NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F015088

Metagenome / Metatranscriptome Family F015088

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F015088
Family Type Metagenome / Metatranscriptome
Number of Sequences 257
Average Sequence Length 45 residues
Representative Sequence GGWLGGAIVFVHGMRVLSLVDEPPARAVAPAPHPEKEEAEA
Number of Associated Samples 213
Number of Associated Scaffolds 257

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 1.17 %
% of genes near scaffold ends (potentially truncated) 96.50 %
% of genes from short scaffolds (< 2000 bps) 93.77 %
Associated GOLD sequencing projects 203
AlphaFold2 3D model prediction Yes
3D model pTM-score0.39

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (96.498 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(23.346 % of family members)
Environment Ontology (ENVO) Unclassified
(27.626 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(57.588 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 37.68%    β-sheet: 0.00%    Coil/Unstructured: 62.32%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.39
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 257 Family Scaffolds
PF00085Thioredoxin 64.98
PF00133tRNA-synt_1 14.40
PF02735Ku 3.11
PF07098DUF1360 1.56
PF00484Pro_CA 1.17
PF00106adh_short 0.78
PF01510Amidase_2 0.78
PF00487FA_desaturase 0.78
PF13185GAF_2 0.78
PF05988DUF899 0.39
PF01594AI-2E_transport 0.39
PF02776TPP_enzyme_N 0.39
PF02622DUF179 0.39
PF02786CPSase_L_D2 0.39
PF13417GST_N_3 0.39
PF12697Abhydrolase_6 0.39
PF02913FAD-oxidase_C 0.39
PF06262Zincin_1 0.39
PF04295GD_AH_C 0.39
PF00005ABC_tran 0.39
PF00392GntR 0.39
PF03729DUF308 0.39
PF13186SPASM 0.39
PF10944DUF2630 0.39
PF08281Sigma70_r4_2 0.39
PF08264Anticodon_1 0.39
PF13458Peripla_BP_6 0.39
PF00196GerE 0.39
PF13561adh_short_C2 0.39

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 257 Family Scaffolds
COG0060Isoleucyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 14.40
COG0143Methionyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 14.40
COG0495Leucyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 14.40
COG0525Valyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 14.40
COG1273Non-homologous end joining protein Ku, dsDNA break repairReplication, recombination and repair [L] 3.11
COG0288Carbonic anhydraseInorganic ion transport and metabolism [P] 1.17
COG1398Fatty-acid desaturaseLipid transport and metabolism [I] 0.78
COG3239Fatty acid desaturaseLipid transport and metabolism [I] 0.78
COG0277FAD/FMN-containing lactate dehydrogenase/glycolate oxidaseEnergy production and conversion [C] 0.39
COG0628Predicted PurR-regulated permease PerMGeneral function prediction only [R] 0.39
COG1678Putative transcriptional regulator, AlgH/UPF0301 familyTranscription [K] 0.39
COG2721Altronate dehydrataseCarbohydrate transport and metabolism [G] 0.39
COG3247Acid resistance membrane protein HdeD, DUF308 familyGeneral function prediction only [R] 0.39
COG3824Predicted Zn-dependent protease, minimal metalloprotease (MMP)-like domainPosttranslational modification, protein turnover, chaperones [O] 0.39
COG4312Predicted dithiol-disulfide oxidoreductase, DUF899 familyGeneral function prediction only [R] 0.39


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms96.50 %
UnclassifiedrootN/A3.50 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2067725001|GPWNP_F5MPXY301DUFL2All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria512Open in IMG/M
3300000044|ARSoilOldRDRAFT_c004853All Organisms → cellular organisms → Bacteria1138Open in IMG/M
3300000891|JGI10214J12806_10172261All Organisms → cellular organisms → Bacteria723Open in IMG/M
3300000956|JGI10216J12902_108248094All Organisms → cellular organisms → Bacteria791Open in IMG/M
3300000956|JGI10216J12902_109300202All Organisms → cellular organisms → Bacteria811Open in IMG/M
3300000956|JGI10216J12902_110932537All Organisms → cellular organisms → Bacteria687Open in IMG/M
3300001305|C688J14111_10021749All Organisms → cellular organisms → Bacteria1896Open in IMG/M
3300001305|C688J14111_10115762All Organisms → cellular organisms → Bacteria819Open in IMG/M
3300001535|A3PFW1_10047315All Organisms → cellular organisms → Bacteria → Terrabacteria group2397Open in IMG/M
3300001538|A10PFW1_10140571All Organisms → cellular organisms → Bacteria3739Open in IMG/M
3300002568|C688J35102_119193483All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria652Open in IMG/M
3300004081|Ga0063454_100287508All Organisms → cellular organisms → Bacteria1017Open in IMG/M
3300004153|Ga0063455_101442676All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria533Open in IMG/M
3300005171|Ga0066677_10483274All Organisms → cellular organisms → Bacteria711Open in IMG/M
3300005181|Ga0066678_10175650All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1355Open in IMG/M
3300005181|Ga0066678_10366645All Organisms → cellular organisms → Bacteria952Open in IMG/M
3300005184|Ga0066671_10121458All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter1482Open in IMG/M
3300005184|Ga0066671_11026587All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium518Open in IMG/M
3300005186|Ga0066676_11121021All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium518Open in IMG/M
3300005186|Ga0066676_11142275All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium512Open in IMG/M
3300005332|Ga0066388_107344193All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria553Open in IMG/M
3300005344|Ga0070661_101355479All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium598Open in IMG/M
3300005345|Ga0070692_10550588All Organisms → cellular organisms → Bacteria756Open in IMG/M
3300005355|Ga0070671_102048680All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium510Open in IMG/M
3300005366|Ga0070659_100613687All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria936Open in IMG/M
3300005456|Ga0070678_100945490All Organisms → cellular organisms → Bacteria790Open in IMG/M
3300005458|Ga0070681_10342665All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1404Open in IMG/M
3300005471|Ga0070698_101622158All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria599Open in IMG/M
3300005546|Ga0070696_101787160All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria531Open in IMG/M
3300005549|Ga0070704_100380092All Organisms → cellular organisms → Bacteria1200Open in IMG/M
3300005557|Ga0066704_10547195All Organisms → cellular organisms → Bacteria755Open in IMG/M
3300005560|Ga0066670_10390600All Organisms → cellular organisms → Bacteria852Open in IMG/M
3300005560|Ga0066670_10478516All Organisms → cellular organisms → Bacteria767Open in IMG/M
3300005561|Ga0066699_10965994Not Available591Open in IMG/M
3300005561|Ga0066699_11148916All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria534Open in IMG/M
3300005561|Ga0066699_11255524All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria508Open in IMG/M
