
3300006880|Ga0075429_100967005All Organisms → cellular organisms → Bacteria745Open in IMG/M
3300006894|Ga0079215_11414499All Organisms → cellular organisms → Bacteria544Open in IMG/M
3300006914|Ga0075436_101154646All Organisms → cellular organisms → Bacteria584Open in IMG/M
3300007076|Ga0075435_100428625All Organisms → cellular organisms → Bacteria1139Open in IMG/M
3300009089|Ga0099828_10181332All Organisms → cellular organisms → Bacteria1873Open in IMG/M
3300009089|Ga0099828_11274991All Organisms → cellular organisms → Bacteria650Open in IMG/M
3300009093|Ga0105240_10797033All Organisms → cellular organisms → Bacteria1024Open in IMG/M
3300009094|Ga0111539_12371536All Organisms → cellular organisms → Bacteria616Open in IMG/M
3300009098|Ga0105245_12904688All Organisms → cellular organisms → Bacteria531Open in IMG/M
3300009148|Ga0105243_11911129Not Available626Open in IMG/M
3300009156|Ga0111538_11710211All Organisms → cellular organisms → Bacteria792Open in IMG/M
3300009156|Ga0111538_12400954All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria662Open in IMG/M
3300009162|Ga0075423_10186495All Organisms → cellular organisms → Bacteria2177Open in IMG/M
3300009177|Ga0105248_11422501All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium785Open in IMG/M
3300009177|Ga0105248_12157786All Organisms → cellular organisms → Bacteria634Open in IMG/M
3300009545|Ga0105237_12467406All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium530Open in IMG/M
3300009553|Ga0105249_11112356All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium860Open in IMG/M
3300009553|Ga0105249_12042075All Organisms → cellular organisms → Bacteria646Open in IMG/M
3300009777|Ga0105164_10169144All Organisms → cellular organisms → Bacteria → Proteobacteria1115Open in IMG/M
3300009837|Ga0105058_1199615Not Available500Open in IMG/M
3300010043|Ga0126380_10129580All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1575Open in IMG/M
3300010046|Ga0126384_11163161All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium710Open in IMG/M
3300010047|Ga0126382_10920427All Organisms → cellular organisms → Bacteria758Open in IMG/M
3300010166|Ga0126306_11447969All Organisms → cellular organisms → Bacteria → Proteobacteria569Open in IMG/M
3300010333|Ga0134080_10063686All Organisms → cellular organisms → Bacteria1469Open in IMG/M
3300010333|Ga0134080_10332640All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Ignavibacteriae → Ignavibacteria → unclassified Ignavibacteria → Ignavibacteria bacterium 13_1_40CM_2_61_4688Open in IMG/M
3300010337|Ga0134062_10560174All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium583Open in IMG/M
3300010360|Ga0126372_10133130All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1949Open in IMG/M
3300010361|Ga0126378_10884171All Organisms → cellular organisms → Bacteria1000Open in IMG/M
3300010362|Ga0126377_10176528All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium2029Open in IMG/M
3300010362|Ga0126377_10527497All Organisms → cellular organisms → Bacteria1216Open in IMG/M
3300010362|Ga0126377_10582017All Organisms → cellular organisms → Bacteria1162Open in IMG/M
3300010362|Ga0126377_11059690Not Available879Open in IMG/M
3300010362|Ga0126377_12979914Not Available546Open in IMG/M
3300010366|Ga0126379_13062027All Organisms → cellular organisms → Bacteria559Open in IMG/M
3300010371|Ga0134125_11604192All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium708Open in IMG/M
3300010373|Ga0134128_12206282All Organisms → cellular organisms → Bacteria607Open in IMG/M
3300010375|Ga0105239_13219362All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium532Open in IMG/M
3300010376|Ga0126381_104810095All Organisms → cellular organisms → Bacteria519Open in IMG/M
3300010391|Ga0136847_11883900All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria642Open in IMG/M
3300010398|Ga0126383_11168716All Organisms → cellular organisms → Bacteria859Open in IMG/M
3300010401|Ga0134121_10527615All Organisms → cellular organisms → Bacteria1092Open in IMG/M
3300011003|Ga0138514_100154440All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium511Open in IMG/M
3300011107|Ga0151490_1167311All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium921Open in IMG/M
3300012189|Ga0137388_11700801All Organisms → cellular organisms → Bacteria565Open in IMG/M
3300012207|Ga0137381_10147427All Organisms → cellular organisms → Bacteria2022Open in IMG/M
3300012209|Ga0137379_10036310All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae4754Open in IMG/M
3300012212|Ga0150985_104335077Not Available786Open in IMG/M
3300012351|Ga0137386_10510388All Organisms → cellular organisms → Bacteria → Proteobacteria866Open in IMG/M
3300012353|Ga0137367_10236086All Organisms → cellular organisms → Bacteria1317Open in IMG/M
3300012355|Ga0137369_11141795All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium506Open in IMG/M
3300012400|Ga0134048_1142239All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria697Open in IMG/M
3300012685|Ga0137397_10919913All Organisms → cellular organisms → Bacteria648Open in IMG/M
3300012917|Ga0137395_10007180All Organisms → cellular organisms → Bacteria5866Open in IMG/M
3300012922|Ga0137394_10072968All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium2863Open in IMG/M
3300012922|Ga0137394_10479802All Organisms → cellular organisms → Bacteria1057Open in IMG/M
3300012923|Ga0137359_10359648All Organisms → cellular organisms → Bacteria1294Open in IMG/M
3300012925|Ga0137419_11657782All Organisms → cellular organisms → Bacteria545Open in IMG/M
3300012929|Ga0137404_10071893All Organisms → cellular organisms → Bacteria2718Open in IMG/M
3300012930|Ga0137407_10460294Not Available1184Open in IMG/M
3300012944|Ga0137410_11849651All Organisms → cellular organisms → Bacteria534Open in IMG/M
3300012948|Ga0126375_10588855All Organisms → cellular organisms → Bacteria847Open in IMG/M
3300012948|Ga0126375_11530699All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium571Open in IMG/M
3300012957|Ga0164303_10915472All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium616Open in IMG/M
3300012971|Ga0126369_10060108All Organisms → cellular organisms → Bacteria3288Open in IMG/M
3300012971|Ga0126369_10283768All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1648Open in IMG/M
3300012971|Ga0126369_10413639All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1389Open in IMG/M
3300012971|Ga0126369_11033460All Organisms → cellular organisms → Bacteria910Open in IMG/M
3300012971|Ga0126369_12533609All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium598Open in IMG/M
3300012984|Ga0164309_10889905All Organisms → cellular organisms → Bacteria724Open in IMG/M
3300013307|Ga0157372_10169748All Organisms → cellular organisms → Bacteria2524Open in IMG/M
3300014262|Ga0075301_1112142Not Available601Open in IMG/M
3300014968|Ga0157379_12509414All Organisms → cellular organisms → Bacteria515Open in IMG/M
3300015054|Ga0137420_1338122Not Available4968Open in IMG/M
3300015077|Ga0173483_10539272Not Available630Open in IMG/M
3300015357|Ga0134072_10245585All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium642Open in IMG/M
3300015358|Ga0134089_10000504All Organisms → cellular organisms → Bacteria9110Open in IMG/M
