| Basic Information | |
|---|---|
| Family ID | F015088 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 257 |
| Average Sequence Length | 45 residues |
| Representative Sequence | GGWLGGAIVFVHGMRVLSLVDEPPARAVAPAPHPEKEEAEA |
| Number of Associated Samples | 213 |
| Number of Associated Scaffolds | 257 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 1.17 % |
| % of genes near scaffold ends (potentially truncated) | 96.50 % |
| % of genes from short scaffolds (< 2000 bps) | 93.77 % |
| Associated GOLD sequencing projects | 203 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.39 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (96.498 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (23.346 % of family members) |
| Environment Ontology (ENVO) | Unclassified (27.626 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (57.588 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 37.68% β-sheet: 0.00% Coil/Unstructured: 62.32% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.39 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 257 Family Scaffolds |
|---|---|---|
| PF00085 | Thioredoxin | 64.98 |
| PF00133 | tRNA-synt_1 | 14.40 |
| PF02735 | Ku | 3.11 |
| PF07098 | DUF1360 | 1.56 |
| PF00484 | Pro_CA | 1.17 |
| PF00106 | adh_short | 0.78 |
| PF01510 | Amidase_2 | 0.78 |
| PF00487 | FA_desaturase | 0.78 |
| PF13185 | GAF_2 | 0.78 |
| PF05988 | DUF899 | 0.39 |
| PF01594 | AI-2E_transport | 0.39 |
| PF02776 | TPP_enzyme_N | 0.39 |
| PF02622 | DUF179 | 0.39 |
| PF02786 | CPSase_L_D2 | 0.39 |
| PF13417 | GST_N_3 | 0.39 |
| PF12697 | Abhydrolase_6 | 0.39 |
| PF02913 | FAD-oxidase_C | 0.39 |
| PF06262 | Zincin_1 | 0.39 |
| PF04295 | GD_AH_C | 0.39 |
| PF00005 | ABC_tran | 0.39 |
| PF00392 | GntR | 0.39 |
| PF03729 | DUF308 | 0.39 |
| PF13186 | SPASM | 0.39 |
| PF10944 | DUF2630 | 0.39 |
| PF08281 | Sigma70_r4_2 | 0.39 |
| PF08264 | Anticodon_1 | 0.39 |
| PF13458 | Peripla_BP_6 | 0.39 |
| PF00196 | GerE | 0.39 |
| PF13561 | adh_short_C2 | 0.39 |
| COG ID | Name | Functional Category | % Frequency in 257 Family Scaffolds |
|---|---|---|---|
| COG0060 | Isoleucyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 14.40 |
| COG0143 | Methionyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 14.40 |
| COG0495 | Leucyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 14.40 |
| COG0525 | Valyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 14.40 |
| COG1273 | Non-homologous end joining protein Ku, dsDNA break repair | Replication, recombination and repair [L] | 3.11 |
| COG0288 | Carbonic anhydrase | Inorganic ion transport and metabolism [P] | 1.17 |
| COG1398 | Fatty-acid desaturase | Lipid transport and metabolism [I] | 0.78 |
| COG3239 | Fatty acid desaturase | Lipid transport and metabolism [I] | 0.78 |
| COG0277 | FAD/FMN-containing lactate dehydrogenase/glycolate oxidase | Energy production and conversion [C] | 0.39 |
| COG0628 | Predicted PurR-regulated permease PerM | General function prediction only [R] | 0.39 |
| COG1678 | Putative transcriptional regulator, AlgH/UPF0301 family | Transcription [K] | 0.39 |
| COG2721 | Altronate dehydratase | Carbohydrate transport and metabolism [G] | 0.39 |
| COG3247 | Acid resistance membrane protein HdeD, DUF308 family | General function prediction only [R] | 0.39 |
| COG3824 | Predicted Zn-dependent protease, minimal metalloprotease (MMP)-like domain | Posttranslational modification, protein turnover, chaperones [O] | 0.39 |
| COG4312 | Predicted dithiol-disulfide oxidoreductase, DUF899 family | General function prediction only [R] | 0.39 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 96.50 % |
| Unclassified | root | N/A | 3.50 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2067725001|GPWNP_F5MPXY301DUFL2 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 512 | Open in IMG/M |
| 3300000044|ARSoilOldRDRAFT_c004853 | All Organisms → cellular organisms → Bacteria | 1138 | Open in IMG/M |
| 3300000891|JGI10214J12806_10172261 | All Organisms → cellular organisms → Bacteria | 723 | Open in IMG/M |
| 3300000956|JGI10216J12902_108248094 | All Organisms → cellular organisms → Bacteria | 791 | Open in IMG/M |
| 3300000956|JGI10216J12902_109300202 | All Organisms → cellular organisms → Bacteria | 811 | Open in IMG/M |
| 3300000956|JGI10216J12902_110932537 | All Organisms → cellular organisms → Bacteria | 687 | Open in IMG/M |
| 3300001305|C688J14111_10021749 | All Organisms → cellular organisms → Bacteria | 1896 | Open in IMG/M |
| 3300001305|C688J14111_10115762 | All Organisms → cellular organisms → Bacteria | 819 | Open in IMG/M |
| 3300001535|A3PFW1_10047315 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 2397 | Open in IMG/M |
| 3300001538|A10PFW1_10140571 | All Organisms → cellular organisms → Bacteria | 3739 | Open in IMG/M |
| 3300002568|C688J35102_119193483 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 652 | Open in IMG/M |
| 3300004081|Ga0063454_100287508 | All Organisms → cellular organisms → Bacteria | 1017 | Open in IMG/M |
| 3300004153|Ga0063455_101442676 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 533 | Open in IMG/M |
| 3300005171|Ga0066677_10483274 | All Organisms → cellular organisms → Bacteria | 711 | Open in IMG/M |
| 3300005181|Ga0066678_10175650 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1355 | Open in IMG/M |
| 3300005181|Ga0066678_10366645 | All Organisms → cellular organisms → Bacteria | 952 | Open in IMG/M |
| 3300005184|Ga0066671_10121458 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 1482 | Open in IMG/M |
| 3300005184|Ga0066671_11026587 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 518 | Open in IMG/M |
| 3300005186|Ga0066676_11121021 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 518 | Open in IMG/M |
| 3300005186|Ga0066676_11142275 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 512 | Open in IMG/M |
| 3300005332|Ga0066388_107344193 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 553 | Open in IMG/M |
| 3300005344|Ga0070661_101355479 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 598 | Open in IMG/M |
| 3300005345|Ga0070692_10550588 | All Organisms → cellular organisms → Bacteria | 756 | Open in IMG/M |
| 3300005355|Ga0070671_102048680 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 510 | Open in IMG/M |
| 3300005366|Ga0070659_100613687 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 936 | Open in IMG/M |
| 3300005456|Ga0070678_100945490 | All Organisms → cellular organisms → Bacteria | 790 | Open in IMG/M |
| 3300005458|Ga0070681_10342665 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1404 | Open in IMG/M |
| 3300005471|Ga0070698_101622158 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 599 | Open in IMG/M |
| 3300005546|Ga0070696_101787160 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 531 | Open in IMG/M |
| 3300005549|Ga0070704_100380092 | All Organisms → cellular organisms → Bacteria | 1200 | Open in IMG/M |
| 3300005557|Ga0066704_10547195 | All Organisms → cellular organisms → Bacteria | 755 | Open in IMG/M |
| 3300005560|Ga0066670_10390600 | All Organisms → cellular organisms → Bacteria | 852 | Open in IMG/M |
| 3300005560|Ga0066670_10478516 | All Organisms → cellular organisms → Bacteria | 767 | Open in IMG/M |
| 3300005561|Ga0066699_10965994 | Not Available | 591 | Open in IMG/M |
| 3300005561|Ga0066699_11148916 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 534 | Open in IMG/M |
| 3300005561|Ga0066699_11255524 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 508 | Open in IMG/M |
| 3300005564|Ga0070664_101558687 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 625 | Open in IMG/M |
| 3300005569|Ga0066705_10847254 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 544 | Open in IMG/M |
| 3300005574|Ga0066694_10367329 | All Organisms → cellular organisms → Bacteria | 680 | Open in IMG/M |
| 3300005576|Ga0066708_10391928 | All Organisms → cellular organisms → Bacteria | 891 | Open in IMG/M |
| 3300005576|Ga0066708_10481296 | All Organisms → cellular organisms → Bacteria | 799 | Open in IMG/M |
| 3300005587|Ga0066654_10312681 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 846 | Open in IMG/M |
| 3300005718|Ga0068866_10543121 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 776 | Open in IMG/M |
| 3300005764|Ga0066903_100752385 | All Organisms → cellular organisms → Bacteria | 1731 | Open in IMG/M |
| 3300005889|Ga0075290_1063134 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 525 | Open in IMG/M |
| 3300005905|Ga0075269_10108297 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 534 | Open in IMG/M |
| 3300006032|Ga0066696_10790638 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
| 3300006032|Ga0066696_10807365 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 599 | Open in IMG/M |
| 3300006034|Ga0066656_10550738 | All Organisms → cellular organisms → Bacteria | 749 | Open in IMG/M |
| 3300006034|Ga0066656_10585301 | All Organisms → cellular organisms → Bacteria | 723 | Open in IMG/M |