3300005564|Ga0070664_101558687All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium625Open in IMG/M
3300005569|Ga0066705_10847254All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium544Open in IMG/M
3300005574|Ga0066694_10367329All Organisms → cellular organisms → Bacteria680Open in IMG/M
3300005576|Ga0066708_10391928All Organisms → cellular organisms → Bacteria891Open in IMG/M
3300005576|Ga0066708_10481296All Organisms → cellular organisms → Bacteria799Open in IMG/M
3300005587|Ga0066654_10312681All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium846Open in IMG/M
3300005718|Ga0068866_10543121All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria776Open in IMG/M
3300005764|Ga0066903_100752385All Organisms → cellular organisms → Bacteria1731Open in IMG/M
3300005889|Ga0075290_1063134All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium525Open in IMG/M
3300005905|Ga0075269_10108297All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria534Open in IMG/M
3300006032|Ga0066696_10790638All Organisms → cellular organisms → Bacteria606Open in IMG/M
3300006032|Ga0066696_10807365All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria599Open in IMG/M
3300006034|Ga0066656_10550738All Organisms → cellular organisms → Bacteria749Open in IMG/M
3300006034|Ga0066656_10585301All Organisms → cellular organisms → Bacteria723Open in IMG/M
3300006049|Ga0075417_10448928All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium643Open in IMG/M
3300006051|Ga0075364_10781614All Organisms → cellular organisms → Bacteria651Open in IMG/M
3300006058|Ga0075432_10153312All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria887Open in IMG/M
3300006573|Ga0074055_10009844All Organisms → cellular organisms → Bacteria878Open in IMG/M
3300006581|Ga0074048_13467624All Organisms → cellular organisms → Bacteria1195Open in IMG/M
3300006606|Ga0074062_10037781All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria505Open in IMG/M
3300006791|Ga0066653_10413095All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium690Open in IMG/M
3300006796|Ga0066665_10206960All Organisms → cellular organisms → Bacteria1527Open in IMG/M
3300006797|Ga0066659_10807786All Organisms → cellular organisms → Bacteria777Open in IMG/M
3300006797|Ga0066659_11930128All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria502Open in IMG/M
3300006800|Ga0066660_10007632All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter5597Open in IMG/M
3300006800|Ga0066660_10186295All Organisms → cellular organisms → Bacteria1570Open in IMG/M
3300006844|Ga0075428_101888189All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria621Open in IMG/M
3300006854|Ga0075425_100620286All Organisms → cellular organisms → Bacteria1244Open in IMG/M
3300006871|Ga0075434_101084842All Organisms → cellular organisms → Bacteria814Open in IMG/M
3300006881|Ga0068865_100745312All Organisms → cellular organisms → Bacteria841Open in IMG/M
3300006914|Ga0075436_100296201All Organisms → cellular organisms → Bacteria1159Open in IMG/M
3300006969|Ga0075419_10785855All Organisms → cellular organisms → Bacteria680Open in IMG/M
3300009012|Ga0066710_100002856All Organisms → cellular organisms → Bacteria14278Open in IMG/M
3300009100|Ga0075418_11032808All Organisms → cellular organisms → Bacteria890Open in IMG/M
3300009137|Ga0066709_102357327All Organisms → cellular organisms → Bacteria726Open in IMG/M
3300009137|Ga0066709_104128011All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria528Open in IMG/M
3300009176|Ga0105242_11055115All Organisms → cellular organisms → Bacteria824Open in IMG/M
3300009176|Ga0105242_11312507All Organisms → cellular organisms → Bacteria748Open in IMG/M
3300009610|Ga0105340_1151175All Organisms → cellular organisms → Bacteria957Open in IMG/M
3300010037|Ga0126304_10561819All Organisms → cellular organisms → Bacteria768Open in IMG/M
3300010041|Ga0126312_10031482All Organisms → cellular organisms → Bacteria3544Open in IMG/M
3300010117|Ga0127449_1094166All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria511Open in IMG/M
3300010122|Ga0127488_1139368All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria503Open in IMG/M
3300010146|Ga0126320_1308236All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium512Open in IMG/M
3300010154|Ga0127503_10376357All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium799Open in IMG/M
3300010166|Ga0126306_10344644Not Available1156Open in IMG/M
3300010303|Ga0134082_10165141All Organisms → cellular organisms → Bacteria899Open in IMG/M
3300010325|Ga0134064_10511945All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria500Open in IMG/M
3300010371|Ga0134125_10755677All Organisms → cellular organisms → Bacteria1071Open in IMG/M
3300010396|Ga0134126_11305744All Organisms → cellular organisms → Bacteria804Open in IMG/M
3300010399|Ga0134127_10091088All Organisms → cellular organisms → Bacteria2645Open in IMG/M
3300011332|Ga0126317_10186939All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium542Open in IMG/M
3300011971|Ga0120175_1006895All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1720Open in IMG/M
3300012011|Ga0120152_1002854All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria8761Open in IMG/M
3300012014|Ga0120159_1010926All Organisms → cellular organisms → Bacteria3800Open in IMG/M
3300012187|Ga0136622_10304057All Organisms → cellular organisms → Bacteria669Open in IMG/M
3300012198|Ga0137364_10638177All Organisms → cellular organisms → Bacteria803Open in IMG/M
3300012203|Ga0137399_11186380All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria643Open in IMG/M
3300012204|Ga0137374_10002012All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria23808Open in IMG/M
3300012207|Ga0137381_10280945All Organisms → cellular organisms → Bacteria1448Open in IMG/M
3300012208|Ga0137376_10610921All Organisms → cellular organisms → Bacteria943Open in IMG/M
3300012208|Ga0137376_10662698All Organisms → cellular organisms → Bacteria901Open in IMG/M
3300012212|Ga0150985_114878830All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium523Open in IMG/M
3300012285|Ga0137370_10293027All Organisms → cellular organisms → Bacteria970Open in IMG/M
3300012350|Ga0137372_10318269All Organisms → cellular organisms → Bacteria1201Open in IMG/M
3300012353|Ga0137367_10790507All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria659Open in IMG/M
3300012354|Ga0137366_10325014All Organisms → cellular organisms → Bacteria1129Open in IMG/M
3300012356|Ga0137371_10939638All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium657Open in IMG/M
3300012356|Ga0137371_11079261All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium605Open in IMG/M
3300012358|Ga0137368_10060292All Organisms → cellular organisms → Bacteria3145Open in IMG/M
3300012359|Ga0137385_10801030All Organisms → cellular organisms → Bacteria783Open in IMG/M