3300015371|Ga0132258_12320875All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1345Open in IMG/M
3300015372|Ga0132256_101536468All Organisms → cellular organisms → Bacteria776Open in IMG/M
3300015373|Ga0132257_100920315All Organisms → cellular organisms → Bacteria1097Open in IMG/M
3300015373|Ga0132257_102519710All Organisms → cellular organisms → Bacteria668Open in IMG/M
3300015373|Ga0132257_102700027Not Available647Open in IMG/M
3300016294|Ga0182041_11756078All Organisms → cellular organisms → Bacteria575Open in IMG/M
3300017654|Ga0134069_1290954All Organisms → cellular organisms → Bacteria577Open in IMG/M
3300018052|Ga0184638_1179062All Organisms → cellular organisms → Bacteria754Open in IMG/M
3300018063|Ga0184637_10206597All Organisms → cellular organisms → Bacteria1204Open in IMG/M
3300018084|Ga0184629_10347930All Organisms → cellular organisms → Bacteria780Open in IMG/M
3300018431|Ga0066655_10200129All Organisms → cellular organisms → Bacteria1235Open in IMG/M
3300018468|Ga0066662_10929932All Organisms → cellular organisms → Bacteria856Open in IMG/M
3300019998|Ga0193710_1008410All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1037Open in IMG/M
3300020084|Ga0194110_10244936All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1311Open in IMG/M
3300020109|Ga0194112_10758247Not Available640Open in IMG/M
3300020150|Ga0187768_1072468Not Available775Open in IMG/M
3300021560|Ga0126371_10383693All Organisms → cellular organisms → Bacteria1545Open in IMG/M
3300022534|Ga0224452_1022342All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria1773Open in IMG/M
3300022563|Ga0212128_10380408All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium876Open in IMG/M
3300025165|Ga0209108_10040061All Organisms → cellular organisms → Bacteria2625Open in IMG/M
3300025326|Ga0209342_10340636All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1291Open in IMG/M
3300025560|Ga0210108_1012109All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1511Open in IMG/M
3300025903|Ga0207680_10875413All Organisms → cellular organisms → Bacteria644Open in IMG/M
3300025910|Ga0207684_10116620All Organisms → cellular organisms → Bacteria → Proteobacteria2288Open in IMG/M
3300025910|Ga0207684_10298295All Organisms → cellular organisms → Bacteria1389Open in IMG/M
3300025912|Ga0207707_10781288All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium797Open in IMG/M
3300025915|Ga0207693_10004501All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria11791Open in IMG/M
3300025917|Ga0207660_10426642All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1070Open in IMG/M
3300025922|Ga0207646_10168881All Organisms → cellular organisms → Bacteria → Proteobacteria1975Open in IMG/M
3300025927|Ga0207687_11067763All Organisms → cellular organisms → Bacteria693Open in IMG/M
3300025933|Ga0207706_10763455All Organisms → cellular organisms → Bacteria → Proteobacteria823Open in IMG/M
3300025941|Ga0207711_12052812All Organisms → cellular organisms → Bacteria514Open in IMG/M
3300026295|Ga0209234_1153240All Organisms → cellular organisms → Bacteria815Open in IMG/M
3300026324|Ga0209470_1109234All Organisms → cellular organisms → Bacteria1235Open in IMG/M
3300026331|Ga0209267_1120964All Organisms → cellular organisms → Bacteria1103Open in IMG/M
3300026335|Ga0209804_1014793All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria4147Open in IMG/M
3300026371|Ga0257179_1004153All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1295Open in IMG/M
3300026376|Ga0257167_1004392All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1656Open in IMG/M
3300026482|Ga0257172_1064993All Organisms → cellular organisms → Bacteria669Open in IMG/M
3300026536|Ga0209058_1155204All Organisms → cellular organisms → Bacteria1065Open in IMG/M
3300026540|Ga0209376_1274209All Organisms → cellular organisms → Bacteria699Open in IMG/M
3300027252|Ga0209973_1026446All Organisms → cellular organisms → Bacteria800Open in IMG/M
3300027384|Ga0209854_1075429All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium595Open in IMG/M
3300027395|Ga0209996_1001042All Organisms → cellular organisms → Bacteria → Proteobacteria3307Open in IMG/M
3300027875|Ga0209283_10647154All Organisms → cellular organisms → Bacteria665Open in IMG/M
3300027876|Ga0209974_10012925All Organisms → cellular organisms → Bacteria → Proteobacteria2786Open in IMG/M
3300027909|Ga0209382_11137700All Organisms → cellular organisms → Bacteria803Open in IMG/M
3300028536|Ga0137415_11174961All Organisms → cellular organisms → Bacteria582Open in IMG/M
3300028589|Ga0247818_10341002All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1002Open in IMG/M
3300028592|Ga0247822_11095918All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria661Open in IMG/M
3300028716|Ga0307311_10110883All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium772Open in IMG/M
3300028812|Ga0247825_10104161All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1922Open in IMG/M
3300028812|Ga0247825_10482733All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium881Open in IMG/M
(restricted) 3300031197|Ga0255310_10040775All Organisms → cellular organisms → Bacteria1206Open in IMG/M
(restricted) 3300031197|Ga0255310_10123192All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium704Open in IMG/M
3300031231|Ga0170824_113763956All Organisms → cellular organisms → Bacteria591Open in IMG/M
(restricted) 3300031237|Ga0255334_1025708Not Available680Open in IMG/M
3300031543|Ga0318516_10088263All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1738Open in IMG/M
3300031544|Ga0318534_10001020All Organisms → cellular organisms → Bacteria10592Open in IMG/M
3300031546|Ga0318538_10580916All Organisms → cellular organisms → Bacteria608Open in IMG/M
3300031572|Ga0318515_10106986All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1470Open in IMG/M
3300031573|Ga0310915_10316577All Organisms → cellular organisms → Bacteria1104Open in IMG/M
3300031679|Ga0318561_10625158All Organisms → cellular organisms → Bacteria593Open in IMG/M
3300031681|Ga0318572_10327914All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium907Open in IMG/M
3300031716|Ga0310813_10032850All Organisms → cellular organisms → Bacteria3685Open in IMG/M
3300031720|Ga0307469_12357635All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium519Open in IMG/M
3300031740|Ga0307468_101367945All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium649Open in IMG/M
3300031779|Ga0318566_10012465All Organisms → cellular organisms → Bacteria3577Open in IMG/M
3300031824|Ga0307413_11835063All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium543Open in IMG/M
3300031852|Ga0307410_11840666Not Available538Open in IMG/M
3300031860|Ga0318495_10041788All Organisms → cellular organisms → Bacteria → Proteobacteria2023Open in IMG/M
3300032043|Ga0318556_10131161All Organisms → cellular organisms → Bacteria1286Open in IMG/M
3300032090|Ga0318518_10058638All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1849Open in IMG/M
3300032174|Ga0307470_10633840All Organisms → cellular organisms → Bacteria804Open in IMG/M
3300032174|Ga0307470_11871229All Organisms → cellular organisms → Bacteria510Open in IMG/M