| 3300006049|Ga0075417_10448928 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 643 | Open in IMG/M |
| 3300006051|Ga0075364_10781614 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
| 3300006058|Ga0075432_10153312 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 887 | Open in IMG/M |
| 3300006573|Ga0074055_10009844 | All Organisms → cellular organisms → Bacteria | 878 | Open in IMG/M |
| 3300006581|Ga0074048_13467624 | All Organisms → cellular organisms → Bacteria | 1195 | Open in IMG/M |
| 3300006606|Ga0074062_10037781 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 505 | Open in IMG/M |
| 3300006791|Ga0066653_10413095 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 690 | Open in IMG/M |
| 3300006796|Ga0066665_10206960 | All Organisms → cellular organisms → Bacteria | 1527 | Open in IMG/M |
| 3300006797|Ga0066659_10807786 | All Organisms → cellular organisms → Bacteria | 777 | Open in IMG/M |
| 3300006797|Ga0066659_11930128 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 502 | Open in IMG/M |
| 3300006800|Ga0066660_10007632 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 5597 | Open in IMG/M |
| 3300006800|Ga0066660_10186295 | All Organisms → cellular organisms → Bacteria | 1570 | Open in IMG/M |
| 3300006844|Ga0075428_101888189 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 621 | Open in IMG/M |
| 3300006854|Ga0075425_100620286 | All Organisms → cellular organisms → Bacteria | 1244 | Open in IMG/M |
| 3300006871|Ga0075434_101084842 | All Organisms → cellular organisms → Bacteria | 814 | Open in IMG/M |
| 3300006881|Ga0068865_100745312 | All Organisms → cellular organisms → Bacteria | 841 | Open in IMG/M |
| 3300006914|Ga0075436_100296201 | All Organisms → cellular organisms → Bacteria | 1159 | Open in IMG/M |
| 3300006969|Ga0075419_10785855 | All Organisms → cellular organisms → Bacteria | 680 | Open in IMG/M |
| 3300009012|Ga0066710_100002856 | All Organisms → cellular organisms → Bacteria | 14278 | Open in IMG/M |
| 3300009100|Ga0075418_11032808 | All Organisms → cellular organisms → Bacteria | 890 | Open in IMG/M |
| 3300009137|Ga0066709_102357327 | All Organisms → cellular organisms → Bacteria | 726 | Open in IMG/M |
| 3300009137|Ga0066709_104128011 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 528 | Open in IMG/M |
| 3300009176|Ga0105242_11055115 | All Organisms → cellular organisms → Bacteria | 824 | Open in IMG/M |
| 3300009176|Ga0105242_11312507 | All Organisms → cellular organisms → Bacteria | 748 | Open in IMG/M |
| 3300009610|Ga0105340_1151175 | All Organisms → cellular organisms → Bacteria | 957 | Open in IMG/M |
| 3300010037|Ga0126304_10561819 | All Organisms → cellular organisms → Bacteria | 768 | Open in IMG/M |
| 3300010041|Ga0126312_10031482 | All Organisms → cellular organisms → Bacteria | 3544 | Open in IMG/M |
| 3300010117|Ga0127449_1094166 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 511 | Open in IMG/M |
| 3300010122|Ga0127488_1139368 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 503 | Open in IMG/M |
| 3300010146|Ga0126320_1308236 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 512 | Open in IMG/M |
| 3300010154|Ga0127503_10376357 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 799 | Open in IMG/M |
| 3300010166|Ga0126306_10344644 | Not Available | 1156 | Open in IMG/M |
| 3300010303|Ga0134082_10165141 | All Organisms → cellular organisms → Bacteria | 899 | Open in IMG/M |
| 3300010325|Ga0134064_10511945 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 500 | Open in IMG/M |
| 3300010371|Ga0134125_10755677 | All Organisms → cellular organisms → Bacteria | 1071 | Open in IMG/M |
| 3300010396|Ga0134126_11305744 | All Organisms → cellular organisms → Bacteria | 804 | Open in IMG/M |
| 3300010399|Ga0134127_10091088 | All Organisms → cellular organisms → Bacteria | 2645 | Open in IMG/M |
| 3300011332|Ga0126317_10186939 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 542 | Open in IMG/M |
| 3300011971|Ga0120175_1006895 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1720 | Open in IMG/M |
| 3300012011|Ga0120152_1002854 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 8761 | Open in IMG/M |
| 3300012014|Ga0120159_1010926 | All Organisms → cellular organisms → Bacteria | 3800 | Open in IMG/M |
| 3300012187|Ga0136622_10304057 | All Organisms → cellular organisms → Bacteria | 669 | Open in IMG/M |
| 3300012198|Ga0137364_10638177 | All Organisms → cellular organisms → Bacteria | 803 | Open in IMG/M |
| 3300012203|Ga0137399_11186380 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 643 | Open in IMG/M |
| 3300012204|Ga0137374_10002012 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 23808 | Open in IMG/M |
| 3300012207|Ga0137381_10280945 | All Organisms → cellular organisms → Bacteria | 1448 | Open in IMG/M |
| 3300012208|Ga0137376_10610921 | All Organisms → cellular organisms → Bacteria | 943 | Open in IMG/M |
| 3300012208|Ga0137376_10662698 | All Organisms → cellular organisms → Bacteria | 901 | Open in IMG/M |
| 3300012212|Ga0150985_114878830 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 523 | Open in IMG/M |
| 3300012285|Ga0137370_10293027 | All Organisms → cellular organisms → Bacteria | 970 | Open in IMG/M |
| 3300012350|Ga0137372_10318269 | All Organisms → cellular organisms → Bacteria | 1201 | Open in IMG/M |
| 3300012353|Ga0137367_10790507 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 659 | Open in IMG/M |
| 3300012354|Ga0137366_10325014 | All Organisms → cellular organisms → Bacteria | 1129 | Open in IMG/M |
| 3300012356|Ga0137371_10939638 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 657 | Open in IMG/M |
| 3300012356|Ga0137371_11079261 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 605 | Open in IMG/M |
| 3300012358|Ga0137368_10060292 | All Organisms → cellular organisms → Bacteria | 3145 | Open in IMG/M |
| 3300012359|Ga0137385_10801030 | All Organisms → cellular organisms → Bacteria | 783 | Open in IMG/M |
| 3300012360|Ga0137375_10439756 | All Organisms → cellular organisms → Bacteria | 1127 | Open in IMG/M |
| 3300012360|Ga0137375_11203208 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 580 | Open in IMG/M |
| 3300012373|Ga0134042_1006458 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 522 | Open in IMG/M |
| 3300012374|Ga0134039_1185140 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 504 | Open in IMG/M |
| 3300012375|Ga0134034_1015154 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 508 | Open in IMG/M |
| 3300012378|Ga0134025_1213086 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 506 | Open in IMG/M |
| 3300012395|Ga0134044_1246599 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 517 | Open in IMG/M |
| 3300012397|Ga0134056_1171815 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 568 | Open in IMG/M |
| 3300012402|Ga0134059_1219950 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 525 | Open in IMG/M |
| 3300012403|Ga0134049_1188698 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 524 | Open in IMG/M |
| 3300012406|Ga0134053_1333096 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 539 | Open in IMG/M |
| 3300012407|Ga0134050_1178479 | All Organisms → cellular organisms → Bacteria | 875 | Open in IMG/M |
| 3300012407|Ga0134050_1195987 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 517 | Open in IMG/M |
| 3300012409|Ga0134045_1318865 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 566 | Open in IMG/M |
| 3300012469|Ga0150984_104236898 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 544 | Open in IMG/M |
| 3300012469|Ga0150984_108816758 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 503 | Open in IMG/M |
| 3300012489|Ga0157349_1028510 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 570 | Open in IMG/M |
| 3300012492|Ga0157335_1008746 | All Organisms → cellular organisms → Bacteria | 783 | Open in IMG/M |
| 3300012527|Ga0136633_1058172 | All Organisms → cellular organisms → Bacteria | 1677 | Open in IMG/M |
| 3300012527|Ga0136633_1289927 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 594 | Open in IMG/M |
| 3300012532|Ga0137373_10239106 | All Organisms → cellular organisms → Bacteria | 1472 | Open in IMG/M |
| 3300012532|Ga0137373_10620534 | All Organisms → cellular organisms → Bacteria | 813 | Open in IMG/M |
| 3300012897|Ga0157285_10049996 | All Organisms → cellular organisms → Bacteria | 1016 | Open in IMG/M |
| 3300012897|Ga0157285_10113418 | All Organisms → cellular organisms → Bacteria | 763 | Open in IMG/M |
| 3300012906|Ga0157295_10202874 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 634 | Open in IMG/M |
| 3300012912|Ga0157306_10207282 | All Organisms → cellular organisms → Bacteria | 663 | Open in IMG/M |
| 3300012913|Ga0157298_10320602 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 558 | Open in IMG/M |
| 3300012915|Ga0157302_10142559 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 806 | Open in IMG/M |
| 3300012960|Ga0164301_10228101 | All Organisms → cellular organisms → Bacteria | 1208 | Open in IMG/M |