3300012360|Ga0137375_10439756All Organisms → cellular organisms → Bacteria1127Open in IMG/M
3300012360|Ga0137375_11203208All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium580Open in IMG/M
3300012373|Ga0134042_1006458All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria522Open in IMG/M
3300012374|Ga0134039_1185140All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria504Open in IMG/M
3300012375|Ga0134034_1015154All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria508Open in IMG/M
3300012378|Ga0134025_1213086All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium506Open in IMG/M
3300012395|Ga0134044_1246599All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria517Open in IMG/M
3300012397|Ga0134056_1171815All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria568Open in IMG/M
3300012402|Ga0134059_1219950All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria525Open in IMG/M
3300012403|Ga0134049_1188698All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria524Open in IMG/M
3300012406|Ga0134053_1333096All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium539Open in IMG/M
3300012407|Ga0134050_1178479All Organisms → cellular organisms → Bacteria875Open in IMG/M
3300012407|Ga0134050_1195987All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria517Open in IMG/M
3300012409|Ga0134045_1318865All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria566Open in IMG/M
3300012469|Ga0150984_104236898All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria544Open in IMG/M
3300012469|Ga0150984_108816758All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria503Open in IMG/M
3300012489|Ga0157349_1028510All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium570Open in IMG/M
3300012492|Ga0157335_1008746All Organisms → cellular organisms → Bacteria783Open in IMG/M
3300012527|Ga0136633_1058172All Organisms → cellular organisms → Bacteria1677Open in IMG/M
3300012527|Ga0136633_1289927All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria594Open in IMG/M
3300012532|Ga0137373_10239106All Organisms → cellular organisms → Bacteria1472Open in IMG/M
3300012532|Ga0137373_10620534All Organisms → cellular organisms → Bacteria813Open in IMG/M
3300012897|Ga0157285_10049996All Organisms → cellular organisms → Bacteria1016Open in IMG/M
3300012897|Ga0157285_10113418All Organisms → cellular organisms → Bacteria763Open in IMG/M
3300012906|Ga0157295_10202874All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium634Open in IMG/M
3300012912|Ga0157306_10207282All Organisms → cellular organisms → Bacteria663Open in IMG/M
3300012913|Ga0157298_10320602All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium558Open in IMG/M
3300012915|Ga0157302_10142559All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria806Open in IMG/M
3300012960|Ga0164301_10228101All Organisms → cellular organisms → Bacteria1208Open in IMG/M
3300012971|Ga0126369_11804150All Organisms → cellular organisms → Bacteria700Open in IMG/M
3300012976|Ga0134076_10221423All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium799Open in IMG/M
3300012976|Ga0134076_10465716All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria572Open in IMG/M
3300012976|Ga0134076_10586706All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria519Open in IMG/M
3300013102|Ga0157371_10376849All Organisms → cellular organisms → Bacteria1036Open in IMG/M
3300013296|Ga0157374_10399717All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1371Open in IMG/M
3300013297|Ga0157378_10210717All Organisms → cellular organisms → Bacteria1842Open in IMG/M
3300013501|Ga0120154_1000461All Organisms → cellular organisms → Bacteria16965Open in IMG/M
3300013501|Ga0120154_1018952All Organisms → cellular organisms → Bacteria1808Open in IMG/M
3300013501|Ga0120154_1099463All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria666Open in IMG/M
3300013765|Ga0120172_1045456All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1151Open in IMG/M
3300013770|Ga0120123_1005869All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium2298Open in IMG/M
3300014157|Ga0134078_10348712All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria650Open in IMG/M
3300014487|Ga0182000_10297866All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria671Open in IMG/M
3300014488|Ga0182001_10100888All Organisms → cellular organisms → Bacteria896Open in IMG/M
3300014745|Ga0157377_10166540All Organisms → cellular organisms → Bacteria1375Open in IMG/M
3300015201|Ga0173478_10162625Not Available900Open in IMG/M
3300015261|Ga0182006_1097844All Organisms → cellular organisms → Bacteria1046Open in IMG/M
3300015359|Ga0134085_10570041All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium524Open in IMG/M
3300015372|Ga0132256_103293085All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria543Open in IMG/M
3300015373|Ga0132257_101685768All Organisms → cellular organisms → Bacteria812Open in IMG/M
3300015374|Ga0132255_102608608All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria772Open in IMG/M
3300017997|Ga0184610_1116081All Organisms → cellular organisms → Bacteria859Open in IMG/M
3300018031|Ga0184634_10240713All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria828Open in IMG/M
3300018071|Ga0184618_10420076All Organisms → cellular organisms → Bacteria565Open in IMG/M
3300018076|Ga0184609_10075633All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1481Open in IMG/M
3300018433|Ga0066667_10939270Not Available745Open in IMG/M
3300018433|Ga0066667_11039423All Organisms → cellular organisms → Bacteria707Open in IMG/M
3300018482|Ga0066669_10980538All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium762Open in IMG/M
3300019259|Ga0184646_1249428All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria552Open in IMG/M
3300019279|Ga0184642_1421424All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria507Open in IMG/M
3300020018|Ga0193721_1148405All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria567Open in IMG/M
3300020080|Ga0206350_11457087All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria601Open in IMG/M
3300020082|Ga0206353_10163267All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium540Open in IMG/M
3300021080|Ga0210382_10003456All Organisms → cellular organisms → Bacteria5093Open in IMG/M
3300021080|Ga0210382_10124024All Organisms → cellular organisms → Bacteria1093Open in IMG/M
3300021384|Ga0213876_10548937All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria615Open in IMG/M
3300022694|Ga0222623_10353350All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria561Open in IMG/M
3300022756|Ga0222622_10815828All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria682Open in IMG/M
3300022886|Ga0247746_1132466All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria627Open in IMG/M
3300025912|Ga0207707_11012175Not Available681Open in IMG/M