3300032205|Ga0307472_102662087All Organisms → cellular organisms → Bacteria510Open in IMG/M
3300032829|Ga0335070_10045100All Organisms → cellular organisms → Bacteria4892Open in IMG/M
3300032954|Ga0335083_10320553All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1353Open in IMG/M
3300033289|Ga0310914_11472798All Organisms → cellular organisms → Bacteria584Open in IMG/M
3300033502|Ga0326731_1156580All Organisms → cellular organisms → Bacteria522Open in IMG/M
3300033550|Ga0247829_10448163All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1065Open in IMG/M
3300033550|Ga0247829_11167353All Organisms → cellular organisms → Bacteria638Open in IMG/M
3300033551|Ga0247830_10374364All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1105Open in IMG/M
3300034165|Ga0364942_0259138All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium568Open in IMG/M
3300034690|Ga0364923_0071764All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium843Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil12.06%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil8.56%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil8.17%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil5.84%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere5.84%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere4.67%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil3.89%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil3.50%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil3.50%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil3.11%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.72%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.95%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.95%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.95%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.95%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere1.56%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.56%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.56%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere1.56%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.17%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.17%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.17%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere1.17%
Sandy SoilEnvironmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil1.17%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.17%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake0.78%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands0.78%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.78%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.78%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.78%
SoilEnvironmental → Terrestrial → Soil → Loam → Unclassified → Soil0.78%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand0.78%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment0.78%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere0.78%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.78%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.78%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.78%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.78%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment0.39%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment0.39%
WastewaterEnvironmental → Aquatic → Freshwater → Drinking Water → Unchlorinated → Wastewater0.39%
Thermal SpringsEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Thermal Springs0.39%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.39%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil0.39%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.39%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.39%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands0.39%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.39%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil0.39%
SoilEnvironmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil0.39%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere0.39%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere0.39%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.39%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.39%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.39%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.39%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000033Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000891Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soilEnvironmentalOpen in IMG/M
3300000953Soil microbial communities from Great Prairies - Kansas Corn soilEnvironmentalOpen in IMG/M
3300000955Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300002121Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1EnvironmentalOpen in IMG/M
3300002910Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cmEnvironmentalOpen in IMG/M
3300002911Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cmEnvironmentalOpen in IMG/M
3300003371Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PMHost-AssociatedOpen in IMG/M
3300003911Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1Host-AssociatedOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300004268Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBioEnvironmentalOpen in IMG/M
3300004281Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBioEnvironmentalOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005159Soil and rhizosphere microbial communities from Laval, Canada - mgLPBEnvironmentalOpen in IMG/M
3300005167Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121EnvironmentalOpen in IMG/M
3300005172Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132EnvironmentalOpen in IMG/M
3300005174Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129EnvironmentalOpen in IMG/M
3300005176Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128EnvironmentalOpen in IMG/M
3300005180Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134EnvironmentalOpen in IMG/M
3300005183Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqC_D1EnvironmentalOpen in IMG/M
3300005186Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125EnvironmentalOpen in IMG/M
3300005289Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2Host-AssociatedOpen in IMG/M
3300005294Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk SoilEnvironmentalOpen in IMG/M
3300005295Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3EnvironmentalOpen in IMG/M
3300005330Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaGEnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005335Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaGHost-AssociatedOpen in IMG/M
3300005440Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaGEnvironmentalOpen in IMG/M
3300005444Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaGEnvironmentalOpen in IMG/M
3300005446Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135EnvironmentalOpen in IMG/M
3300005450Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131EnvironmentalOpen in IMG/M
3300005455Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaGHost-AssociatedOpen in IMG/M