| 3300012971|Ga0126369_11804150 | All Organisms → cellular organisms → Bacteria | 700 | Open in IMG/M |
| 3300012976|Ga0134076_10221423 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 799 | Open in IMG/M |
| 3300012976|Ga0134076_10465716 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 572 | Open in IMG/M |
| 3300012976|Ga0134076_10586706 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 519 | Open in IMG/M |
| 3300013102|Ga0157371_10376849 | All Organisms → cellular organisms → Bacteria | 1036 | Open in IMG/M |
| 3300013296|Ga0157374_10399717 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1371 | Open in IMG/M |
| 3300013297|Ga0157378_10210717 | All Organisms → cellular organisms → Bacteria | 1842 | Open in IMG/M |
| 3300013501|Ga0120154_1000461 | All Organisms → cellular organisms → Bacteria | 16965 | Open in IMG/M |
| 3300013501|Ga0120154_1018952 | All Organisms → cellular organisms → Bacteria | 1808 | Open in IMG/M |
| 3300013501|Ga0120154_1099463 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 666 | Open in IMG/M |
| 3300013765|Ga0120172_1045456 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1151 | Open in IMG/M |
| 3300013770|Ga0120123_1005869 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2298 | Open in IMG/M |
| 3300014157|Ga0134078_10348712 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 650 | Open in IMG/M |
| 3300014487|Ga0182000_10297866 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 671 | Open in IMG/M |
| 3300014488|Ga0182001_10100888 | All Organisms → cellular organisms → Bacteria | 896 | Open in IMG/M |
| 3300014745|Ga0157377_10166540 | All Organisms → cellular organisms → Bacteria | 1375 | Open in IMG/M |
| 3300015201|Ga0173478_10162625 | Not Available | 900 | Open in IMG/M |
| 3300015261|Ga0182006_1097844 | All Organisms → cellular organisms → Bacteria | 1046 | Open in IMG/M |
| 3300015359|Ga0134085_10570041 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 524 | Open in IMG/M |
| 3300015372|Ga0132256_103293085 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 543 | Open in IMG/M |
| 3300015373|Ga0132257_101685768 | All Organisms → cellular organisms → Bacteria | 812 | Open in IMG/M |
| 3300015374|Ga0132255_102608608 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 772 | Open in IMG/M |
| 3300017997|Ga0184610_1116081 | All Organisms → cellular organisms → Bacteria | 859 | Open in IMG/M |
| 3300018031|Ga0184634_10240713 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 828 | Open in IMG/M |
| 3300018071|Ga0184618_10420076 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
| 3300018076|Ga0184609_10075633 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1481 | Open in IMG/M |
| 3300018433|Ga0066667_10939270 | Not Available | 745 | Open in IMG/M |
| 3300018433|Ga0066667_11039423 | All Organisms → cellular organisms → Bacteria | 707 | Open in IMG/M |
| 3300018482|Ga0066669_10980538 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 762 | Open in IMG/M |
| 3300019259|Ga0184646_1249428 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 552 | Open in IMG/M |
| 3300019279|Ga0184642_1421424 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 507 | Open in IMG/M |
| 3300020018|Ga0193721_1148405 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 567 | Open in IMG/M |
| 3300020080|Ga0206350_11457087 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 601 | Open in IMG/M |
| 3300020082|Ga0206353_10163267 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 540 | Open in IMG/M |
| 3300021080|Ga0210382_10003456 | All Organisms → cellular organisms → Bacteria | 5093 | Open in IMG/M |
| 3300021080|Ga0210382_10124024 | All Organisms → cellular organisms → Bacteria | 1093 | Open in IMG/M |
| 3300021384|Ga0213876_10548937 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 615 | Open in IMG/M |
| 3300022694|Ga0222623_10353350 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 561 | Open in IMG/M |
| 3300022756|Ga0222622_10815828 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 682 | Open in IMG/M |
| 3300022886|Ga0247746_1132466 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 627 | Open in IMG/M |
| 3300025912|Ga0207707_11012175 | Not Available | 681 | Open in IMG/M |
| 3300025912|Ga0207707_11534869 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 527 | Open in IMG/M |
| 3300025913|Ga0207695_11088126 | Not Available | 679 | Open in IMG/M |
| 3300025917|Ga0207660_11548102 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 535 | Open in IMG/M |
| 3300025918|Ga0207662_10430676 | Not Available | 899 | Open in IMG/M |
| 3300025920|Ga0207649_10556653 | All Organisms → cellular organisms → Bacteria | 878 | Open in IMG/M |
| 3300025923|Ga0207681_10285656 | All Organisms → cellular organisms → Bacteria | 1301 | Open in IMG/M |
| 3300025938|Ga0207704_10913652 | All Organisms → cellular organisms → Bacteria | 739 | Open in IMG/M |
| 3300026023|Ga0207677_10259360 | All Organisms → cellular organisms → Bacteria | 1416 | Open in IMG/M |
| 3300026078|Ga0207702_11730439 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 618 | Open in IMG/M |
| 3300026111|Ga0208291_1093335 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Acidothermales → Acidothermaceae → Acidothermus → Acidothermus cellulolyticus | 527 | Open in IMG/M |
| 3300026121|Ga0207683_11445800 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 635 | Open in IMG/M |
| 3300026312|Ga0209153_1135568 | All Organisms → cellular organisms → Bacteria | 930 | Open in IMG/M |
| 3300026326|Ga0209801_1183989 | All Organisms → cellular organisms → Bacteria | 855 | Open in IMG/M |
| 3300026326|Ga0209801_1198899 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 805 | Open in IMG/M |
| 3300026330|Ga0209473_1283198 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 557 | Open in IMG/M |
| 3300026331|Ga0209267_1313635 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 520 | Open in IMG/M |
| 3300026342|Ga0209057_1012215 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5257 | Open in IMG/M |
| 3300026536|Ga0209058_1341433 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 518 | Open in IMG/M |
| 3300026538|Ga0209056_10706142 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 510 | Open in IMG/M |
| 3300026552|Ga0209577_10067097 | All Organisms → cellular organisms → Bacteria | 2979 | Open in IMG/M |
| 3300027787|Ga0209074_10498748 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 528 | Open in IMG/M |
| 3300028597|Ga0247820_10707551 | All Organisms → cellular organisms → Bacteria | 702 | Open in IMG/M |
| 3300028710|Ga0307322_10011303 | All Organisms → cellular organisms → Bacteria | 1979 | Open in IMG/M |
| 3300028710|Ga0307322_10116015 | All Organisms → cellular organisms → Bacteria | 696 | Open in IMG/M |
| 3300028711|Ga0307293_10033263 | All Organisms → cellular organisms → Bacteria | 1566 | Open in IMG/M |
| 3300028712|Ga0307285_10075557 | All Organisms → cellular organisms → Bacteria | 867 | Open in IMG/M |
| 3300028716|Ga0307311_10155373 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 659 | Open in IMG/M |
| 3300028717|Ga0307298_10089384 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 869 | Open in IMG/M |
| 3300028721|Ga0307315_10043674 | All Organisms → cellular organisms → Bacteria | 1232 | Open in IMG/M |
| 3300028744|Ga0307318_10287131 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 576 | Open in IMG/M |
| 3300028744|Ga0307318_10348798 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 521 | Open in IMG/M |
| 3300028754|Ga0307297_10171004 | All Organisms → cellular organisms → Bacteria | 749 | Open in IMG/M |
| 3300028755|Ga0307316_10158482 | All Organisms → cellular organisms → Bacteria | 808 | Open in IMG/M |
| 3300028771|Ga0307320_10149644 | All Organisms → cellular organisms → Bacteria | 902 | Open in IMG/M |
| 3300028771|Ga0307320_10309263 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 628 | Open in IMG/M |
| 3300028778|Ga0307288_10407413 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces mirabilis | 554 | Open in IMG/M |
| 3300028784|Ga0307282_10200334 | All Organisms → cellular organisms → Bacteria | 954 | Open in IMG/M |
| 3300028787|Ga0307323_10254225 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 633 | Open in IMG/M |
| 3300028791|Ga0307290_10147809 | All Organisms → cellular organisms → Bacteria | 860 | Open in IMG/M |
| 3300028793|Ga0307299_10153887 | All Organisms → cellular organisms → Bacteria | 865 | Open in IMG/M |
| 3300028796|Ga0307287_10077436 | All Organisms → cellular organisms → Bacteria | 1245 | Open in IMG/M |
| 3300028799|Ga0307284_10331005 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 615 | Open in IMG/M |
| 3300028802|Ga0307503_10688844 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 573 | Open in IMG/M |
| 3300028807|Ga0307305_10190302 | All Organisms → cellular organisms → Bacteria | 944 | Open in IMG/M |
| 3300028810|Ga0307294_10071244 | All Organisms → cellular organisms → Bacteria | 1052 | Open in IMG/M |