3300025912|Ga0207707_11534869All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria527Open in IMG/M
3300025913|Ga0207695_11088126Not Available679Open in IMG/M
3300025917|Ga0207660_11548102All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria535Open in IMG/M
3300025918|Ga0207662_10430676Not Available899Open in IMG/M
3300025920|Ga0207649_10556653All Organisms → cellular organisms → Bacteria878Open in IMG/M
3300025923|Ga0207681_10285656All Organisms → cellular organisms → Bacteria1301Open in IMG/M
3300025938|Ga0207704_10913652All Organisms → cellular organisms → Bacteria739Open in IMG/M
3300026023|Ga0207677_10259360All Organisms → cellular organisms → Bacteria1416Open in IMG/M
3300026078|Ga0207702_11730439All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria618Open in IMG/M
3300026111|Ga0208291_1093335All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Acidothermales → Acidothermaceae → Acidothermus → Acidothermus cellulolyticus527Open in IMG/M
3300026121|Ga0207683_11445800All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium635Open in IMG/M
3300026312|Ga0209153_1135568All Organisms → cellular organisms → Bacteria930Open in IMG/M
3300026326|Ga0209801_1183989All Organisms → cellular organisms → Bacteria855Open in IMG/M
3300026326|Ga0209801_1198899All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium805Open in IMG/M
3300026330|Ga0209473_1283198All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria557Open in IMG/M
3300026331|Ga0209267_1313635All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium520Open in IMG/M
3300026342|Ga0209057_1012215All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria5257Open in IMG/M
3300026536|Ga0209058_1341433All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria518Open in IMG/M
3300026538|Ga0209056_10706142All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria510Open in IMG/M
3300026552|Ga0209577_10067097All Organisms → cellular organisms → Bacteria2979Open in IMG/M
3300027787|Ga0209074_10498748All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium528Open in IMG/M
3300028597|Ga0247820_10707551All Organisms → cellular organisms → Bacteria702Open in IMG/M
3300028710|Ga0307322_10011303All Organisms → cellular organisms → Bacteria1979Open in IMG/M
3300028710|Ga0307322_10116015All Organisms → cellular organisms → Bacteria696Open in IMG/M
3300028711|Ga0307293_10033263All Organisms → cellular organisms → Bacteria1566Open in IMG/M
3300028712|Ga0307285_10075557All Organisms → cellular organisms → Bacteria867Open in IMG/M
3300028716|Ga0307311_10155373All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria659Open in IMG/M
3300028717|Ga0307298_10089384All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria869Open in IMG/M
3300028721|Ga0307315_10043674All Organisms → cellular organisms → Bacteria1232Open in IMG/M
3300028744|Ga0307318_10287131All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria576Open in IMG/M
3300028744|Ga0307318_10348798All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium521Open in IMG/M
3300028754|Ga0307297_10171004All Organisms → cellular organisms → Bacteria749Open in IMG/M
3300028755|Ga0307316_10158482All Organisms → cellular organisms → Bacteria808Open in IMG/M
3300028771|Ga0307320_10149644All Organisms → cellular organisms → Bacteria902Open in IMG/M
3300028771|Ga0307320_10309263All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium628Open in IMG/M
3300028778|Ga0307288_10407413All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces mirabilis554Open in IMG/M
3300028784|Ga0307282_10200334All Organisms → cellular organisms → Bacteria954Open in IMG/M
3300028787|Ga0307323_10254225All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium633Open in IMG/M
3300028791|Ga0307290_10147809All Organisms → cellular organisms → Bacteria860Open in IMG/M
3300028793|Ga0307299_10153887All Organisms → cellular organisms → Bacteria865Open in IMG/M
3300028796|Ga0307287_10077436All Organisms → cellular organisms → Bacteria1245Open in IMG/M
3300028799|Ga0307284_10331005All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium615Open in IMG/M
3300028802|Ga0307503_10688844All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria573Open in IMG/M
3300028807|Ga0307305_10190302All Organisms → cellular organisms → Bacteria944Open in IMG/M
3300028810|Ga0307294_10071244All Organisms → cellular organisms → Bacteria1052Open in IMG/M
3300028814|Ga0307302_10046805All Organisms → cellular organisms → Bacteria2010Open in IMG/M
3300028819|Ga0307296_10518847All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium652Open in IMG/M
3300028819|Ga0307296_10621160All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria591Open in IMG/M
3300028828|Ga0307312_10117813All Organisms → cellular organisms → Bacteria1662Open in IMG/M
3300028872|Ga0307314_10211318All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria588Open in IMG/M
3300028878|Ga0307278_10282763All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium734Open in IMG/M
3300028878|Ga0307278_10318508All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria687Open in IMG/M
3300028878|Ga0307278_10541917All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium507Open in IMG/M
3300028884|Ga0307308_10071123All Organisms → cellular organisms → Bacteria1643Open in IMG/M
3300028884|Ga0307308_10105784All Organisms → cellular organisms → Bacteria1340Open in IMG/M
3300028885|Ga0307304_10396116All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria623Open in IMG/M
3300030902|Ga0308202_1119656All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium562Open in IMG/M
3300030902|Ga0308202_1155445Not Available512Open in IMG/M
3300030903|Ga0308206_1146592All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria565Open in IMG/M
3300031058|Ga0308189_10546220All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria505Open in IMG/M
3300031092|Ga0308204_10116301All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria756Open in IMG/M
3300031092|Ga0308204_10343401All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria512Open in IMG/M
3300031093|Ga0308197_10311563All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria584Open in IMG/M
3300031094|Ga0308199_1183393All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria518Open in IMG/M
3300031096|Ga0308193_1082413All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria530Open in IMG/M
3300031099|Ga0308181_1145677All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria550Open in IMG/M
3300031099|Ga0308181_1180310All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria510Open in IMG/M
3300031170|Ga0307498_10245086All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria647Open in IMG/M
3300031229|Ga0299913_11441332Not Available643Open in IMG/M
3300031538|Ga0310888_10979407All Organisms → cellular organisms → Bacteria531Open in IMG/M