3300005458Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaGEnvironmentalOpen in IMG/M
3300005468Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaGEnvironmentalOpen in IMG/M
3300005518Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaGEnvironmentalOpen in IMG/M
3300005536Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaGEnvironmentalOpen in IMG/M
3300005544Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaGEnvironmentalOpen in IMG/M
3300005555Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141EnvironmentalOpen in IMG/M
3300005556Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156EnvironmentalOpen in IMG/M
3300005557Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153EnvironmentalOpen in IMG/M
3300005569Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154EnvironmentalOpen in IMG/M
3300005576Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157EnvironmentalOpen in IMG/M
3300005577Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2Host-AssociatedOpen in IMG/M
3300005598Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155EnvironmentalOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300005844Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2Host-AssociatedOpen in IMG/M
3300005983Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1Host-AssociatedOpen in IMG/M
3300006034Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105EnvironmentalOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006058Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1Host-AssociatedOpen in IMG/M
3300006237Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)Host-AssociatedOpen in IMG/M
3300006796Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114EnvironmentalOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006853Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4Host-AssociatedOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006880Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3Host-AssociatedOpen in IMG/M
3300006894Agricultural soil microbial communities from Utah to study Nitrogen management - NC ControlEnvironmentalOpen in IMG/M
3300006914Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5Host-AssociatedOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300009089Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaGEnvironmentalOpen in IMG/M
3300009093Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaGHost-AssociatedOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009168Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015EnvironmentalOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300009545Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaGHost-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300009777Wastewater microbial communities from Netherlands to study Microbial Dark Matter (Phase II) - VDW unchlorinated drinking waterEnvironmentalOpen in IMG/M
3300009837Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_20_30EnvironmentalOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010166Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27EnvironmentalOpen in IMG/M
3300010304Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015EnvironmentalOpen in IMG/M
3300010333Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010336Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015EnvironmentalOpen in IMG/M
3300010337Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010391Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300011003Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t9i015EnvironmentalOpen in IMG/M
3300011107Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAC (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300012189Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaGEnvironmentalOpen in IMG/M
3300012207Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaGEnvironmentalOpen in IMG/M
3300012209Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012351Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012353Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012355Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaGEnvironmentalOpen in IMG/M
3300012360Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaGEnvironmentalOpen in IMG/M
3300012400Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_4_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012685Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaGEnvironmentalOpen in IMG/M
3300012917Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaGEnvironmentalOpen in IMG/M
3300012922Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaGEnvironmentalOpen in IMG/M
3300012923Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaGEnvironmentalOpen in IMG/M
3300012925Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012944Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300012984Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MGEnvironmentalOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300014262Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleA_D1EnvironmentalOpen in IMG/M
3300014968Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaGHost-AssociatedOpen in IMG/M
3300015054Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300015077Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2)EnvironmentalOpen in IMG/M
3300015357Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaGEnvironmentalOpen in IMG/M
3300015358Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300017654Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300018052Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2EnvironmentalOpen in IMG/M
3300018063Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2EnvironmentalOpen in IMG/M
3300018084Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1EnvironmentalOpen in IMG/M
3300018431Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104EnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300019998Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3m1EnvironmentalOpen in IMG/M
3300020084Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015032 Kigoma Deep Cast 1200mEnvironmentalOpen in IMG/M
3300020109Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015016 Mahale Deep Cast 400mEnvironmentalOpen in IMG/M
3300020150Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_20_MGEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300022534Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_b1EnvironmentalOpen in IMG/M
3300022563OV2_combined assemblyEnvironmentalOpen in IMG/M
3300025165Soil microbial communities from Rifle, Colorado, USA - sediment 10ft 1EnvironmentalOpen in IMG/M
3300025326Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 16_2 (SPAdes)EnvironmentalOpen in IMG/M
3300025560Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqB_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025903Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025912Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025914Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025917Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025927Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025933Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025941Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026295Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026324Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes)EnvironmentalOpen in IMG/M