| 3300028814|Ga0307302_10046805 | All Organisms → cellular organisms → Bacteria | 2010 | Open in IMG/M |
| 3300028819|Ga0307296_10518847 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 652 | Open in IMG/M |
| 3300028819|Ga0307296_10621160 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 591 | Open in IMG/M |
| 3300028828|Ga0307312_10117813 | All Organisms → cellular organisms → Bacteria | 1662 | Open in IMG/M |
| 3300028872|Ga0307314_10211318 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 588 | Open in IMG/M |
| 3300028878|Ga0307278_10282763 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 734 | Open in IMG/M |
| 3300028878|Ga0307278_10318508 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 687 | Open in IMG/M |
| 3300028878|Ga0307278_10541917 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 507 | Open in IMG/M |
| 3300028884|Ga0307308_10071123 | All Organisms → cellular organisms → Bacteria | 1643 | Open in IMG/M |
| 3300028884|Ga0307308_10105784 | All Organisms → cellular organisms → Bacteria | 1340 | Open in IMG/M |
| 3300028885|Ga0307304_10396116 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 623 | Open in IMG/M |
| 3300030902|Ga0308202_1119656 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 562 | Open in IMG/M |
| 3300030902|Ga0308202_1155445 | Not Available | 512 | Open in IMG/M |
| 3300030903|Ga0308206_1146592 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 565 | Open in IMG/M |
| 3300031058|Ga0308189_10546220 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 505 | Open in IMG/M |
| 3300031092|Ga0308204_10116301 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 756 | Open in IMG/M |
| 3300031092|Ga0308204_10343401 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 512 | Open in IMG/M |
| 3300031093|Ga0308197_10311563 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 584 | Open in IMG/M |
| 3300031094|Ga0308199_1183393 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 518 | Open in IMG/M |
| 3300031096|Ga0308193_1082413 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 530 | Open in IMG/M |
| 3300031099|Ga0308181_1145677 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 550 | Open in IMG/M |
| 3300031099|Ga0308181_1180310 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 510 | Open in IMG/M |
| 3300031170|Ga0307498_10245086 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 647 | Open in IMG/M |
| 3300031229|Ga0299913_11441332 | Not Available | 643 | Open in IMG/M |
| 3300031538|Ga0310888_10979407 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300031720|Ga0307469_12141164 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 544 | Open in IMG/M |
| 3300031996|Ga0308176_11131324 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 829 | Open in IMG/M |
| 3300032074|Ga0308173_11311956 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 678 | Open in IMG/M |
| 3300032126|Ga0307415_100323015 | All Organisms → cellular organisms → Bacteria | 1288 | Open in IMG/M |
| 3300032126|Ga0307415_102210443 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 538 | Open in IMG/M |
| 3300033412|Ga0310810_10263040 | All Organisms → cellular organisms → Bacteria | 1887 | Open in IMG/M |
| 3300034643|Ga0370545_059866 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 759 | Open in IMG/M |
| 3300034644|Ga0370548_111991 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 563 | Open in IMG/M |
| 3300034644|Ga0370548_132306 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 528 | Open in IMG/M |
| 3300034680|Ga0370541_043560 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 573 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 23.35% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 15.95% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 8.17% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 7.00% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 3.89% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.11% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.33% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 2.33% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.95% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 1.56% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.56% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.56% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.56% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.56% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.56% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.56% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 1.17% |
| Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 1.17% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.17% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 1.17% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.17% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.78% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.78% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.78% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.78% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.78% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.78% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.78% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.78% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.78% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.78% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.78% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.39% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.39% |
| Unplanted Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil | 0.39% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.39% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.39% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.39% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.39% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.39% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.39% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.39% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.39% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.39% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 0.39% |
| Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 0.39% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.39% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.39% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.39% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2067725001 | Soil microbial communities from Great Prairies - Wisconsin Native Prairie soil | Environmental | Open in IMG/M |
| 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis soil old | Host-Associated | Open in IMG/M |
| 3300000891 | Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001305 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
| 3300001535 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A3-PF-15A)- 1 week illumina | Environmental | Open in IMG/M |
| 3300001538 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A10-PF 4A)- 1 week illumina | Environmental | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300004081 | Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2) | Environmental | Open in IMG/M |
| 3300004153 | Grasslands soil microbial communities from Hopland, California, USA (version 2) | Environmental | Open in IMG/M |
| 3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
| 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
| 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005889 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_201 | Environmental | Open in IMG/M |
| 3300005905 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_0N_105 | Environmental | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006051 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Host-Associated | Open in IMG/M |
| 3300006058 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Host-Associated | Open in IMG/M |
| 3300006573 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAC (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006581 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006606 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009610 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT700 | Environmental | Open in IMG/M |
| 3300010037 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25 | Environmental | Open in IMG/M |
| 3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
| 3300010117 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_2_4_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010122 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_4_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010146 | Soil microbial communities from California, USA to study soil gas exchange rates - JR-CA-SND metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010154 | Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010166 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27 | Environmental | Open in IMG/M |