3300031720|Ga0307469_12141164All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria544Open in IMG/M
3300031996|Ga0308176_11131324All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium829Open in IMG/M
3300032074|Ga0308173_11311956All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria678Open in IMG/M
3300032126|Ga0307415_100323015All Organisms → cellular organisms → Bacteria1288Open in IMG/M
3300032126|Ga0307415_102210443All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria538Open in IMG/M
3300033412|Ga0310810_10263040All Organisms → cellular organisms → Bacteria1887Open in IMG/M
3300034643|Ga0370545_059866All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria759Open in IMG/M
3300034644|Ga0370548_111991All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria563Open in IMG/M
3300034644|Ga0370548_132306All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria528Open in IMG/M
3300034680|Ga0370541_043560All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria573Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil23.35%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil15.95%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil8.17%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil7.00%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost3.89%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere3.11%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil2.33%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil2.33%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.95%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment1.56%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.56%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil1.56%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere1.56%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere1.56%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.56%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere1.56%
SoilEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil1.17%
Polar Desert SandEnvironmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand1.17%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.17%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil1.17%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.17%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.78%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.78%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil0.78%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.78%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.78%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere0.78%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.78%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.78%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.78%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.78%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere0.78%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil0.39%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.39%
Unplanted SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil0.39%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.39%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.39%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.39%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil0.39%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands0.39%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.39%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere0.39%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.39%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere0.39%
Populus EndosphereHost-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere0.39%
Plant RootsHost-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots0.39%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.39%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.39%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.39%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2067725001Soil microbial communities from Great Prairies - Wisconsin Native Prairie soilEnvironmentalOpen in IMG/M
3300000044Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis soil oldHost-AssociatedOpen in IMG/M
3300000891Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soilEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300001305Grasslands soil microbial communities from Hopland, California, USAEnvironmentalOpen in IMG/M
3300001535Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A3-PF-15A)- 1 week illuminaEnvironmentalOpen in IMG/M
3300001538Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A10-PF 4A)- 1 week illuminaEnvironmentalOpen in IMG/M
3300002568Grasslands soil microbial communities from Hopland, California, USA - 2EnvironmentalOpen in IMG/M
3300004081Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2)EnvironmentalOpen in IMG/M
3300004153Grasslands soil microbial communities from Hopland, California, USA (version 2)EnvironmentalOpen in IMG/M
3300005171Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126EnvironmentalOpen in IMG/M
3300005181Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127EnvironmentalOpen in IMG/M
3300005184Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120EnvironmentalOpen in IMG/M
3300005186Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005344Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaGHost-AssociatedOpen in IMG/M
3300005345Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaGEnvironmentalOpen in IMG/M
3300005355Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaGHost-AssociatedOpen in IMG/M
3300005366Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaGHost-AssociatedOpen in IMG/M
3300005456Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaGHost-AssociatedOpen in IMG/M
3300005458Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaGEnvironmentalOpen in IMG/M
3300005471Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaGEnvironmentalOpen in IMG/M
3300005546Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaGEnvironmentalOpen in IMG/M
3300005549Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaGEnvironmentalOpen in IMG/M
3300005557Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153EnvironmentalOpen in IMG/M
3300005560Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119EnvironmentalOpen in IMG/M
3300005561Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148EnvironmentalOpen in IMG/M
3300005564Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaGHost-AssociatedOpen in IMG/M
3300005569Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154EnvironmentalOpen in IMG/M
3300005574Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143EnvironmentalOpen in IMG/M
3300005576Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157EnvironmentalOpen in IMG/M
3300005587Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103EnvironmentalOpen in IMG/M