3300026331Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 (SPAdes)EnvironmentalOpen in IMG/M
3300026335Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes)EnvironmentalOpen in IMG/M
3300026371Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-01-BEnvironmentalOpen in IMG/M
3300026376Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-02-BEnvironmentalOpen in IMG/M
3300026482Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-16-BEnvironmentalOpen in IMG/M
3300026536Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes)EnvironmentalOpen in IMG/M
3300026540Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes)EnvironmentalOpen in IMG/M
3300027252Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes)Host-AssociatedOpen in IMG/M
3300027384Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_30_40 (SPAdes)EnvironmentalOpen in IMG/M
3300027395Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes)Host-AssociatedOpen in IMG/M
3300027725Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes)EnvironmentalOpen in IMG/M
3300027875Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027876Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes)Host-AssociatedOpen in IMG/M
3300027909Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)Host-AssociatedOpen in IMG/M
3300028536Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300028589Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day1EnvironmentalOpen in IMG/M
3300028592Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30EnvironmentalOpen in IMG/M
3300028715Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_203EnvironmentalOpen in IMG/M
3300028716Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_198EnvironmentalOpen in IMG/M
3300028812Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Vanillin_Day48EnvironmentalOpen in IMG/M
3300031197 (restricted)Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH1_T0_E1EnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031237 (restricted)Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH5_35cm_T3_129EnvironmentalOpen in IMG/M
3300031543Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20EnvironmentalOpen in IMG/M
3300031544Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26EnvironmentalOpen in IMG/M
3300031546Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23EnvironmentalOpen in IMG/M
3300031572Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19EnvironmentalOpen in IMG/M
3300031573Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111EnvironmentalOpen in IMG/M
3300031679Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23EnvironmentalOpen in IMG/M
3300031681Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20EnvironmentalOpen in IMG/M
3300031716Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031779Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22EnvironmentalOpen in IMG/M
3300031824Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2Host-AssociatedOpen in IMG/M
3300031852Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3Host-AssociatedOpen in IMG/M
3300031858Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2EnvironmentalOpen in IMG/M
3300031860Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25EnvironmentalOpen in IMG/M
3300032012Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3EnvironmentalOpen in IMG/M
3300032043Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24EnvironmentalOpen in IMG/M
3300032090Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22EnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032829Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3EnvironmentalOpen in IMG/M
3300032954Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2EnvironmentalOpen in IMG/M
3300033289Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108EnvironmentalOpen in IMG/M
3300033502Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF9FY SIP fractionEnvironmentalOpen in IMG/M
3300033550Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4EnvironmentalOpen in IMG/M
3300033551Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5EnvironmentalOpen in IMG/M
3300034165Sediment microbial communities from East River floodplain, Colorado, United States - 19_s17EnvironmentalOpen in IMG/M
3300034690Sediment microbial communities from East River floodplain, Colorado, United States - 60_j17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
ICChiseqgaiiDRAFT_199152113300000033SoilEALAKRGVTRVAVPISSGAGLPAQVKTPDDVLRYGKDVIARFRD*
INPhiseqgaiiFebDRAFT_10062610813300000364SoilRVAVPVSAAAGLPEQVKTPDDVLRYGKEMIARFR*
JGI10214J12806_1105973923300000891SoilQGVARVAVPISAAAGLPAQLKTPEDVLRYGREVIARFR*
JGI10214J12806_1135903423300000891SoilSRVAVPVSAAAGLPAQVKTPDDVLRYGKDVIARFR*
JGI11615J12901_1075752413300000953SoilRVAGPISAAAGLPAQLKTPEDVLRYGREVIARFR*
JGI1027J12803_10756447313300000955SoilDPKEIEALAKQGVARVAVPISAAAGLPAQLKTPDDVLRYGKDMIARFR*
C687J26615_1015399623300002121SoilDPAEIEALARQGIARVAVPISNAAGLPAQLKTPDDVLRYGRDVIARFR*
JGI25615J43890_105911913300002910Grasslands SoilPKAIEITVAAPTDVAEIEALARQGIARVAVPVSAAAGLPAQLKTPDDVLRYGKDVIARFR
JGI25390J43892_1008187623300002911Grasslands SoilAEPAEIESLARLGVTRVTVPVSAAAGLPAQVKTPDDVLRYGRDVIARLRD*
JGI26145J50221_100627923300003371Arabidopsis Thaliana RhizospherePAEIEALARQGISRVGVPVSAAAGLPAQVKTPDDVLRYGREVIAHFR*
JGI25405J52794_1014309023300003911Tabebuia Heterophylla RhizosphereRQGITRVAVPVSAAAGLPAQVKTPDDVLRYGREVIAKFR*
Ga0062593_10022229313300004114SoilADPAEIEALARQGISRVGVPVSAAAGLPAQVKTPDDVLRYGREVIAHFR*
Ga0062593_10026992133300004114SoilAEIEALAKMGVTRVAVPVSSGAGLPAQVKTPDDVLRYGKTMIARFDR*
Ga0062593_10119631823300004114SoilEIEALARRGIARVAVPVSSGAGLPAQVKTPDDVLRYGKDVIARFR*
Ga0062589_10021314043300004156SoilEAAGRDPKTIEITVAAPADPAEIAGLARQGIARVAVPVSAAAGLPAQVKTPEDVLRYGKDVIARFG*
Ga0066398_1005656913300004268Tropical Forest SoilVSAPTTPEEIEALARRGVTRVAVPVSSAAGLPAQVKTPDDVLRYGKIMIDRFRE*
Ga0066398_1014927813300004268Tropical Forest SoilAEIEKLARQGVARVAVPVSSAAGLPAQVRTPEDVLRYGKEMIARFR*
Ga0066397_1000621323300004281Tropical Forest SoilAIEITVAAPADAAEIEALEQQGITRVAVPVSNAAGLPAQVKTPDDVLRYGKEMIARFR*
Ga0062594_10125692423300005093SoilEALAKQGVARVAVPISAAAGLPAQLKTPDDVLRYGKDMIARFR*
Ga0066808_102084133300005159SoilWEIEALAKRGITRVAVPVSSGAGLPAQVKTPDDVLRYGKDVIARFTR*
Ga0066672_1069764923300005167SoilAAPTEASEIEALAKRGITRVAVPVSAAAGLPAQVKTPDDVLRYGKEMIARFR*
Ga0066672_1091284713300005167SoilEEIEALARRGVTRVAVPVSSAAGLPAQVKTPDDVLRYGKTMIERFRDR*
Ga0066683_1091340323300005172SoilIEKLARQGVARVAVPVSSAAGLPAQVRTPEDVLRYGKEMIARFR*
Ga0066680_1017782713300005174SoilAKRGITRVAVPVSAAAGLPAQVKTPDDVLRYGKEMIARFR*
Ga0066679_1098750223300005176SoilEALAKRGITRVGVPVNSSAGLPAQVKTPEDVLRYGKDVIARFR*
Ga0066685_1043802713300005180SoilADIEITVAAPTAPSEIEALARLGVTRVAVPVSSAAGLPAQVQTPDDVLRYGREVIARLRD
Ga0068993_1006182923300005183Natural And Restored WetlandsVAAPPEPAEIEALAKRGVARVAVPVSAAAGLPAQVKTPDDVLRYGKEMIARFR*
Ga0066676_1035538913300005186SoilAKRGVTRVAVPVSAAAGLPAQVKTPDDVLRYGKEMIARFR*
Ga0065704_1034612523300005289Switchgrass RhizosphereAIEITVAAPADPEEIEGLARQGIARVAVPVSAAAGLPAQVKTPEDVLRYGKDVIARFR*