| 3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300011332 | Soil microbial communities from California, USA to study soil gas exchange rates - SR-CA-SC2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011971 | Permafrost microbial communities from Nunavut, Canada - A7_80cm_12M | Environmental | Open in IMG/M |
| 3300012011 | Permafrost microbial communities from Nunavut, Canada - A30_65cm_6M | Environmental | Open in IMG/M |
| 3300012014 | Permafrost microbial communities from Nunavut, Canada - A10_80cm_6M | Environmental | Open in IMG/M |
| 3300012187 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ448 (21.06) | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012358 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012373 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_0_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012374 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_8_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012375 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_8_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012378 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_16_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012395 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_8_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012397 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_24_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012402 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_8_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012403 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_8_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012406 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_4_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012407 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_16_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012409 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_16_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012489 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.5.yng.040610 | Environmental | Open in IMG/M |
| 3300012492 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 | Host-Associated | Open in IMG/M |
| 3300012527 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ83 (22.06) | Environmental | Open in IMG/M |
| 3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012897 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S074-202C-1 | Environmental | Open in IMG/M |
| 3300012906 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S212-509R-1 | Environmental | Open in IMG/M |
| 3300012912 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S163-409C-2 | Environmental | Open in IMG/M |
| 3300012913 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S043-104R-2 | Environmental | Open in IMG/M |
| 3300012915 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2 | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013501 | Permafrost microbial communities from Nunavut, Canada - A35_65cm_0.25M | Environmental | Open in IMG/M |
| 3300013765 | Permafrost microbial communities from Nunavut, Canada - A30_80cm_6M | Environmental | Open in IMG/M |
| 3300013770 | Permafrost microbial communities from Nunavut, Canada - A15_5cm_18M | Environmental | Open in IMG/M |
| 3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300014487 | Bulk soil microbial communities from Mexico - Magueyal (Ma) metaG | Environmental | Open in IMG/M |
| 3300014488 | Bulk soil microbial communities from Mexico - San Felipe (SF) metaG | Environmental | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300015201 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1 (version 2) | Environmental | Open in IMG/M |
| 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Host-Associated | Open in IMG/M |
| 3300015359 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015 | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300017997 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coex | Environmental | Open in IMG/M |
| 3300018031 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1 | Environmental | Open in IMG/M |
| 3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
| 3300018076 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019259 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019279 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020018 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2s2 | Environmental | Open in IMG/M |
| 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300021080 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redo | Environmental | Open in IMG/M |
| 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Host-Associated | Open in IMG/M |
| 3300022694 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coex | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300022886 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S079-202R-5 | Environmental | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026111 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_CattailB_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026312 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 (SPAdes) | Environmental | Open in IMG/M |
| 3300026326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes) | Environmental | Open in IMG/M |
| 3300026330 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes) | Environmental | Open in IMG/M |
| 3300026331 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 (SPAdes) | Environmental | Open in IMG/M |
| 3300026342 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 (SPAdes) | Environmental | Open in IMG/M |
| 3300026536 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes) | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
| 3300028597 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day14 | Environmental | Open in IMG/M |
| 3300028710 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_380 | Environmental | Open in IMG/M |
| 3300028711 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_150 | Environmental | Open in IMG/M |
| 3300028712 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_139 | Environmental | Open in IMG/M |
| 3300028716 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_198 | Environmental | Open in IMG/M |
| 3300028717 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_158 | Environmental | Open in IMG/M |
| 3300028721 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_355 | Environmental | Open in IMG/M |
| 3300028744 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_367 | Environmental | Open in IMG/M |
| 3300028754 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_157 | Environmental | Open in IMG/M |
| 3300028755 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_356 | Environmental | Open in IMG/M |
| 3300028771 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_369 | Environmental | Open in IMG/M |
| 3300028778 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_142 | Environmental | Open in IMG/M |
| 3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
| 3300028787 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_381 | Environmental | Open in IMG/M |
| 3300028791 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_144 | Environmental | Open in IMG/M |
| 3300028793 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159 | Environmental | Open in IMG/M |
| 3300028796 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_141 | Environmental | Open in IMG/M |
| 3300028799 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123 | Environmental | Open in IMG/M |
| 3300028802 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_S | Environmental | Open in IMG/M |
| 3300028807 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186 | Environmental | Open in IMG/M |
| 3300028810 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_151 | Environmental | Open in IMG/M |
| 3300028814 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183 | Environmental | Open in IMG/M |
| 3300028819 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153 | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300028872 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_204 | Environmental | Open in IMG/M |
| 3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
| 3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
| 3300028885 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185 | Environmental | Open in IMG/M |