3300005718Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005889Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_201EnvironmentalOpen in IMG/M
3300005905Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_0N_105EnvironmentalOpen in IMG/M
3300006032Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145EnvironmentalOpen in IMG/M
3300006034Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105EnvironmentalOpen in IMG/M
3300006049Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1Host-AssociatedOpen in IMG/M
3300006051Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4Host-AssociatedOpen in IMG/M
3300006058Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1Host-AssociatedOpen in IMG/M
3300006573Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAC (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006581Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006606Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006791Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102EnvironmentalOpen in IMG/M
3300006796Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114EnvironmentalOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300006800Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109EnvironmentalOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006881Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2Host-AssociatedOpen in IMG/M
3300006914Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5Host-AssociatedOpen in IMG/M
3300006969Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3Host-AssociatedOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009610Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT700EnvironmentalOpen in IMG/M
3300010037Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25EnvironmentalOpen in IMG/M
3300010041Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104AEnvironmentalOpen in IMG/M
3300010117Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_2_4_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010122Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_4_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010146Soil microbial communities from California, USA to study soil gas exchange rates - JR-CA-SND metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010154Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010166Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27EnvironmentalOpen in IMG/M
3300010303Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015EnvironmentalOpen in IMG/M
3300010325Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaGEnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300011332Soil microbial communities from California, USA to study soil gas exchange rates - SR-CA-SC2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300011971Permafrost microbial communities from Nunavut, Canada - A7_80cm_12MEnvironmentalOpen in IMG/M
3300012011Permafrost microbial communities from Nunavut, Canada - A30_65cm_6MEnvironmentalOpen in IMG/M
3300012014Permafrost microbial communities from Nunavut, Canada - A10_80cm_6MEnvironmentalOpen in IMG/M
3300012187Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ448 (21.06)EnvironmentalOpen in IMG/M
3300012198Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012203Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaGEnvironmentalOpen in IMG/M
3300012204Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012207Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaGEnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012285Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012350Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012353Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012354Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012356Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012358Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012359Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012360Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaGEnvironmentalOpen in IMG/M
3300012373Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_0_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012374Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_8_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012375Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_8_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012378Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_16_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012395Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_8_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012397Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_24_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012402Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_8_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012403Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_8_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012406Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_4_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012407Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_16_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012409Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_16_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012489Unplanted soil (control) microbial communities from North Carolina - M.Soil.5.yng.040610EnvironmentalOpen in IMG/M
3300012492Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610Host-AssociatedOpen in IMG/M
3300012527Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ83 (22.06)EnvironmentalOpen in IMG/M
3300012532Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012897Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S074-202C-1EnvironmentalOpen in IMG/M
3300012906Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S212-509R-1EnvironmentalOpen in IMG/M
3300012912Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S163-409C-2EnvironmentalOpen in IMG/M
3300012913Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S043-104R-2EnvironmentalOpen in IMG/M
3300012915Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2EnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300012976Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaGEnvironmentalOpen in IMG/M
3300013102Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaGHost-AssociatedOpen in IMG/M
3300013296Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaGHost-AssociatedOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300013501Permafrost microbial communities from Nunavut, Canada - A35_65cm_0.25MEnvironmentalOpen in IMG/M
3300013765Permafrost microbial communities from Nunavut, Canada - A30_80cm_6MEnvironmentalOpen in IMG/M
3300013770Permafrost microbial communities from Nunavut, Canada - A15_5cm_18MEnvironmentalOpen in IMG/M