Ga0065705_1025791323300005294Switchgrass RhizosphereEGLARQGIARVAVPVSAAAGLPAQVKTPEDVLRYGKDVIARFR*
Ga0065705_1095418013300005294Switchgrass RhizosphereGLARQGIARVAVPVSAAAGLPAQVKTPEDVLRYGKDVIARFG*
Ga0065707_1030084923300005295Switchgrass RhizosphereLARQGIARVAVPVSAAAGLPAQVKTPEDVLRYGKDVIARFR*
Ga0070690_10124994913300005330Switchgrass RhizosphereEAAGRDPASIEITLAAPADPKEIEALAVQGVTRVAVPISAAAGLPAQLKTPDDVLRYGKDMIARFH*
Ga0066388_10012812253300005332Tropical Forest SoilKAIEVTVAAPADPTEIEGLARQGVARVAVPISNAAGLPAQVKTPDDVLRYGKEVIARFR*
Ga0066388_10557157813300005332Tropical Forest SoilLERQGITRVAVPVSNAAGLPAQVKTPDDVLRYGKEMIVRFR*
Ga0070666_1104169823300005335Switchgrass RhizosphereEIEALARQGVARVAVPISAAAGLPAQLKTPEDVLRYGREVIARFR*
Ga0070705_10057536913300005440Corn, Switchgrass And Miscanthus RhizosphereAPAEPAEIEALAKQGVTRVAVPISAAAGLPAQLKTPDDVLRYGKDMIARFR*
Ga0070705_10154736613300005440Corn, Switchgrass And Miscanthus RhizosphereVAHLVEITVAAPPEPAEIEALAKRGVTRVAVPVSAAAGLPEQVKTPDDVLRYGKEMIARFR*
Ga0070694_10002187713300005444Corn, Switchgrass And Miscanthus RhizosphereALARQGISRVGVPVSAAAGLPAQVKTPDDVLRYGREVIAHFR*
Ga0066686_1005299243300005446SoilLGVTRVAVPVSSAAGLPAQVQTPDDVLRYGREVIARLRD*
Ga0066682_1034746933300005450SoilEIEALAKRGVSRVAVPVSGAAGLPAQVRTPDDVLRYGKDVIARLRD*
Ga0070663_10063527423300005455Corn RhizosphereEAAGRDPKAIEITLAAPADPAEIEALARQGVARVAVPISAAAGLPAQLKTPEDVLRYGREVIARFR*
Ga0070681_1096327733300005458Corn RhizosphereLARQGIARVAVPVSAAAGLPAQVKTPEDVLRYGKDVIARFG*
Ga0070681_1097522513300005458Corn RhizosphereKMGVTRVAVPVSSGAGLPAQVKTPDDVLRYGKTMIARFDR*
Ga0070707_10021626933300005468Corn, Switchgrass And Miscanthus RhizosphereEALAKRGVTRVAVPVSAAAGLPAQVKTPDDVLRYGKEMIARFR*
Ga0070707_10203309813300005468Corn, Switchgrass And Miscanthus RhizospherePSNVSEIEALAKRGVARVAVPVSAAAGLPAQVRTPDDVLRYGKEVIARFQ*
Ga0070699_10032836333300005518Corn, Switchgrass And Miscanthus RhizosphereEITVSAPTTPEEIEALARRGVTRVAVPVSSAAGLPAQVKTRDDVLRYGKTMIERFRDR*
Ga0070697_10091686023300005536Corn, Switchgrass And Miscanthus RhizosphereLAAPTEVSEIEALAKSGVSRVAVPVSPAAGLPAQVRTPDEVLRYGKEVIARFRS*
Ga0070697_10095516223300005536Corn, Switchgrass And Miscanthus RhizosphereEITVSAPTEPAEIEALARRGVKRVAVPVSAAAGLPAQVRTPDDVLRYGKTMIERFRD*
Ga0070686_10012262913300005544Switchgrass RhizosphereAGRDPASIEITLAAPADPKEIEALAVQGVTRVAVPISAAAGLPAQLKTPDDVLRYGKDMIARFH*
Ga0066692_1036913813300005555SoilGVKRVAVPVSSAAGLPAQVKTPDDVLRYGKTMIERFRD*
Ga0066692_1083683013300005555SoilELFDEMRRAAEAAGRDPKAIELTVAAPADPKEIEALARRGITRVGVPVNSSAGLPAQVKTPEDVLRYGKDVIARFR*
Ga0066707_1063255233300005556SoilKRGVSRVAVPVSAAAGLPAQVKTPDDVLRYGRDVIARFADV*
Ga0066704_1066964213300005557SoilSAPTTPEEIEALARRGVTRVAVPVSSAAGLPAQVKTPDDVLRYGKTMIERFRDR*
Ga0066705_1004755613300005569SoilEIEALAKRGVSRVAVPVSGAAGLPAQVGTPDDVLRYGKDVIARLRD*
Ga0066708_1024378113300005576SoilSRVTVPVSAAAGLPAQVKTPDDVLRYGRDVIARLRD*
Ga0068857_10167451913300005577Corn RhizospherePAQIEALAKRGVTRVAVPISSGAGLPAQVKTPDDVLRYGKDVIARFRD*
Ga0066706_1146685013300005598SoilAIELTVAAPADPKEIEALAKRGITRVGVPVNSSAGLPAQVKTPEDVLRYGKDVIARFR*
Ga0066905_10005213013300005713Tropical Forest SoilVARVAVPVSAAAGLPAQVRTPDDVLRYGKTMIERFRE*
Ga0066905_10083701523300005713Tropical Forest SoilRDPSTIEITVAAPAEPLGIEALARQGVARVAVPVSAAAGLPAQVRTPDDVLRYGKQVIEKFRDTKAR*
Ga0066905_10183632613300005713Tropical Forest SoilVSAPTEPAEIEALARRGVARVAVPVSSAAGLPAQVRTPDDVLRYGKTMIERFRE*
Ga0068861_10152137323300005719Switchgrass RhizospherePPEPAEIEALARRGVARVAVPVSAAAGLPAQVKTPEDVLRYGKEMIARFR*
Ga0068861_10238066213300005719Switchgrass RhizosphereAKRGIARVAVPISSGAGLPAQVKTPDDVLRYGKDVIARFR*
Ga0066903_10807761223300005764Tropical Forest SoilASTEPAEIEKLARQGVARVAVPVSSAAGLPAQVRTPEDVLRYGKEMIARF*
Ga0066903_10814811213300005764Tropical Forest SoilPAEPAEIEALARRGVKRVAVPVSSAAGLPAQVRTPDDVLRYGKTMIERFRE*
Ga0068863_10271489223300005841Switchgrass RhizosphereRGIARVAVPVSSGAGLPAQVKTPDDVLRYGKDVIARFR*
Ga0068862_10217113723300005844Switchgrass RhizosphereAGRDPASIEITLAAPADPKEIEALAGQGVTRVAVPISAAAGLPAQLKTPDDVLRYGKDMIARFH*
Ga0081540_101506413300005983Tabebuia Heterophylla RhizosphereAAEIEALERQGITRVAVPVSNAAGLPAQVKTPDDVLRYGKEMITRFR*
Ga0066656_1032976713300006034SoilGVARVAVPLSGAAGLPAQVRTPDDVLRYGKDVIARLRD*
Ga0066652_10168301433300006046SoilEIEALARLGVTRVTVPVSAAAGLPAQVKTPDDVLRYGRDVIARLRD*
Ga0075432_1046252513300006058Populus RhizospherePAEIEKLARQGVARVAVPVSSAAGLPAQVRTPEDVLRYGKEMIARF*
Ga0097621_10064235213300006237Miscanthus RhizospherePADPAEIEALARQGVARVAVPISAAAGLPAQLKTPEDVLRYGREVIARFR*
Ga0066665_1015013613300006796SoilEALAKRGVSRVAVPVSGAAGLPAQVRTPDDVLRYGKDVIARLRD*
Ga0066665_1034474713300006796SoilAPSGIEALARLGVTRVAVPVSSAAGLPAQVQTPDDVLRYGREVIARLRD*
Ga0075433_1011865233300006852Populus RhizosphereVAAPTEPAEIEKLARQGVARVAVPISSAAGLPAQVRTPEDVLRYGKEMIARF*
Ga0075420_10019650813300006853Populus RhizosphereAPTDPAQIEALAKRGVTRVAVPISSGAGLPAQVKTPDDVLRYGKDVIARFRD*
Ga0075434_10172002923300006871Populus RhizosphereEPAEIEALARQGVTRVAVPVSAAAGLPSQVKTPDDVLRYGKEMIARFR*
Ga0075429_10013602613300006880Populus RhizosphereVAVPISSGAGLPAQVKTPDDVLRYGKDVIARFRD*
Ga0075429_10067376023300006880Populus RhizospherePPEAEEIEKLAKQGVTRVAVPVSSAAGLPAQVRTPDDVLRYGKEMIARFR*
Ga0075429_10096700523300006880Populus RhizosphereTRVAVPVSSAAGLPAQVKTPDDVLRYGKDVIARFR*
Ga0079215_1141449923300006894Agricultural SoilEALAKQGVARVAVPVSAAAGLPAQVRTPDDVLRYGREVIARFS*
Ga0075436_10115464623300006914Populus RhizosphereTEPAEIEALARRGVKRVAVPVSAAAGLPAQVRTPDDVLRYGKTMIERFRD*
Ga0075435_10042862513300007076Populus RhizosphereEIETLARQGVARVAVPVSAAAGLPAQVKTPDDVLRYGKDVIARFR*
Ga0099828_1018133233300009089Vadose Zone SoilRVAVPVSAAAGLPAQVKTPDDVLRYGKEMIARFR*
Ga0099828_1127499123300009089Vadose Zone SoilAKRGAARVAVPVSAAAGLPAQVKTPDDVRRYSKETIARFR*
Ga0105240_1079703313300009093Corn RhizosphereAEIEALARQGVARVAVPISAAAGLPAQLKTPEDVLRYGREVIARFR*
Ga0111539_1237153623300009094Populus RhizosphereIEALAKRGVTRVAVPISSGAGLPAQVKTPDDVLRYGKDVIARFRD*
Ga0105245_1290468823300009098Miscanthus RhizosphereSEIEALARQGVARVAVPISAAAGLPAQLKTPEDVLRYGREVIARFR*
Ga0114129_1147789523300009147Populus RhizosphereEAAGRDPKGIEITLAAPAEPAEIETLARQGVARVAVPISAAAGLPAQLKTPEDVLRYGREVIARFR*
Ga0105243_1191112923300009148Miscanthus RhizosphereSAPQDPTEIEALAKRGIARVAVPVSSGAGLPAQVRTPDDVLRYGKEVISRFR*
Ga0111538_1171021113300009156Populus RhizosphereTVAAPTDPKEIEALAKQGVARVAVPVSAAAGLPAQVRTPDDVLRYGREMIARFS*
Ga0111538_1240095443300009156Populus RhizosphereVAVPVSSGAGLPAQVKTPDDVLQYGKNVIARFDR*
Ga0075423_1018649543300009162Populus RhizosphereVAAPTEPAEIEKLARQGVARVAVPVSSAAGLPAQVRTPEDVLRYGKEMIARF*
Ga0105104_1037680423300009168Freshwater SedimentAGRDPASIEITLAAPTEPAEIEALAKQGVTRVAVPISAAAGLPAQLKTPDDVLRYGKDMIARFR*
Ga0105248_1142250123300009177Switchgrass RhizospherePEIEALATQGVARVAVPISAAAGLPAQLMTPDDVLRYGKDMIARFR*
Ga0105248_1215778623300009177Switchgrass RhizosphereAEIEALARRGVARVAVPVSAAAGLPAQVKTPEDVLRYGKEMIARFR*
Ga0105237_1094260913300009545Corn RhizosphereDPKAIEITLAAPADPAEIEALARQGVARVAVPISAAAGLPAQLKTPEDVLRYGREVIARFR*
Ga0105237_1246740623300009545Corn RhizosphereLARQGISRVGVPVSAAAGLPAQVKTPDDVLRYGREVIAHFR*
Ga0105249_1111235613300009553Switchgrass RhizosphereEIEALAKQGVARVAVPISAAAGLPAQLKTPDDVLRYGKDMIARFR*
Ga0105249_1204207513300009553Switchgrass RhizosphereEIEALARKGVSRVAVPVSSAAGLPSQVKTPDDVLRYGKEMIARFR*
Ga0105164_1016914413300009777WastewaterSEIEGLARLGVTRVAVPVSAAAGLPAQVKTPDDVLRYGRDVIARFA*