| 3300030902 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_356 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030903 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_369 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031058 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_184 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031092 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_367 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031093 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_198 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031094 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_203 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031096 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_194 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031099 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_152 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031170 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_S | Environmental | Open in IMG/M |
| 3300031229 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT155D38 | Environmental | Open in IMG/M |
| 3300031538 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
| 3300032074 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1 | Environmental | Open in IMG/M |
| 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Host-Associated | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| 3300034643 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_120 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034644 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_123 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034680 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_116 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| GPWNP_02193410 | 2067725001 | Soil | SLVLTLVGYAVLAAGGWLGGAIVFVHGMRVLSLVDEPAAKAVSPIPSPEKEEAEGA |
| ARSoilOldRDRAFT_0048533 | 3300000044 | Arabidopsis Rhizosphere | AIVFTHGMRVLKLVDEPTSRAISPLPKPEKEEAEA* |
| JGI10214J12806_101722611 | 3300000891 | Soil | ALVFTHGMRVLKLVDEPTSRAISPLPKPEKEEAEA* |
| JGI10216J12902_1082480941 | 3300000956 | Soil | AIVFVHGMRVLNLVEEPAKRAMAPAGEEKAEAERS* |
| JGI10216J12902_1093002021 | 3300000956 | Soil | ALLTLGGWLGGAVVFTHGMRVLQLVDEPTKRAVAPVPLTEKEKAEA* |
| JGI10216J12902_1109325371 | 3300000956 | Soil | GGAITYVYGMRVLSLVEEPATRAAAPVPHEEKVEAEKS* |
| C688J14111_100217493 | 3300001305 | Soil | VYVHGMRVLNLVDEPADRAAAPVPHPEKEEAEGG* |
| C688J14111_101157623 | 3300001305 | Soil | GWLGGAVVYVHGMRVLSLTGEPPGRAVAPVPHPEKEMAEGG* |
| A3PFW1_100473155 | 3300001535 | Permafrost | AIVFVHGMRVLSLVKEPAARAAAPVPHPEKEMAEGS* |
| A10PFW1_101405711 | 3300001538 | Permafrost | VFVHGMRVLSLVKEPASRAAAPVPHPEKEMAEGS* |
| C688J35102_1191934833 | 3300002568 | Soil | GWLGGAIVYVHGMRVLSLVEEPTERAIAPVPHEEKEAAQA* |
| Ga0063454_1002875081 | 3300004081 | Soil | TLVGFAVLTLGGWLGGAVVFTHGMRVLSLVDEPTKRAVSPMPVPEMEEAEGGG* |
| Ga0063455_1014426761 | 3300004153 | Soil | LTLVGFCLLTLGGWLGGAVVFTHGMRVLSLVDEPTKRAVSPMPLPEKEEAEA* |
| Ga0066677_104832741 | 3300005171 | Soil | GWLGGAIVFVHGMRVLSLVDEPSLKAAAPVVTPEKEAAEGG* |
| Ga0066678_101756503 | 3300005181 | Soil | IGGWLGGAIVFVHGMRVLSLVGEPTERAVSPAPKPEKEAAEGG* |
| Ga0066678_103666451 | 3300005181 | Soil | FLFMTLGGWLGGAIVFVHGMRVLSLVSEPAERAVAPVPHAEKEQAEGG* |
| Ga0066671_101214581 | 3300005184 | Soil | GGWLGGAVVFVHGMRVLSLVDERALRAAAPLPHDEKVDAAED* |
| Ga0066671_110265871 | 3300005184 | Soil | LTLGGWLGGAIVFVHGMRVLSLTGEPPGRAVAPVPHPEKEEAEGA* |
| Ga0066676_111210211 | 3300005186 | Soil | GWLGGAIVFVHGMRVLSLTGEPPGRAVSPLPHPEKEEAEA* |
| Ga0066676_111422752 | 3300005186 | Soil | GFGFLTLGGWLGGAVVYVHGMRVLSLTGEPPGRAVSPVPHPEKEEAEGA* |
| Ga0066388_1073441931 | 3300005332 | Tropical Forest Soil | IGFALLTLGGWLGGALVFTHGNRVLKLVGAPTSMVSPPPKAEKEEAEA* |
| Ga0070661_1013554791 | 3300005344 | Corn Rhizosphere | WLGGAVVFVHGMRVLSLVDEPPDRAAAPVPHPEKEEAEA* |
| Ga0070692_105505881 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | LLTLGGWLGGAVVFTHGMRVLSLVDEPTKRAVSPMPLPEKEEAEGGG* |
| Ga0070671_1020486801 | 3300005355 | Switchgrass Rhizosphere | GGWLGGAIVFVHGMRVLSLVDEPPARAVAPAPHPEKEEAEA* |
| Ga0070659_1006136871 | 3300005366 | Corn Rhizosphere | GWLGGAVVFTHGMRVLALVDEPPGRAAIPGGAEKEEAEA* |
| Ga0070678_1009454903 | 3300005456 | Miscanthus Rhizosphere | GGWLGGAVVFTHGMRVLSLVDEPTKRAVSPMPLPEKEEAEGGG* |
| Ga0070681_103426651 | 3300005458 | Corn Rhizosphere | LGGAITYVHGMRVLSLVDEPALRAAAPLPHDEKVDAAED* |
| Ga0070698_1016221582 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | TLGGWLGGAIVFTHGMRVLKLKNEPAGRAVSPIPQAEKEQADGG* |
| Ga0070696_1017871601 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | GGWLGGAVVFTHGMRVLKLVDEPARRAAAPIPTPEKRDAEGA* |
| Ga0070704_1003800923 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | FAFLTLGGWLGGAVVFVHGMRVLSLVDEPPDRAAAPVPHPEKEEAEA* |
| Ga0066704_105471951 | 3300005557 | Soil | GGWLGGAIVFVHGMRVLSLVDEPSLKAAAPVVTPEKEAAEGG* |
| Ga0066670_103906001 | 3300005560 | Soil | TLGGWLGGAIVFVHGMRVLSLTGEPPGRAVAPVPHPEKEEAEGA* |
| Ga0066670_104785161 | 3300005560 | Soil | AVVYVHGMRVLSLVDEPPERAAAPVPHPEKEEAEA* |
| Ga0066699_109659942 | 3300005561 | Soil | GFGLLTLGGWLGGAIVFVHGMRVLSLVHEPASRAAAPIPHTEKEMAEGS* |
| Ga0066699_111489162 | 3300005561 | Soil | MTLGGWLGGAIVFVHGMRVLSLVQEPAERAVSPVPHAEKEQAEGG* |
| Ga0066699_112555242 | 3300005561 | Soil | GGSIVYVHGMRVLNLVTEPSHRAVAPVATPEKELAEKTS* |
| Ga0070664_1015586871 | 3300005564 | Corn Rhizosphere | LGFAFLTLGGWLGGAVVFVHGMRVLSLVGEPPDRAAAPVPHPEKEEAEA* |
| Ga0066705_108472542 | 3300005569 | Soil | LGGWLGGAIVFVHGMRVLSLTGEPPGRAIAPVPHPEKEEAEGA* |
| Ga0066694_103673291 | 3300005574 | Soil | WLGGSIVFVHGMRVLSLVDEPTARAIAPVVTPEKEEAAS* |
| Ga0066708_103919283 | 3300005576 | Soil | TLIGFGLLTLGGWLGGAVVFVHGMRVLSLVDEPAAKAVSPLPQPEKEEAEA* |
| Ga0066708_104812961 | 3300005576 | Soil | GSIVFVHGMRVLSLVQEPPGRAVSPVPKPEKEAAEGS* |
| Ga0066654_103126811 | 3300005587 | Soil | LTLIGFGLLTLGGWLGGAIVFVHGMRVLSLVHEPASRAAAPVPHPEKEMAEGS* |
| Ga0068866_105431211 | 3300005718 | Miscanthus Rhizosphere | AVVFTHGMRVLNLVDEPPERAAIPGGAEKEEAEA* |
| Ga0066903_1007523853 | 3300005764 | Tropical Forest Soil | VIGFGFLTLGGWLGGAIVFVHGMRVLSLVREHTARAVSPVPHPEQEMAQRG* |
| Ga0075290_10631342 | 3300005889 | Rice Paddy Soil | LLGFGFLTLGGWLGGSIVFVHGMRVLKLVDEPPDRAAAPVAHPEKEEAEA* |
| Ga0075269_101082972 | 3300005905 | Rice Paddy Soil | VVFVHGMRVLNLAEEPPSRAAAPVATPEKEEASVI* |
| Ga0066696_107906381 | 3300006032 | Soil | VVYVHGMRVLSLVEEPPGRAVAPVPHPEKEEASA* |
| Ga0066696_108073651 | 3300006032 | Soil | WLGGTIVFVHGMRVLSLVDEPAGRAVSPLPKPEKESAEGS* |
| Ga0066656_105507381 | 3300006034 | Soil | IVFVHGMRVLSLTGEPPGRAVSPLPHPEKEAAEGS* |
| Ga0066656_105853013 | 3300006034 | Soil | GGAVVFVHGMRVLSLVNEPAERAVAPVPHAEKEQAEGG* |
| Ga0075417_104489281 | 3300006049 | Populus Rhizosphere | VVFVHGMRVLSLIDEPPARAAAPAPHPEKEEAEN* |
| Ga0075364_107816141 | 3300006051 | Populus Endosphere | VGGAIVFVHGMRVLSLVDEPAGRAMAPTGEEKAEAERS* |
| Ga0075432_101533121 | 3300006058 | Populus Rhizosphere | LGGAVVFTHGMRVLDLVDEPPKRAAIPGGSEKKEAEA* |
| Ga0074055_100098441 | 3300006573 | Soil | GAIVFTHGMRVLKLVDEPTSRAVSPLPKPEKEEAEA* |
| Ga0074048_134676241 | 3300006581 | Soil | TLGGWLGGAIVFTHGMRVLSLVDEPTKRAVSPMPLPEKEEAEGGG* |
| Ga0074062_100377812 | 3300006606 | Soil | IVFTHGMRVLKLVDEPTSRAISPLPKPEKEEAEA* |
| Ga0066653_104130953 | 3300006791 | Soil | FGFLTLGGWLGGAIVFVHGMRVLSLTSEPPGRAVAPVPHPEKEEAEGG* |
| Ga0066665_102069603 | 3300006796 | Soil | TLGGWLGGAVVFVHGMRVLSLVDEPTARAVSPAPSPEKEEAEGG* |
| Ga0066659_108077861 | 3300006797 | Soil | ALTVVGFLFMTLGGWLGGAIVFVHGMRVLSLVSEPAERAVAPVPHAEKEQAEGG* |
| Ga0066659_119301282 | 3300006797 | Soil | LTVVGFGLMTLGGWLGGSIVFVHGMRVLSLVGEPTERAVSPVPKPEKEAAEGS* |
| Ga0066660_100076321 | 3300006800 | Soil | AITYVHGMRVLKLVDEPALRAAAPLPHDEKVDAAED* |
| Ga0066660_101862951 | 3300006800 | Soil | VSSGAYALTVIGFGFLTLGGWLGGAVVYVHGMRVLSLVDEPTQRAVAPVPHAEKERAEGS |
| Ga0075428_1018881891 | 3300006844 | Populus Rhizosphere | ILAFGGWVGGAIVFVHGMRVLSLVDEPAGRAMAPTGEEKAEAERS* |
| Ga0075425_1006202861 | 3300006854 | Populus Rhizosphere | VFVHGMRVLNLVEEPPARAAAPVPHPEKQEAEAG* |
| Ga0075434_1010848423 | 3300006871 | Populus Rhizosphere | IVFVHGMRVLNLVKEPTERAISPVPHAEKEMAEGG* |
| Ga0068865_1007453123 | 3300006881 | Miscanthus Rhizosphere | ILTLVGFGFLTLGGWLGGAVVFTHGMRVLQLVDEPPARAVAPVSHPEKQEAEGG* |
| Ga0075436_1002962013 | 3300006914 | Populus Rhizosphere | GGWLGGAVVFVHGMRVLSLVDEPPDRAAAPVPHPEKEEAEA* |
| Ga0075419_107858553 | 3300006969 | Populus Rhizosphere | IVFVHGMRVLSLVDEPAGRAMAPTGEEKAEAERS* |
| Ga0066710_1000028561 | 3300009012 | Grasslands Soil | GGAIVFVHGMRVLSLVSEPAERAVSPVPHAEKEQAEGG |
| Ga0075418_110328081 | 3300009100 | Populus Rhizosphere | VFGYGMRVLNLTKEPTERAIAPVAHPEKEMAEGS* |
| Ga0066709_1023573273 | 3300009137 | Grasslands Soil | TLGGWLGGAIVFVHGMRVLSLVEEPTERAVAPVSHPEKERAEGA* |
| Ga0066709_1041280112 | 3300009137 | Grasslands Soil | FGLLTLGGWLGGAIVFVHGMRVLSLIEEPAGRAVAPVVTPEKERAEGA* |
| Ga0105242_110551151 | 3300009176 | Miscanthus Rhizosphere | IVFVHGMRVLSLVDEPAGRAMAPAAHPEKKEAAEG* |
| Ga0105242_113125073 | 3300009176 | Miscanthus Rhizosphere | GGWLGGAVVFTHGMRVLNLADESPQRAALPGGSEKEEAEA* |
| Ga0105340_11511753 | 3300009610 | Soil | GSVVFVHGMRVLNLVDEPARRAAAPVATPEKREAEGA* |
| Ga0126304_105618193 | 3300010037 | Serpentine Soil | LLTAGGWLGGAVVYVHGMRVLKLVDEPAERAVAPVPHPEKEMAEGS* |
| Ga0126312_100314825 | 3300010041 | Serpentine Soil | GAVVFTHGMRVLNLVEEPTARAVTPGHPEKEHAEA* |
| Ga0127449_10941662 | 3300010117 | Grasslands Soil | FVLNLIGFGLLTLGGWLGDAVVYVHGMRVLSLVEEPPGRAVAPVPHPEKEEASA* |