3300014157Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300014487Bulk soil microbial communities from Mexico - Magueyal (Ma) metaGEnvironmentalOpen in IMG/M
3300014488Bulk soil microbial communities from Mexico - San Felipe (SF) metaGEnvironmentalOpen in IMG/M
3300014745Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaGHost-AssociatedOpen in IMG/M
3300015201Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1 (version 2)EnvironmentalOpen in IMG/M
3300015261Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaGHost-AssociatedOpen in IMG/M
3300015359Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015EnvironmentalOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300017997Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coexEnvironmentalOpen in IMG/M
3300018031Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1EnvironmentalOpen in IMG/M
3300018071Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1EnvironmentalOpen in IMG/M
3300018076Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coexEnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300019259Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019279Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300020018Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2s2EnvironmentalOpen in IMG/M
3300020080Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300020082Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300021080Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redoEnvironmentalOpen in IMG/M
3300021384Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9Host-AssociatedOpen in IMG/M
3300022694Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coexEnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300022886Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S079-202R-5EnvironmentalOpen in IMG/M
3300025912Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025913Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025917Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025918Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025920Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025923Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025938Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026023Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026078Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026111Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_CattailB_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300026121Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026312Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 (SPAdes)EnvironmentalOpen in IMG/M
3300026326Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes)EnvironmentalOpen in IMG/M
3300026330Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes)EnvironmentalOpen in IMG/M
3300026331Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 (SPAdes)EnvironmentalOpen in IMG/M
3300026342Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 (SPAdes)EnvironmentalOpen in IMG/M
3300026536Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes)EnvironmentalOpen in IMG/M
3300026538Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes)EnvironmentalOpen in IMG/M
3300026552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes)EnvironmentalOpen in IMG/M
3300027787Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes)EnvironmentalOpen in IMG/M
3300028597Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day14EnvironmentalOpen in IMG/M
3300028710Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_380EnvironmentalOpen in IMG/M
3300028711Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_150EnvironmentalOpen in IMG/M
3300028712Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_139EnvironmentalOpen in IMG/M
3300028716Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_198EnvironmentalOpen in IMG/M
3300028717Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_158EnvironmentalOpen in IMG/M
3300028721Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_355EnvironmentalOpen in IMG/M
3300028744Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_367EnvironmentalOpen in IMG/M
3300028754Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_157EnvironmentalOpen in IMG/M
3300028755Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_356EnvironmentalOpen in IMG/M
3300028771Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_369EnvironmentalOpen in IMG/M
3300028778Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_142EnvironmentalOpen in IMG/M
3300028784Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121EnvironmentalOpen in IMG/M
3300028787Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_381EnvironmentalOpen in IMG/M
3300028791Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_144EnvironmentalOpen in IMG/M
3300028793Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159EnvironmentalOpen in IMG/M
3300028796Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_141EnvironmentalOpen in IMG/M
3300028799Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123EnvironmentalOpen in IMG/M
3300028802Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_SEnvironmentalOpen in IMG/M
3300028807Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186EnvironmentalOpen in IMG/M
3300028810Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_151EnvironmentalOpen in IMG/M
3300028814Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183EnvironmentalOpen in IMG/M
3300028819Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153EnvironmentalOpen in IMG/M
3300028828Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202EnvironmentalOpen in IMG/M
3300028872Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_204EnvironmentalOpen in IMG/M
3300028878Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117EnvironmentalOpen in IMG/M
3300028884Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195EnvironmentalOpen in IMG/M
3300028885Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185EnvironmentalOpen in IMG/M
3300030902Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_356 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030903Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_369 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031058Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_184 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031092Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_367 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031093Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_198 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031094Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_203 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031096Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_194 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031099Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_152 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031170Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_SEnvironmentalOpen in IMG/M