Ga0105058_119961513300009837Groundwater SandRQGVARVAVPVSSAAGLPAQVKTPDDVLRYGKDVIARFR*
Ga0126380_1012958043300010043Tropical Forest SoilLGRQGITRVAVPVSKAAGLPAQVKTPDDVLRYGKQMIARFR*
Ga0126384_1116316113300010046Tropical Forest SoilASVGADIEALGRQGIARVAVPVSNAAGLPAQVKTPDDVLRYGEEMIARFR*
Ga0126382_1092042723300010047Tropical Forest SoilQGVARVAVPVSSAAGLPAQVRTPEDVLRYGKEMIARFR*
Ga0126306_1144796923300010166Serpentine SoilTVAAPVTPAEIEALAREGVNRVAVPVSNAAGLAAHVRTPEDVVRYGKEVIARFRA*
Ga0134088_1013735133300010304Grasslands SoilRAAEAAGRSPDAIEITTAAPTDLFEIEALAKRGVARVAVPLSGAAGPPAQVRTPDDVLRYGKDVIARLRD*
Ga0134080_1006368633300010333Grasslands SoilRGITRVAVPVSAAAGLPAQVKTPDDVLRYGKEMIARFR*
Ga0134080_1033264013300010333Grasslands SoilKRVAVPVSSAGGLSAQVTTPDDVLRYGRTVIARLRD*
Ga0134071_1039415513300010336Grasslands SoilDEMRRAAEAAGRNPDAIEITTAAPTDLFEIEALAKRGVARVAVALSGAAGLPAQVRTPDDVLRYGKDVIARLRD*
Ga0134062_1056017433300010337Grasslands SoilAAPAAVAEIEALAKRGITRVAVPVSAAAGLPAQVKTPEDVLRYGRDVIARFADV*
Ga0126372_1013313013300010360Tropical Forest SoilRQGIARVAVPVSSAAGLPAQVKTPDDVLRYGKEMIARFR*
Ga0126378_1088417123300010361Tropical Forest SoilERQGITRVAVPVSNAAGLPAQVKTPDDVLRYGKEMIARFR*
Ga0126377_1017652843300010362Tropical Forest SoilRRGVRRVAVPVSSAAGLPAQVRTPDDVLRYGKTMIERFRE*
Ga0126377_1052749713300010362Tropical Forest SoilVAAPTEASEIEALGRQGIARVAVPASSAAGLPAQVKTPDDVLRYGKEMIARFR*
Ga0126377_1058201723300010362Tropical Forest SoilEIEALERQGITRVAVPVSNAAGLPAQVKTPDDVLRYGKEMIARFR*
Ga0126377_1105969013300010362Tropical Forest SoilVPVSAAAGLPAQVRTPDDVLRYGKQVIEKFRDTKAR*
Ga0126377_1297991423300010362Tropical Forest SoilEPSEIEGLARLGVARVAVPVSAAAGLPPQVKTPDDVLRYGKNVIEKFR*
Ga0126379_1043187413300010366Tropical Forest SoilDPRAIELTVSAPTDPAEIEALGRQGVTRVAVPVSAAAGLPAQLKTPDDVLRYGKEMIARFR*
Ga0126379_1306202723300010366Tropical Forest SoilRVAVPVSNAAGLPAQVKTPDDVLRYGKEMIGRFR*
Ga0134125_1160419223300010371Terrestrial SoilAAPADPAEIASLARQGIARVAVPVSAAAGLPAQVKTPEDVLRYGKDVIARFG*
Ga0134128_1220628223300010373Terrestrial SoilTVAAPPEPAEIEALAQRGVARVAVPVSAAAGLPAQVKTPDDVLRYGKEMIARFR*
Ga0105239_1321936213300010375Corn RhizosphereEVLAKRGITRVAVPVSSGAGLPAQVKTPDDVLRYGKDVIARFTR*
Ga0126381_10481009513300010376Tropical Forest SoilGVRRVAVPVSSAAGLPAQVRTPDDVLRYGKTMIERFRE*
Ga0136847_1188390013300010391Freshwater SedimentLARLGVTRVAVPVSAAAGLPAQVKTPDDVLRYGKEMIARFR*
Ga0126383_1116871613300010398Tropical Forest SoilEKLARQGVARVAVPVSSAAGLPAQVRTPEDVLRYGKEMIARFR*
Ga0134121_1052761543300010401Terrestrial SoilRQGVARVAVPVSAAAGLPAQVKTPDDVLRYGRDVIARFR*
Ga0138514_10015444013300011003SoilKQGVARVAVPVSSAAGLPAQVRTPEDVLRYGKNVIARLRDRD*
Ga0151490_116731113300011107SoilEIEALAKQGVTRVAVPISAAAGLPAQLKTPDDVLRYGKDMIARFR*
Ga0137388_1170080113300012189Vadose Zone SoilAAPTEPAEIEALAKRGITRVAVPVSAAAGLPAQVKTPDDVLRYGKEMIARFR*
Ga0137381_1014742733300012207Vadose Zone SoilVTRVAVPVSAAAGLPAQVKTPDDVLRYGKEMIARFR*
Ga0137379_1003631013300012209Vadose Zone SoilAEPAEIEKLARQGVARVAVPVSSAAGLPAQVRTPEDVLRYGKEMIARFR*
Ga0150985_10433507713300012212Avena Fatua RhizosphereAAPADPAEIAGLERSGVSRVMVPVTGAAGLPPLVKDPDEVLRYGREVIGRYGAA*
Ga0137386_1051038823300012351Vadose Zone SoilVVARVAVPVSAAAGLPAQVKTPDDVLRYGKEMIARFR*
Ga0137367_1023608613300012353Vadose Zone SoilALAQQGVARVAVPVSSAAGLPAQVKTPDDLLRYGKDVIARFH*
Ga0137369_1114179513300012355Vadose Zone SoilADLAEIEALARQGVARVAVPVSAAAGLPAQVKTPEDVLRYGRDVIARFR*
Ga0137375_1022468613300012360Vadose Zone SoilAEAAGRDLASIEITLAAPAEPAEIEALAKQGVTRVAVPISAAAGLPAQLKTPDDVLRYGKDMIARFH*
Ga0134048_114223933300012400Grasslands SoilAPAEPAEIEALARVGVTRVTVPVSAAAGLPAQVKTPDDVLRYGRDVIARLRD*
Ga0137397_1091991313300012685Vadose Zone SoilPAEIEALARRGVKRVAVPVSAAAGLPAQVRTPDDVLRYGKTMIERFRD*
Ga0137395_1000718013300012917Vadose Zone SoilITVAAPPEPAEIEALAKRGVTRVAVPVSAAAGLPAQVKTPDDVLRYGKEMIARFR*
Ga0137394_1007296813300012922Vadose Zone SoilEITVAAPADPAEIESLARQGIARVAVPVSAAAGLPAQVRTPDDVLRYGKDVIARFR*
Ga0137394_1047980223300012922Vadose Zone SoilLAKRGVSRVAVPVSGAAGLPAQVRTPDDVLRYGKDVIARLRD*
Ga0137359_1035964813300012923Vadose Zone SoilALARQGIARVAVPVSAAAGLPAQVKTPDDVLRYGKDVIARFR*
Ga0137419_1165778223300012925Vadose Zone SoilPTEAPEIEALARRGITRVAVPVSAAAGLPAQVKTPDDVLRYGKEMIARFR*
Ga0137404_1007189313300012929Vadose Zone SoilEPAEIEALARQGVARVAVPVSSAAGLPAQVKTPDDVLRYGKDVIARFR*
Ga0137407_1046029413300012930Vadose Zone SoilEIEVLARQGITRVAVPVSSGAGLPAQVKTPDDVLRYGKDVIARFG*
Ga0137410_1184965113300012944Vadose Zone SoilIEALAKRGVTRVAVPVSAAAGLPAQVKTPDDVLRYGKEMIARFR*
Ga0126375_1058885513300012948Tropical Forest SoilKIEALARRGVRRVAVPVSSAAGLPAQVRTPDDVLRYGKTMIERFRE*
Ga0126375_1153069913300012948Tropical Forest SoilSAPAEAGEIEKLARQGVARVAVPVSSAAGLPAQVRTPDDVLRYGKEMITRFR*
Ga0164303_1091547213300012957SoilALAKRGITRVAVPVSSGAGLPAQVKTPDDVLRYGKDVIARFR*
Ga0126369_1006010843300012971Tropical Forest SoilVARVAVPVSSAAGLPAQVRTPEDVLRYGKEMIARF*
Ga0126369_1028376813300012971Tropical Forest SoilTEASEIEALGRQGTARVAVPVSNAAGLPAQVKTPDDGLRYGKEMIARFR*
Ga0126369_1041363923300012971Tropical Forest SoilIEITLAAPPEPAAIEALARRGIARVAVPVSSAAGLPAQVKTPDDVLRYGKDVITHFR*
Ga0126369_1103346013300012971Tropical Forest SoilIARVAVPVSNAAGLSAQVKTPDDVLRYGKEMIARFR*
Ga0126369_1253360923300012971Tropical Forest SoilAPSDVSEIEALARRGVTRVAVPVSAAAGLPAQVKTPDDVLRYGQEIIARFR*
Ga0164309_1088990523300012984SoilEIEALARRGVKRVAVPVSAAAGLPAQVRTPDDVLRYGKTMIERFRD*
Ga0157372_1016974813300013307Corn RhizosphereQADPAEIEALARQGISRVGVPVSAAAGLPAQVKTPDDVLRYGREVIAHFR*
Ga0075301_111214213300014262Natural And Restored WetlandsLAEIDALARQGVARVAVPVSAAAGLPAQVKTPDDVLRYGKDVIARFR*
Ga0157379_1250941413300014968Switchgrass RhizosphereVAVPVSAAAGLPAQVRTPDDVLRYGKTMIERFRD*
Ga0137420_133812263300015054Vadose Zone SoilVARVAVPVSAAAGLPAQVKTPDDVLRYGKEMIARFR*
Ga0173483_1053927213300015077SoilSAPAEPAEIEALAKMGVTRVAVPVSSGAGLPAQVKTPDDVLRYGKTMIARFDR*
Ga0134072_1024558513300015357Grasslands SoilAEIEALARVGVTRVTVPVSAAAGLPAQVKTPDDVLRYGRDVIARLRD*
Ga0134089_1000050493300015358Grasslands SoilVKRVAVPVSSAAGLPAQVKTPDDVLRYGKTMIERFRD*
Ga0132258_1232087513300015371Arabidopsis RhizosphereIEALAKRGIARVAVPVSSGAGLPAQVKTPDDVLRYGKEVISRFR*
Ga0132256_10153646823300015372Arabidopsis RhizosphereVAAPAEASEIEALARKGVSRVAVPVSSAAGLPSQVKTPDDVLRYGKEMIARFR*
Ga0132256_10296730823300015372Arabidopsis RhizosphereVELTVAAPTDAKEIAALAEQGVARVAVPVSAAAGLPAQVRTPDDVLRYGREMIARFG*
Ga0132257_10092031523300015373Arabidopsis RhizosphereASEIEALARKGVSRVAVPVSSAAGLPSQVKTPDDVLRYGKEMIARFR*
Ga0132257_10251971013300015373Arabidopsis RhizosphereALARQGVARVAVPISAAAGLPAQLKTPEDVLRYGREVIARFR*
Ga0132257_10270002713300015373Arabidopsis RhizosphereRVAVPISAAAGLPAQIKTPDDVLRYGKDVIARFR*
Ga0182041_1175607813300016294SoilTEASDIEALARRGVKRVAVPVSAAAGLPAHVRTPDDVLRYGKTMIERFRD
Ga0134069_129095423300017654Grasslands SoilAEIEALAKRGVSRVAVPVSGAAGLPAQVGTPDDVLRYGKDVIARLRD
Ga0184638_117906213300018052Groundwater SedimentIARVAVPVSNAAGLPAQVKTPDDVLRYGKDVIARFR
Ga0184637_1020659733300018063Groundwater SedimentAAAPAEPSEIEALAKLGVTRVAVPVSAAAGLPAQVKTPDDLLRYGNDVIAKFR
Ga0184629_1034793043300018084Groundwater SedimentRQGIARVAVPVSNAAGLPAQVKTPDDVLRYGKDVIARFR
Ga0066655_1020012933300018431Grasslands SoilEALARRGVKRVAVPVSSAAGLPAQVRTPDDVLRYGKTMIERFGE
Ga0066662_1092993223300018468Grasslands SoilVKRVAVPVSSAAGLPAQVKTPDDVLRYGKTMIERFRD
Ga0193710_100841023300019998SoilVPDGWATGTPTPGLLDEMRRAAEAAGRDPKTIEITVAAPADPAEIEGLARKGIARVAVPVSAAAGLPAQVKTPEDVLRYGKDVIARFG
Ga0194110_1024493613300020084Freshwater LakeGVSRVAVPVSNAAGLAAQVRTPEDVLRYGKEVIARFR