| Ga0127488_11393682 | 3300010122 | Grasslands Soil | GFAVLTLGGWLGGAIVFTHGMRVLELVEEPTSRAISPLPKPEKEEAEA* |
| Ga0126320_13082361 | 3300010146 | Soil | ETGPFLLTLVGFGFLTLGGWLGGAIVFVHGMRVLSLTSEPPGRAVAPVPHPEKEEAEGG* |
| Ga0127503_103763573 | 3300010154 | Soil | GAFALTVAGFATMALGGWLGGAIVFVHGMRVLGLPKEPALRAVSPYPHEEKVAAQK* |
| Ga0126306_103446441 | 3300010166 | Serpentine Soil | LGGAVVFTHGMRVLNLVEEPTRRAVTPGHPEKEMAEE* |
| Ga0134082_101651411 | 3300010303 | Grasslands Soil | LGGWLGGAIVFVHGMRVLSLTGEPPGRAVAPVPHPEKEEAEGA* |
| Ga0134064_105119452 | 3300010325 | Grasslands Soil | WLGGSIVFVHGMRVLSLVQEPAGRAVSPVPKPEKEAAEGG* |
| Ga0134125_107556771 | 3300010371 | Terrestrial Soil | GGAIVFVHGMRVLSLPEEPSRRAIAPAPHPEKQAAEGA* |
| Ga0134126_113057443 | 3300010396 | Terrestrial Soil | FLTLGGWLGGAVVFVHGMRVLSLVDEPPDRAAAPVPHPEKEEAEA* |
| Ga0134127_100910883 | 3300010399 | Terrestrial Soil | GGAIVFVHGMRVLSLVDEPPARAVAPAPHPEKEEAEA* |
| Ga0126317_101869391 | 3300011332 | Soil | LVGFAFLTLGGWLGGAVVFVHGMRVLSLVDEPPDRAAAPVPHREKEEAEA* |
| Ga0120175_10068954 | 3300011971 | Permafrost | VSAGPFILTLIGFALLTLGGIFGGSIVFVHGMRVLKLKDEPAKEALSPLNQRKEQAEG* |
| Ga0120152_10028541 | 3300012011 | Permafrost | SSGAFVLTAIGFGLLTLGGWLGGAIVFVHGMRVLKLKSEPAGRAVSPIPHSEKERAEED* |
| Ga0120159_10109261 | 3300012014 | Permafrost | GLLTLGGWLGGAIVFVHGMHVLSLVKEPASRATVPVPHPEKEMAEGS* |
| Ga0136622_103040571 | 3300012187 | Polar Desert Sand | LTLIGFGLLTLGGWIGGSVVYVHGMRVLGLRDEPAEQAVTPGHTEKGQTQAS* |
| Ga0137364_106381773 | 3300012198 | Vadose Zone Soil | VGFGFLTLGGWLGGAVVYVHGMRVLKLVKEPSERAVSPVPHKEKEMAEGA* |
| Ga0137399_111863802 | 3300012203 | Vadose Zone Soil | TLVGYGLLTLGGWLGGAIVFVHGMRVLSLVDEPATRAAAPVATPEKERAEGT* |
| Ga0137374_100020128 | 3300012204 | Vadose Zone Soil | VFVHGMRVLSLVEEPAERSIAPVATPEKEEAEGA* |
| Ga0137381_102809451 | 3300012207 | Vadose Zone Soil | AIVFVHGMRVLSLTGEPPGRAVAPVPRPEKEEAEGA* |
| Ga0137376_106109212 | 3300012208 | Vadose Zone Soil | GFGLLTLGGWLGGAIVFVHGMRVLSLVHEPASRAAAPVPHPEKEMAEGS* |
| Ga0137376_106626981 | 3300012208 | Vadose Zone Soil | GPFILTLVGFCFLTLGGWLGGAIVFVHGMRVLSLTSEPPGRAVAPVPHPEKEEAEGA* |
| Ga0150985_1148788302 | 3300012212 | Avena Fatua Rhizosphere | VVFVHGMRVLSLPGEPPGRAAAPVPHPEKEAAEGS* |
| Ga0137370_102930271 | 3300012285 | Vadose Zone Soil | TIGGWLGGAVVFVHGMRVLSLVDEPAGRAVAPIPHPEKEDAEA* |
| Ga0137372_103182693 | 3300012350 | Vadose Zone Soil | VYVHGMRVLNLRKEPTGRAVAPAAHPEKEMAEGS* |
| Ga0137367_107905072 | 3300012353 | Vadose Zone Soil | SLILTLVGFGILTLGGWLGGAVVFVHGMRVLSLVDEPAKRAASPVEYPEKEEAEGGS* |
| Ga0137366_103250143 | 3300012354 | Vadose Zone Soil | VFVHGMRVLNLTGEPPGRAIAPAAHPEKEMAEGS* |
| Ga0137371_109396382 | 3300012356 | Vadose Zone Soil | GWLGGAVVFVHGMRVLSLVKEPAARAAAPLPHPEKEAAEGG* |
| Ga0137371_110792611 | 3300012356 | Vadose Zone Soil | LAGFGFLTLGGWLGGAIVFVHGMRVLSLTSEPPGRAVAPRSHPEKEEAEGA* |
| Ga0137368_100602923 | 3300012358 | Vadose Zone Soil | IVFVHGMRVLSLVDEPASRAVSPIPHPEKEEAEGS* |
| Ga0137385_108010301 | 3300012359 | Vadose Zone Soil | IVFVHGMRVLSLVDEPAGRAVSPLPKPEKEKAEGS* |
| Ga0137375_104397561 | 3300012360 | Vadose Zone Soil | VYVHGMRVLNLLHEPTERAVAPAPQPEKERAEGS* |
| Ga0137375_112032081 | 3300012360 | Vadose Zone Soil | VFVHGMRVLSLVEEPTERAIAPAPHPEKEEAEGA* |
| Ga0134042_10064581 | 3300012373 | Grasslands Soil | TLVGFAVLTLGGWLGGAIVFTHGMRVLELVEEPTSRAISPLPKPEKEEAEA* |
| Ga0134039_11851402 | 3300012374 | Grasslands Soil | LLTLGGWLGGSIVFVHGMRVLSLVQEPASRAVSPVPKPEKEAAEGG* |
| Ga0134034_10151542 | 3300012375 | Grasslands Soil | GAFALTLVGFGLMTLGGWLGGAVVYVHGMRVLSLVQEPTERAVAPVPHPEKEMAEGG* |
| Ga0134025_12130861 | 3300012378 | Grasslands Soil | GFAFLTLGGWLGGAIVFVHGMRVLSLTGEPPGRAVSPLPHPEKEAAEGS* |
| Ga0134044_12465991 | 3300012395 | Grasslands Soil | LVLTLVGYGLLATGGWLGGAIVFTHGMRVLKLVDEPTSRAVSPLPKPEKEEAEA* |
| Ga0134056_11718152 | 3300012397 | Grasslands Soil | VSSGSYALTVIGFGFLTLGGWFGGAVVFVHGMRVLSLVDEPTGRAVAPVPHAGKERAEGG |
| Ga0134059_12199501 | 3300012402 | Grasslands Soil | THANTSDGAYALTLIGFAFMTLGGWLGGAVVFVHGMRVLSLVKEPAERAVSPVPHAEKEQAEGG* |
| Ga0134049_11886981 | 3300012403 | Grasslands Soil | VKSGPFLLTLVGYAVLTLGGWIGGSITFVHGMRVLGLQDEPTRRAISPLPKPEKEQSEG* |
| Ga0134053_13330962 | 3300012406 | Grasslands Soil | VVFVHGMRVLSLVDEPPERAVAPAPHPEKEEAEA* |
| Ga0134050_11784791 | 3300012407 | Grasslands Soil | GFAFLTLGGWLGGAVVFVHGMRVLSLVKEPAERAVAPVPHAEKEQAEGG* |
| Ga0134050_11959872 | 3300012407 | Grasslands Soil | VGFAVLTLGGWLGGAIVFTHGMRVLELVEEPTSRAISPLPKPEKEEAEA* |
| Ga0134045_13188652 | 3300012409 | Grasslands Soil | VLTVIGFGILTLGGWLGGAIVFVHGMRVLSLKSEPAGRAVSPIPHAEKEQAD* |
| Ga0150984_1042368981 | 3300012469 | Avena Fatua Rhizosphere | CSSDLVFVHVMRVLNLVDEPTDRAVAPVPHPEKEAAES* |
| Ga0150984_1088167581 | 3300012469 | Avena Fatua Rhizosphere | VVFVHGMRVLGLVDEPPGRAAAPVAHPEKEDAAAG* |
| Ga0157349_10285101 | 3300012489 | Unplanted Soil | GGWLGGAVVFVHGMRVLSLVDEPPERAAAPAPHQEKEEAEA* |
| Ga0157335_10087463 | 3300012492 | Arabidopsis Rhizosphere | GWLGGAVVFVHGMRVLSLVDEPPERAAAPAPHQEKEEAEA* |
| Ga0136633_10581723 | 3300012527 | Polar Desert Sand | FGLLTLGGWLGGAIVFVHGMRVLGLEEEPTHRAVSPVPHPEEKRAES* |
| Ga0136633_12899271 | 3300012527 | Polar Desert Sand | VFVHGMRVLNLVDEPARRAAAPVATPEKREAEGA* |
| Ga0137373_102391061 | 3300012532 | Vadose Zone Soil | GFGFLTLGGWLGGAVVYVHGMRVLSLVQEPAERAVAPVPHPEKEMAEGT* |
| Ga0137373_106205343 | 3300012532 | Vadose Zone Soil | VYVHGMRVLSLVDEPTERAVSPKPHPEKEMAEGG* |
| Ga0157285_100499963 | 3300012897 | Soil | VVFVHGMRVLNLVDEPARRAAAPVATPEKREAEGA* |
| Ga0157285_101134183 | 3300012897 | Soil | RRLARGAVVFTHGMRVLNLVDEPAMRAVSPMPLPEKEEAEGGG* |
| Ga0157295_102028743 | 3300012906 | Soil | LTLGGWFGGAVVFVHGMRVLSLVDEPPERAVAPAPHPEKEEAEA* |
| Ga0157306_102072823 | 3300012912 | Soil | VGGWLGGAVVFTHGMRVLNLADESPQRAALPGGREKEEAEA* |
| Ga0157298_103206021 | 3300012913 | Soil | ILTLVGFAFLTLGGWLGGAIVFVHGMRVLSLVDEPPDRAASPVPHPEKEEAEA* |
| Ga0157302_101425592 | 3300012915 | Soil | GWLGGAVVFTHGIRVLNLVEEPPERAAIPGGAEKEEAEA* |
| Ga0164301_102281013 | 3300012960 | Soil | VFVHGMRVLSLPEEPSGRAIAPAPHPEKEAAEGA* |
| Ga0126369_118041501 | 3300012971 | Tropical Forest Soil | GGAIVFVYGMRVLSLADEPPARALAPAPHPEKEEPEA* |
| Ga0134076_102214231 | 3300012976 | Grasslands Soil | LLTAGGWFGGAIVYVHGMRVLSLVDEPAERAVAPVPHAEKEMAEGS* |
| Ga0134076_104657161 | 3300012976 | Grasslands Soil | GLLATGGWLGGAIVFTHGMRVLKLVDEPTSRAVSPLPKPEKEEAEA* |
| Ga0134076_105867061 | 3300012976 | Grasslands Soil | VLTVIGFGILTLGGWLGGAIVFVHGMRVLSLKNEPAGRAVSPIPHAEKEQAEG* |
| Ga0157371_103768491 | 3300013102 | Corn Rhizosphere | RGGVGVFTHGMRVLQLVDEPPARAVAPVSHPEKQEAEGG* |
| Ga0157374_103997174 | 3300013296 | Miscanthus Rhizosphere | VLTLLGFGFLTLGGWLGGAVVFVHGMRVLSLVDEPPDRAAAPVPHPEKEEAEA* |
| Ga0157378_102107173 | 3300013297 | Miscanthus Rhizosphere | LTLGGWLGGAVVFTHGMRVLQLVDEPPARAVAPVSHPEKQEAEGG* |
| Ga0120154_100046121 | 3300013501 | Permafrost | GNVSSGAFVLTVIGFGLLTLGGWLGGAIVFVHGMRVLKLKSEPAGRAVSPIPHSEKERAEGG* |
| Ga0120154_10189521 | 3300013501 | Permafrost | GVVETGPFILTLVGFGFLTLGGWLGGAIVFVHGMRVLGLPDEPTARAISPTPYPEKQKAEG* |
| Ga0120154_10994632 | 3300013501 | Permafrost | LLTLGGWLGGAIVFVHGMHVLSLVKEPASRATVPVPHPEKEMAEGS* |
| Ga0120172_10454562 | 3300013765 | Permafrost | VFVHGMRVLSLVKEPASRATVPVPHPEKEMAEGS* |
| Ga0120123_10058691 | 3300013770 | Permafrost | AGPFILTLIGFALLTLGGIFGGSIVFVHGMRVLKLKDEPAKEALSPLNQRKEQAEG* |
| Ga0134078_103487123 | 3300014157 | Grasslands Soil | LGGWLGGAIVYVHGMRVLSLVEEPTERAIAPVPHEEKEAAQA* |
| Ga0182000_102978662 | 3300014487 | Soil | SIVFVHGMRVLNLVEEPTSKAVTPGHSEKELAEEG* |
| Ga0182001_101008881 | 3300014488 | Soil | IVYVHGMRVLNLLQEPTERAVSPVPHPEKEMAEGA* |
| Ga0157377_101665401 | 3300014745 | Miscanthus Rhizosphere | TLGGWLGGAIVFVHGMRVLSLVDEPPERAIAPAPHPEKEEAEA* |
| Ga0173478_101626253 | 3300015201 | Soil | GGAVVFVHGMRVLSLIDEPPARAAAPAPHPEKEEAEN* |
| Ga0182006_10978443 | 3300015261 | Rhizosphere | WLGGAVTYVHGMRVLSLVDEPAEKAVAPVPSDEKVEAEA* |
| Ga0134085_105700411 | 3300015359 | Grasslands Soil | GSIVFVHGMRVLSLVDEPTERAISPLPEKELADKS* |
| Ga0132256_1032930852 | 3300015372 | Arabidopsis Rhizosphere | GWVGGAIVFVHGMRVLSLVDEPAGRAMAPTGEEKAEAERS* |
| Ga0132257_1016857683 | 3300015373 | Arabidopsis Rhizosphere | VGFAFLTLGGWLGGAVVFVHGMRVLSLVDEPPDRAAAPVPHPEKEEAEA* |
| Ga0132255_1026086082 | 3300015374 | Arabidopsis Rhizosphere | WLGGAVVFTHGMRVLNLVDEPPQRAAIPGGAEKEEAEA* |
| Ga0184610_11160811 | 3300017997 | Groundwater Sediment | AYALTLIGFALLTLGGWLGGAIVFVHGMRVLKLKSEPAGRAVSPIPHAEKEEAD |
| Ga0184634_102407131 | 3300018031 | Groundwater Sediment | GWLGGAVVFTHGMRVLNLVDEPPERAAIPGGAEKEEAEA |
| Ga0184618_104200761 | 3300018071 | Groundwater Sediment | TLGGWLGGAIVFVHGMRVLSLVYEPASRAAAPVPHPEKEMAEGS |
| Ga0184609_100756334 | 3300018076 | Groundwater Sediment | GGAIVFTYDMRVLNLVDEPASRAVTPGHPEKERAEG |
| Ga0066667_109392702 | 3300018433 | Grasslands Soil | FLALTAGGWLGGAITYVHGMRVLSLVDEPALRAAAPLPHDEKVEAAEN |
| Ga0066667_110394233 | 3300018433 | Grasslands Soil | GFGLMTLGGWLGGAVVYVHGMRVLSLVQEPTERAVAPVPHPEKEMAEGG |
| Ga0066669_109805382 | 3300018482 | Grasslands Soil | FLLTLVGFGFLTLGGWLGGAIVFVHGMRVLSLTSEPPGRAVAPVPHPEKEEAEGG |
| Ga0184646_12494282 | 3300019259 | Groundwater Sediment | TLGGWLGGAIVYVHGMRVLGLAKEPTGRAVSPLPHAEKEEAEGAS |