Ga0194112_1075824713300020109Freshwater LakeAKRGIARVAVPISSGAGLPAQVKTPDDVLRYGKDVIRSFGDGGR
Ga0187768_107246813300020150Tropical PeatlandGIEALARQGIARVAVPISNAAGLPAQVKTPDDVLRYGKDVIARFR
Ga0126371_1038369333300021560Tropical Forest SoilTRVAVPVSNAAGLPAQVKTPDDVLRYGKEMIARFR
Ga0224452_102234243300022534Groundwater SedimentLAKQGITRVAVPVSSGAGLPAQVKTPDDVLRYGKNVIARFAR
Ga0212128_1038040823300022563Thermal SpringsGVTRVAVPVSAAAGLPAQVRTPDDVLRYGKEMIARFR
Ga0209108_1004006113300025165SoilPAEIEALARQGIARVAVPISNAAGLPAQLKTPDDVLRYGRDVIARFR
Ga0209342_1034063623300025326SoilLTVAAPPEPAEIEKQARQSVARVAVPVSSAAGLPAQVRTPDDVLRYGKEMIARFR
Ga0210108_101210923300025560Natural And Restored WetlandsVAAPPEPAEIEALAKRGVARVAVPVSAAAGLPAQVKTPDDVLRYGKEMIARFR
Ga0207680_1087541313300025903Switchgrass RhizosphereIEITLAALADPAEIEALARQGVARVAVPISAAAGLPAQLKTPEDVLRYGREVIARFR
Ga0207684_1011662043300025910Corn, Switchgrass And Miscanthus RhizosphereVTRVAVPVSSAAGLPAQVKTPDDVLRYGKTMIERFRDR
Ga0207684_1029829513300025910Corn, Switchgrass And Miscanthus RhizosphereAKRGVTRVAVPVSAAAGLPAQVKTPDDVLRYGKEMIARFR
Ga0207707_1078128833300025912Corn RhizosphereADPAEIASLARQGIARVAVPVSAAAGLPAQVKTPEDVLRYGKDVIARFG
Ga0207671_1024365833300025914Corn RhizosphereDPKAIEITLAAPADPAEIEALARQGVARVAVPISAAAGLPAQLKTPEDVLRYGREVIARF
Ga0207693_1000450113300025915Corn, Switchgrass And Miscanthus RhizosphereARRGVARVAVPVSAAAGLPAQVKTPEDVLRYGKEMIARFR
Ga0207660_1042664213300025917Corn RhizosphereRQGISRVAVPVSAAAGLPAQVKTPDDVLRYGKDVIARFR
Ga0207646_1016888113300025922Corn, Switchgrass And Miscanthus RhizosphereLARQGVARVAVPVSAAAGLPAQVKTPDDVLRYGKDVIARFR
Ga0207687_1106776313300025927Miscanthus RhizosphereAEIEALARQGVARVAVPISAAAGLPAQLKTPEDVLRYGREVIARFR
Ga0207706_1076345523300025933Corn RhizosphereQDPKDIEALAKRGIARVAVPISSGAGLPAQVKTPDDVLRYGKDVIARFR
Ga0207711_1205281213300025941Switchgrass RhizosphereRQGVARVAVPISAAAGLPAQLKTPEDVLRYGREVIARFR
Ga0209234_115324023300026295Grasslands SoilAEIEALARLGVTRVAVPVSSAAGLPAQVQTPDDVLRYGRDVIARLRD
Ga0209470_110923423300026324SoilRGITRVAVPVSAAAGLPAQVKTPDDVLRYGKEMIARFR
Ga0209267_112096423300026331SoilAPTEASEIEALAKRGITRVAVPVSAAAGLPAQVKTPDDVLRYGKEMIARFR
Ga0209804_101479353300026335SoilVAVPVSSAAGLPAQVKTPDDVLRYGKTMIERFRDR
Ga0257179_100415313300026371SoilQGIARVAVPVSNAAGLPAQVKTPDDVLRYGKDVIARFR
Ga0257167_100439243300026376SoilPADPAEIEGLARQDIARVAVPVSNAAGLPAQVKTPDDVLRYGKDVIARFR
Ga0257172_106499313300026482SoilLARQGIARVAVPVSAAAGLPAQVKTPDDVLRYGKDVIARFR
Ga0209058_115520423300026536SoilMEALARQGVARVAVPVSSAAGLPAQVKTPDDVLRYGKDVIARFR
Ga0209376_127420913300026540SoilALAKRGITRVAVPVSAAAGLPAQVKTPDDVLRYGKEMIARFR
Ga0209973_102644623300027252Arabidopsis Thaliana RhizosphereAEIEALARQGISRVGVPVSAAAGLPAQVKTPDDVLRYGREVIAHFR
Ga0209854_107542933300027384Groundwater SandEALARQGITRVAVPVSSGAGLPAQVKTPDDLLRYGKNMIARFAR
Ga0209996_100104213300027395Arabidopsis Thaliana RhizospherePADPAEIEALARQGISRVGVPVSAAAGLPAQVKTPDDVLRYGREVIAHFR
Ga0209178_132738913300027725Agricultural SoilKAIEITLAAPADPAEIEALARQGVARVAVPISAAAGLPAQLKTPEDVLRYGREVIARFR
Ga0209283_1064715413300027875Vadose Zone SoilAKRGAARVAVPVSAAAGLPAQVKTPDDVRRYSKETIARFR
Ga0209974_1001292513300027876Arabidopsis Thaliana RhizosphereEITVAAPADPAEIEALARQGISRVGVPVSAAAGLPAQVKTPDDVLRYGREVIAHFR
Ga0209382_1113770023300027909Populus RhizosphereAKQGVTRVAVPVSSAAGLPAQVRTPDDVLRYGKEMIARFR
Ga0137415_1117496123300028536Vadose Zone SoilRGVKRVAVPVSAAAGLPAQVRTPDDVLRYGKTMIERFRD
Ga0247818_1034100213300028589SoilPGEIEALARQGVTRVAVPISSGAGLPAQVKTPDDVLRYGKDMIARFDR
Ga0247822_1109591813300028592SoilALARAGVTRVAVPVSSGAGLPAQVKTPDDVLQYGKNVIARFDR
Ga0307313_1021872833300028715SoilRDPKAVEITLAAPTDVAEIEALARQGVARVAVPVSAAAGLPAQLKTPDDVLRYGKDVIARFR
Ga0307311_1011088333300028716SoilRQGVARVAVPVSAAAGLPAQVKTPDDVLRYGKDVIARFR
Ga0247825_1010416113300028812SoilEIVGLARQGIARVAVPVSAAAGLPAQVKTPEDVLRYGKDVIARFR
Ga0247825_1048273313300028812SoilVAAPADPAEIASLARQGIARVAVPVSAAAGLPAQVKTPEDVLRYGKDVIARFG
(restricted) Ga0255310_1004077533300031197Sandy SoilRRGVARVAVPVSAAAGLPAQVRTPDDVLRYGKTMIERFRD
(restricted) Ga0255310_1012319213300031197Sandy SoilARQGIARVAVPVSAAAGLPAQVKTPDDVLRYGKDVIARFR
Ga0170824_11376395623300031231Forest SoilVARVAVPVSAAAGLPAQVKTPEDVLRYGKEMIARFR
(restricted) Ga0255334_102570813300031237Sandy SoilDPGEIETLARQGIARVAVPVSNAAGLPAQVKTPDDVLRYGKDVIARFR
Ga0318516_1008826313300031543SoilTVAAPTEASEIEALGRQGIARVAVPVSNAAGLPAQVKTPDDVLRYGKEMIARFR
Ga0318534_10001020123300031544SoilTEASEIEALGRQGIARVAVPVSNAAGLPAQVKTPDDVLRYGKEMIARFR
Ga0318538_1058091623300031546SoilARRGVRRVAVPVSSAAGLPAQVRTPDDVLRYGKTMIERFRE
Ga0318515_1010698653300031572SoilSEIEALGRQGIARVAVPVSNAAGLPAQVKTPDDVLRYGKEMIARFR
Ga0310915_1031657713300031573SoilKRVAVPVSAAAGLPAQVRTPDDVLRYGKTMIERFRD
Ga0318561_1062515823300031679SoilAGSPAAEPAEIEALARRGVRRVAVPVSSAAGLPAQVRTPDDVLRYGKTMIERFRE
Ga0318572_1032791413300031681SoilVAAPTEASEIEALGRQGIARVAVPVSNAAGLPAQVKTPDDVLRYGKEMIARFR
Ga0310813_1003285013300031716SoilEAAPADVAEIEELARQGVARVAVPVSAAAGLPAQVKTPDDVLRYGKDVIARFR
Ga0307469_1235763513300031720Hardwood Forest SoilAKRGVARVAVPVSAAAGLPAQVKTPDDVLRYGKEMIARFR
Ga0307468_10086729313300031740Hardwood Forest SoilRDPAEIEITVAAPVALAEIEALAARGIARVAVPVSGAAGLPAQVRTPDDVLRYGRDVIARFR
Ga0307468_10136794523300031740Hardwood Forest SoilKTIEITVAAPADPAEIEGLARQGIARVAVPVSAAAGLPAQVRTPEDVVRYGKDVIARFR
Ga0318566_1001246513300031779SoilEALARKGVTRVAVPVSSAAGLPSQVKTPDDVLRYGKEMIARFR
Ga0307413_1183506323300031824RhizospherePAEIEALARMGVSRVAVPVSSGAGLPAQVKTPDDVLRYGRTMIARFRD
Ga0307410_1184066613300031852RhizosphereVPADVAAIEALGKQGVGRVAVPVSSLAGTNVQLRTPDDVLRYGRDVIARLRD
Ga0310892_1096183923300031858SoilPKGIEITLAAPAEPAEIETLARQGVARVAVPISAAAGLPAQLKTPEDVLRYGREVIARFR
Ga0318495_1004178813300031860SoilAEPAEIEALARRGVRRVAVPVSSAAGLPAQVRTPDDVLRYGKTMIERFRE
Ga0310902_1018235313300032012SoilLLDEMRRAAEAAGRDPKGIEITLAAPAEPAEIETLARQGVARVAVPISAAAGLPAQLKTPEDVLRYGREVIARFR
Ga0318556_1013116113300032043SoilALARRGVKRVAVPVSAAAGLPAQVRTPDDVLRYGKTMIERFRD
Ga0318518_1005863813300032090SoilEALGRQGIARVAVPVSNAAGLPAQVKTPDDVLRYGKEMIARFR
Ga0307470_1063384013300032174Hardwood Forest SoilGVARVAVPVSAAAGLPAQVKTPDDVLRYGKEMIARFR
Ga0307470_1187122923300032174Hardwood Forest SoilDPAEIEALARQGITRVGVPVSAAAGLPAQVKTPDDVLRYGRDVIARFR
Ga0307471_10005487913300032180Hardwood Forest SoilAEAAGRDPGAIEITVAAPPEPAEIEALARRGVARVAVPVSAAAGLPAQVKTPEDVLRYGKEMIARFR
Ga0307471_10029946113300032180Hardwood Forest SoilRRAAEAAGRDPKTIEITVAAPADPAEIEGLARQGIARVAVPVSAAAGLPAQVKTPEDVLRYGKDVIARFG
Ga0307472_10266208723300032205Hardwood Forest SoilSAPTEPAEIEALARRGVKRVAVPVSAAAGLPAQVRTPDDVLRYGKTMIERFRD
Ga0335070_1004510013300032829SoilLARQGVARFAVPVSAAAGLPAQVKTPDDVLRYGKDVIARFR
Ga0335083_1032055313300032954SoilQGIARVAVPISNAAGLPAQVRTPDDVLRYGKDVIARFR
Ga0310914_1147279813300033289SoilVTRVAVPVSSAAGLPSQVKTPDDVLRYGKEMIARFR
Ga0326731_115658023300033502Peat SoilITVSAPTEPAEIEALARRGVKRVAVPVSGAAGLPAQVRTPDDVLRYGKTMIERFRD
Ga0247829_1044816313300033550SoilTGEIEALARQGVTRVAVPISSGAGLPAQVKTPDDVLRYGKDMIARFDR
Ga0247829_1116735323300033550SoilFDLGRQGVARVAVPISAAAGLPAQLKTPEDVLRYGREVIARFR
Ga0247830_1037436413300033551SoilEIEALARAGVTRVAVPVSSGAGLPAQVKTPDDVLQYGKNVIARFDR
Ga0364942_0259138_6_1193300034165SedimentVTRVAVPVSSAAGQPAQVKTPDDVLRYGKTVIARLRD
Ga0364923_0071764_2_1333300034690SedimentEARARQGVARVAVPVSAAAGLPAQVRTPDDVLRYGKDVIARFR


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.