| Ga0184642_14214242 | 3300019279 | Groundwater Sediment | LTLGGWLGGAIVFVHGMRVLSLVDEPTKRAVSPLPHEEKEAAEGS |
| Ga0193721_11484051 | 3300020018 | Soil | LGGAIVFVHGMRVLSLVDEPAGRAASPLPKPEKEKAEGV |
| Ga0206350_114570872 | 3300020080 | Corn, Switchgrass And Miscanthus Rhizosphere | TLIAFALLTLGGWLGGAVVFTHGMRVLRLVDEPTKRAVSPMPLPEKEEAEGGG |
| Ga0206353_101632671 | 3300020082 | Corn, Switchgrass And Miscanthus Rhizosphere | LGGWLGGAIVFVHGMRVLSLVDEPPERAIAPAPHPEKEEAEA |
| Ga0210382_100034565 | 3300021080 | Groundwater Sediment | MSRDVGATVFVHGMRILNLESEPAGRAVSPIPHAEKERAEGG |
| Ga0210382_101240243 | 3300021080 | Groundwater Sediment | GGWLGGAIVYVHGMRVLGLAKEPTGRAVSPLPHAEKEEAEGA |
| Ga0213876_105489371 | 3300021384 | Plant Roots | GGTIVFVHGMRVLSLAKEPWRRAIAPVPHPEKEMAAGD |
| Ga0222623_103533501 | 3300022694 | Groundwater Sediment | VDGAIGGASLILTLVGFGLLTIGGWLGGAIVFVHGMRVLSLVDEPAARAVSPMPHPEKEEAEGS |
| Ga0222622_108158281 | 3300022756 | Groundwater Sediment | VVFVHGMRVLNLVDEPARRAAAPVATPEKREAEGV |
| Ga0247746_11324661 | 3300022886 | Soil | ANVFVHGMRVLNLVDEPTARAISPLPHPEKEEAEA |
| Ga0207707_110121752 | 3300025912 | Corn Rhizosphere | GFVVLTLGGWLGGAVVFVHGMRVLGLVQLPWRRAVTPGGPPDDASA |
| Ga0207707_115348692 | 3300025912 | Corn Rhizosphere | GSVSGGSLVLTLVAFGLLTLGGWLGGAIVFTHGMRVLSLVDEPTKRAVSPMPLPEKEEAEGGG |
| Ga0207695_110881261 | 3300025913 | Corn Rhizosphere | GWLGGAVTFVHGMRVLSLVDEPAQKAVAPVPTREKVEAGEG |
| Ga0207660_115481022 | 3300025917 | Corn Rhizosphere | GGWLGGAVVFTHGMRVLNLADESPQHAALPGGPEKEEAEA |
| Ga0207662_104306761 | 3300025918 | Switchgrass Rhizosphere | AIVFVYGMRVLSLVNEPVSRAAVPLPHTEKERAEGS |
| Ga0207649_105566533 | 3300025920 | Corn Rhizosphere | VLTLLGFAFLTLGGWLGGAVVFVHGMRVLSLVDEPPDRAAAPVPHPEKEEAEA |
| Ga0207681_102856563 | 3300025923 | Switchgrass Rhizosphere | LIAFALLTLGGWLGGAVVFTHGMRVLSLVDEPTKRAVSPMPLPEKEEAEGGG |
| Ga0207704_109136523 | 3300025938 | Miscanthus Rhizosphere | GAVVFTYGMRVLQLVDEPPARAVAPVPHPEKQEAEGG |
| Ga0207677_102593603 | 3300026023 | Miscanthus Rhizosphere | AVVFTYGMRVLQLVDEPPARAVAPVPHPEKQEAEGG |
| Ga0207702_117304391 | 3300026078 | Corn Rhizosphere | WLGGAIVFVHGMRVLSLPEEPSGRAIAPAPHPEKEAAEGA |
| Ga0208291_10933351 | 3300026111 | Natural And Restored Wetlands | TAGGWLGGAITFVHGMRVLGLADEPATRAAAPLPREEDAADG |
| Ga0207683_114458001 | 3300026121 | Miscanthus Rhizosphere | GGAVVFTHGMRVLNLADESPQRAALPGGSEKEEAEA |
| Ga0209153_11355683 | 3300026312 | Soil | TAGPFVLTVVGFGLLALGGWFGGAVVYVHGMRVLSLVREPAVRAASPVPKPEKEAAEGG |
| Ga0209801_11839891 | 3300026326 | Soil | FLFMTLGGWLGGAIVFVHGMRVLSLVSEPAERAVAPVPHAEKEQAEGG |
| Ga0209801_11988993 | 3300026326 | Soil | LLTLGGWLGGAIVFVHGMRVLSLVGEPTERAVSPAPKPEKEAAEGG |
| Ga0209473_12831981 | 3300026330 | Soil | SIVFVHGMRVLSLVQEPAGRAVSPVPKPEKEAAEGS |
| Ga0209267_13136351 | 3300026331 | Soil | FILTLVGFAFLTLGGWLGGAIVFVHGMRVLSLTGEPPGRAVSPLPHPEKEAAEGS |
| Ga0209057_10122151 | 3300026342 | Soil | GFGFLTLGGWLGGAIVFVHGMRVLSLTGEPPGRAVAPVPHPEKEEAEGA |
| Ga0209058_13414332 | 3300026536 | Soil | NVGSGAYTLTVIGFLFMTLGAWLGGAIVFVHGMRVLSLVSEPAERAVSPVPHAEKEQAEG |
| Ga0209056_107061422 | 3300026538 | Soil | FVLTVVGFGLLTLGGWLGGSIVFVHGMRVLSLVGEPTERAVSPVPKPEKEAAEGS |
| Ga0209577_100670971 | 3300026552 | Soil | GNVSGGAYTLTVIGFLFMTLGGWLGGAIVFVHGMRVLSLVKEPAERAVSPVPHAEKKQAEGG |
| Ga0209074_104987482 | 3300027787 | Agricultural Soil | TLVGFAVLTLGGWLGGAIVYVHGMRVLSLVDEPPARAVAPAPHPEKEEAEA |
| Ga0247820_107075511 | 3300028597 | Soil | SIVFVHGMRVLGLVDEPPERAVAPVAHPEKEEAAA |
| Ga0307322_100113031 | 3300028710 | Soil | LVLTLVGYILLAAGGWLGGAIVFTHGMRVLKLADEPTSRAISPLPKPEKEEAEA |
| Ga0307322_101160153 | 3300028710 | Soil | VVFTHGMRVLQLVDEPPARAVAPVPHPEKQEAEGG |
| Ga0307293_100332633 | 3300028711 | Soil | ANVGAGAYALTLIGFGFLTLGGWLGGAIVYVHGMRVLGLAKEPTGRAVSPLPHAEKEEAEGA |
| Ga0307285_100755573 | 3300028712 | Soil | VETGPFILTLVGFGFLTLGGWLGGAVVFTHGMRVLQLVDEPPARAVAPVPHPEKQESEGG |
| Ga0307311_101553731 | 3300028716 | Soil | VVYVHGMRVLSLVKEPAGRAVSPVPHAEKEQAEGG |
| Ga0307298_100893841 | 3300028717 | Soil | TLIGFASMTIGGWLGGAIVFVHGMRVLSLVDEPAMRAASPLPKPEKERAEGS |
| Ga0307315_100436741 | 3300028721 | Soil | TLGGWLGGAIVFVHGMRVLGLKSEPAGRAVSPIPHAEKEEAD |
| Ga0307318_102871311 | 3300028744 | Soil | LILTLVGFGLLTLGGWLGGAIVFVHGMRVLSLVDEPAARAVSPLPHPEKEEAEGG |
| Ga0307318_103487982 | 3300028744 | Soil | ILTLVGFGFLTLGGWLGGAVVFTHGMRVLQLVDEPPARAVAPVPHPEKQEAEGG |
| Ga0307297_101710043 | 3300028754 | Soil | GPFILTLVGFGFLTLGGWFGGAVVFTHGMRVLQLVDEPPARAVAPVPHPEKQEAEGG |
| Ga0307316_101584821 | 3300028755 | Soil | VEAGPFVLTLLGFAFLTLGGWLGGAVVFVHGMRVLSLVDEPPARAASPAPHPEKEDAAS |
| Ga0307320_101496441 | 3300028771 | Soil | VGAGAYALTLIGFGFLTLGGWLGGAIVYVHGMRVLGLAKEPTGRAVSPLPHAEKEEAEGA |
| Ga0307320_103092631 | 3300028771 | Soil | VVYVHGMRVLSLTGEPPGRAVAPVPHPEKEEAEGS |
| Ga0307288_104074132 | 3300028778 | Soil | TLIGFGLLTLGGWLGGAIVFVHGMRVLSLVHEPASRAAAPVPHPEKERAEGS |
| Ga0307282_102003341 | 3300028784 | Soil | WLGGAIVFVHGMRVLSLVDEPAGRAASPLPKPEKEKAEGV |
| Ga0307323_102542251 | 3300028787 | Soil | AVEAGPFVLTLLGFAFLTLGGWLGGAVVFVHGMRVLSLVDEPPSRAASPAPHPEKEDAAS |
| Ga0307290_101478091 | 3300028791 | Soil | FLTLGGWLGGAVVFVHGMRVLSLVDEPPARAAAPVPHSEKEEAEA |
| Ga0307299_101538871 | 3300028793 | Soil | LIGFALLTLGGWLGGAIVFVHGMRVLGLKSEPAGRAVSPIPHAEKEEAEGG |
| Ga0307287_100774361 | 3300028796 | Soil | GGSLVLTLVGYILLAAGGWLGGAIVFTHGMRVLKLVDEPTSRAISPLPKPEKEEAEA |
| Ga0307284_103310052 | 3300028799 | Soil | GGWLGGAITYVHGMRVLSLVYEPALRAAAPLPHDEKVEAAED |
| Ga0307503_106888442 | 3300028802 | Soil | WFGGTVVFTHGMRVLKLADEPTSRATSPLPKPEQEEAEA |
| Ga0307305_101903023 | 3300028807 | Soil | GGANVFVHGMRVLSLVDEPTKRAVSPLPHEEKEEAEGG |
| Ga0307294_100712443 | 3300028810 | Soil | TLVGFGFLTLGGWLGGAVVFTHGMRVLQLVDEPPARAVAPVPHPEKQEAEGG |
| Ga0307302_100468053 | 3300028814 | Soil | GGAIVFTHGMRVLKLVDEPTSRAISPLPKPEKEEAEA |
| Ga0307296_105188473 | 3300028819 | Soil | LGGSIVFVHGMRVLNLVDEPPDRAAAPVAHPEKKEAEA |
| Ga0307296_106211601 | 3300028819 | Soil | AIVFVHGMRVLKLKSEPAGRAVSPIPHPEKEKAEGG |
| Ga0307312_101178133 | 3300028828 | Soil | ANVSAGAYVLTVIGFGFLTLGGWLGGAIVYVHGMRVLGLAKEPTERAVAPMPHPEKEKAEGA |
| Ga0307314_102113181 | 3300028872 | Soil | GAYALTLIAFGLLTLGGWLGGAVVYVHGMRVLSLVKEPAGRAVSPVPHAEKEQAEGG |
| Ga0307278_102827633 | 3300028878 | Soil | HGAVRTWPFIATLIGFGFLTLGGWLGGAVVYVHGMRVLSLTSEPPGRAVSPVPHPEKDEAEGG |
| Ga0307278_103185081 | 3300028878 | Soil | LGGAIVFTHGMRVLKLVDEPTSRAISPLPKPEKEEAEA |
| Ga0307278_105419172 | 3300028878 | Soil | LTLGGWLGGAVVFVHGMRVLSLVDEPPARAAAPVPHSEKEEAEA |
| Ga0307308_100711231 | 3300028884 | Soil | TLGGWLGGAIVFVHGMRVLSLTGEPPGRAVSPLPHPEKEEAEA |
| Ga0307308_101057843 | 3300028884 | Soil | IVFVYGMRVLKLKDEPAGRAVSPIPHTEKEKAESS |
| Ga0307304_103961162 | 3300028885 | Soil | EAYALTLIGFALLTLGGWLGGAIVFVRGMRVLKLKSEPAGRAVSPIPHPEKEKAEGG |
| Ga0308202_11196562 | 3300030902 | Soil | LVGFGFLTLGGWLGGAVVFTHGMRVLQLVDEPPARAVAPVPHPEKQESEGG |
| Ga0308202_11554452 | 3300030902 | Soil | VGFAALSAGGWLGGAITYVHGMRVLSLPDEPATRAASPVPHEEKVEAEA |
| Ga0308206_11465921 | 3300030903 | Soil | IGGGSLILTLVGFGLLTLGGWLGGAIVFVHGMRVLSLVDEPAGRAVSPLPHPEKEEAEGG |
| Ga0308189_105462201 | 3300031058 | Soil | LGGAVVFTHGMRVLSLVDEQTNRAVSPMPLPEKEEAEGAG |
| Ga0308204_101163012 | 3300031092 | Soil | GAVVFTHGMRVLNLADEPPERAAIPGGAEKEEAEA |
| Ga0308204_103434011 | 3300031092 | Soil | TLVGFGVLTLGGWLGGAIVFVHGMRVLSLVDEPAARAVSPMPHPEKEEAEGG |
| Ga0308197_103115631 | 3300031093 | Soil | SVGGGSLVLTIVGYVLLAAGGWLGGAIVFTHGMRVLKLVAEPTSRAVSPLPKPEKEEAEA |
| Ga0308199_11833932 | 3300031094 | Soil | WLGGAIVFTHGMRVLKLVDEPTSRAISPLPKPEKEEAGA |
| Ga0308193_10824132 | 3300031096 | Soil | SVGGGSLILTLVAYVLLAAGGWLGGAIVFTHGMRVLKLVDEPTSRAISPLPKPEKEEAEA |
| Ga0308181_11456772 | 3300031099 | Soil | LAAGGWLGGAIVFTHGMRVLKLVDEPTSRAISPLPKPEKEEAEA |
| Ga0308181_11803101 | 3300031099 | Soil | VIGFGFLTLGGWLGGAIVYVHGMRVLGLAKEPTERAVAPMPHPEKEKAEGA |
| Ga0307498_102450862 | 3300031170 | Soil | GAIVFVHGMRVLSLVDEPPSRAATPVPHAEKERAEGS |
| Ga0299913_114413321 | 3300031229 | Soil | VFVHGMRVLELPEEPAARAATPGGEEKERAEGRRG |
| Ga0310888_109794072 | 3300031538 | Soil | GFAALTAGGWLGGAVVFTHGMRVLDLVDEPPKRAAIPGGSEKKEAEA |
| Ga0307469_121411642 | 3300031720 | Hardwood Forest Soil | LAAGGWLGGAIVFTHGMRVLKLVDEPTSRAISSLPKPEKEEAEA |
| Ga0308176_111313242 | 3300031996 | Soil | TLIGFGLLTLGGWLGGAIVYVHGMRVLSLVQEPAPRAAAPVAHPEKELAEGS |
| Ga0308173_113119563 | 3300032074 | Soil | ILTLIGFGLLTLGGWLGGAVVYVHGMRVLQLVGEPTGRAVAPVPHPEKEMAEGS |
| Ga0307415_1003230151 | 3300032126 | Rhizosphere | LTLGGWLGGSIVFVHGMRVLSLVQEPVERAVSPAPKPEKEAAEGSD |
| Ga0307415_1022104431 | 3300032126 | Rhizosphere | VSSSALVLTLVAYGVLAVGGWVGGAITYVHGMRVLELVDEPASRAVQPLTPEKEEAERS |
| Ga0310810_102630401 | 3300033412 | Soil | WLGGAVVFVHGMRVLSLVDEPPDRAAAPVPHPEKEEAEA |
| Ga0370545_059866_102_293 | 3300034643 | Soil | MAAAAGSPSLKRTIVGYVLLAAGGWLGGAIVFTHGMRVLKLVDEPTSRAVSPLEKPEKEEAEA |
| Ga0370548_111991_1_159 | 3300034644 | Soil | LTLIGFSLLTLGGIFGGSIVFVHGMRVLKLRDEPAKEALSPLPNERKEQAEG |
| Ga0370548_132306_355_513 | 3300034644 | Soil | LTVVGYVLLAAGGWLGGAIVFTHGMRVLKLVDEPTSRAISPLPKPEKEEAEA |
| Ga0370541_043560_457_573 | 3300034680 | Soil | GGAIVYVHGMRVLGLAKEPTGRAVSPLPHAEKEEAEGA |
| ⦗Top⦘ |