3300031229Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT155D38EnvironmentalOpen in IMG/M
3300031538Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031996Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2EnvironmentalOpen in IMG/M
3300032074Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1EnvironmentalOpen in IMG/M
3300032126Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2Host-AssociatedOpen in IMG/M
3300033412Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NCEnvironmentalOpen in IMG/M
3300034643Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_120 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300034644Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_123 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300034680Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_116 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
GPWNP_021934102067725001SoilSLVLTLVGYAVLAAGGWLGGAIVFVHGMRVLSLVDEPAAKAVSPIPSPEKEEAEGA
ARSoilOldRDRAFT_00485333300000044Arabidopsis RhizosphereAIVFTHGMRVLKLVDEPTSRAISPLPKPEKEEAEA*
JGI10214J12806_1017226113300000891SoilALVFTHGMRVLKLVDEPTSRAISPLPKPEKEEAEA*
JGI10216J12902_10824809413300000956SoilAIVFVHGMRVLNLVEEPAKRAMAPAGEEKAEAERS*
JGI10216J12902_10930020213300000956SoilALLTLGGWLGGAVVFTHGMRVLQLVDEPTKRAVAPVPLTEKEKAEA*
JGI10216J12902_11093253713300000956SoilGGAITYVYGMRVLSLVEEPATRAAAPVPHEEKVEAEKS*
C688J14111_1002174933300001305SoilVYVHGMRVLNLVDEPADRAAAPVPHPEKEEAEGG*
C688J14111_1011576233300001305SoilGWLGGAVVYVHGMRVLSLTGEPPGRAVAPVPHPEKEMAEGG*
A3PFW1_1004731553300001535PermafrostAIVFVHGMRVLSLVKEPAARAAAPVPHPEKEMAEGS*
A10PFW1_1014057113300001538PermafrostVFVHGMRVLSLVKEPASRAAAPVPHPEKEMAEGS*
C688J35102_11919348333300002568SoilGWLGGAIVYVHGMRVLSLVEEPTERAIAPVPHEEKEAAQA*
Ga0063454_10028750813300004081SoilTLVGFAVLTLGGWLGGAVVFTHGMRVLSLVDEPTKRAVSPMPVPEMEEAEGGG*
Ga0063455_10144267613300004153SoilLTLVGFCLLTLGGWLGGAVVFTHGMRVLSLVDEPTKRAVSPMPLPEKEEAEA*
Ga0066677_1048327413300005171SoilGWLGGAIVFVHGMRVLSLVDEPSLKAAAPVVTPEKEAAEGG*
Ga0066678_1017565033300005181SoilIGGWLGGAIVFVHGMRVLSLVGEPTERAVSPAPKPEKEAAEGG*
Ga0066678_1036664513300005181SoilFLFMTLGGWLGGAIVFVHGMRVLSLVSEPAERAVAPVPHAEKEQAEGG*
Ga0066671_1012145813300005184SoilGGWLGGAVVFVHGMRVLSLVDERALRAAAPLPHDEKVDAAED*
Ga0066671_1102658713300005184SoilLTLGGWLGGAIVFVHGMRVLSLTGEPPGRAVAPVPHPEKEEAEGA*
Ga0066676_1112102113300005186SoilGWLGGAIVFVHGMRVLSLTGEPPGRAVSPLPHPEKEEAEA*
Ga0066676_1114227523300005186SoilGFGFLTLGGWLGGAVVYVHGMRVLSLTGEPPGRAVSPVPHPEKEEAEGA*
Ga0066388_10734419313300005332Tropical Forest SoilIGFALLTLGGWLGGALVFTHGNRVLKLVGAPTSMVSPPPKAEKEEAEA*
Ga0070661_10135547913300005344Corn RhizosphereWLGGAVVFVHGMRVLSLVDEPPDRAAAPVPHPEKEEAEA*
Ga0070692_1055058813300005345Corn, Switchgrass And Miscanthus RhizosphereLLTLGGWLGGAVVFTHGMRVLSLVDEPTKRAVSPMPLPEKEEAEGGG*
Ga0070671_10204868013300005355Switchgrass RhizosphereGGWLGGAIVFVHGMRVLSLVDEPPARAVAPAPHPEKEEAEA*
Ga0070659_10061368713300005366Corn RhizosphereGWLGGAVVFTHGMRVLALVDEPPGRAAIPGGAEKEEAEA*
Ga0070678_10094549033300005456Miscanthus RhizosphereGGWLGGAVVFTHGMRVLSLVDEPTKRAVSPMPLPEKEEAEGGG*
Ga0070681_1034266513300005458Corn RhizosphereLGGAITYVHGMRVLSLVDEPALRAAAPLPHDEKVDAAED*
Ga0070698_10162215823300005471Corn, Switchgrass And Miscanthus RhizosphereTLGGWLGGAIVFTHGMRVLKLKNEPAGRAVSPIPQAEKEQADGG*
Ga0070696_10178716013300005546Corn, Switchgrass And Miscanthus RhizosphereGGWLGGAVVFTHGMRVLKLVDEPARRAAAPIPTPEKRDAEGA*
Ga0070704_10038009233300005549Corn, Switchgrass And Miscanthus RhizosphereFAFLTLGGWLGGAVVFVHGMRVLSLVDEPPDRAAAPVPHPEKEEAEA*
Ga0066704_1054719513300005557SoilGGWLGGAIVFVHGMRVLSLVDEPSLKAAAPVVTPEKEAAEGG*
Ga0066670_1039060013300005560SoilTLGGWLGGAIVFVHGMRVLSLTGEPPGRAVAPVPHPEKEEAEGA*
Ga0066670_1047851613300005560SoilAVVYVHGMRVLSLVDEPPERAAAPVPHPEKEEAEA*
Ga0066699_1096599423300005561SoilGFGLLTLGGWLGGAIVFVHGMRVLSLVHEPASRAAAPIPHTEKEMAEGS*
Ga0066699_1114891623300005561SoilMTLGGWLGGAIVFVHGMRVLSLVQEPAERAVSPVPHAEKEQAEGG*
Ga0066699_1125552423300005561SoilGGSIVYVHGMRVLNLVTEPSHRAVAPVATPEKELAEKTS*
Ga0070664_10155868713300005564Corn RhizosphereLGFAFLTLGGWLGGAVVFVHGMRVLSLVGEPPDRAAAPVPHPEKEEAEA*
Ga0066705_1084725423300005569SoilLGGWLGGAIVFVHGMRVLSLTGEPPGRAIAPVPHPEKEEAEGA*
Ga0066694_1036732913300005574SoilWLGGSIVFVHGMRVLSLVDEPTARAIAPVVTPEKEEAAS*
Ga0066708_1039192833300005576SoilTLIGFGLLTLGGWLGGAVVFVHGMRVLSLVDEPAAKAVSPLPQPEKEEAEA*
Ga0066708_1048129613300005576SoilGSIVFVHGMRVLSLVQEPPGRAVSPVPKPEKEAAEGS*
Ga0066654_1031268113300005587SoilLTLIGFGLLTLGGWLGGAIVFVHGMRVLSLVHEPASRAAAPVPHPEKEMAEGS*
Ga0068866_1054312113300005718Miscanthus RhizosphereAVVFTHGMRVLNLVDEPPERAAIPGGAEKEEAEA*
Ga0066903_10075238533300005764Tropical Forest SoilVIGFGFLTLGGWLGGAIVFVHGMRVLSLVREHTARAVSPVPHPEQEMAQRG*
Ga0075290_106313423300005889Rice Paddy SoilLLGFGFLTLGGWLGGSIVFVHGMRVLKLVDEPPDRAAAPVAHPEKEEAEA*
Ga0075269_1010829723300005905Rice Paddy SoilVVFVHGMRVLNLAEEPPSRAAAPVATPEKEEASVI*
Ga0066696_1079063813300006032SoilVVYVHGMRVLSLVEEPPGRAVAPVPHPEKEEASA*
Ga0066696_1080736513300006032SoilWLGGTIVFVHGMRVLSLVDEPAGRAVSPLPKPEKESAEGS*
Ga0066656_1055073813300006034SoilIVFVHGMRVLSLTGEPPGRAVSPLPHPEKEAAEGS*
Ga0066656_1058530133300006034SoilGGAVVFVHGMRVLSLVNEPAERAVAPVPHAEKEQAEGG*
Ga0075417_1044892813300006049Populus RhizosphereVVFVHGMRVLSLIDEPPARAAAPAPHPEKEEAEN*
Ga0075364_1078161413300006051Populus EndosphereVGGAIVFVHGMRVLSLVDEPAGRAMAPTGEEKAEAERS*
Ga0075432_1015331213300006058Populus RhizosphereLGGAVVFTHGMRVLDLVDEPPKRAAIPGGSEKKEAEA*
Ga0074055_1000984413300006573SoilGAIVFTHGMRVLKLVDEPTSRAVSPLPKPEKEEAEA*
Ga0074048_1346762413300006581SoilTLGGWLGGAIVFTHGMRVLSLVDEPTKRAVSPMPLPEKEEAEGGG*
Ga0074062_1003778123300006606SoilIVFTHGMRVLKLVDEPTSRAISPLPKPEKEEAEA*
Ga0066653_1041309533300006791SoilFGFLTLGGWLGGAIVFVHGMRVLSLTSEPPGRAVAPVPHPEKEEAEGG*
Ga0066665_1020696033300006796SoilTLGGWLGGAVVFVHGMRVLSLVDEPTARAVSPAPSPEKEEAEGG*
Ga0066659_1080778613300006797SoilALTVVGFLFMTLGGWLGGAIVFVHGMRVLSLVSEPAERAVAPVPHAEKEQAEGG*
Ga0066659_1193012823300006797SoilLTVVGFGLMTLGGWLGGSIVFVHGMRVLSLVGEPTERAVSPVPKPEKEAAEGS*
Ga0066660_1000763213300006800SoilAITYVHGMRVLKLVDEPALRAAAPLPHDEKVDAAED*
Ga0066660_1018629513300006800SoilVSSGAYALTVIGFGFLTLGGWLGGAVVYVHGMRVLSLVDEPTQRAVAPVPHAEKERAEGS
Ga0075428_10188818913300006844Populus RhizosphereILAFGGWVGGAIVFVHGMRVLSLVDEPAGRAMAPTGEEKAEAERS*
Ga0075425_10062028613300006854Populus RhizosphereVFVHGMRVLNLVEEPPARAAAPVPHPEKQEAEAG*
Ga0075434_10108484233300006871Populus RhizosphereIVFVHGMRVLNLVKEPTERAISPVPHAEKEMAEGG*
Ga0068865_10074531233300006881Miscanthus RhizosphereILTLVGFGFLTLGGWLGGAVVFTHGMRVLQLVDEPPARAVAPVSHPEKQEAEGG*
Ga0075436_10029620133300006914Populus RhizosphereGGWLGGAVVFVHGMRVLSLVDEPPDRAAAPVPHPEKEEAEA*
Ga0075419_1078585533300006969Populus RhizosphereIVFVHGMRVLSLVDEPAGRAMAPTGEEKAEAERS*
Ga0066710_10000285613300009012Grasslands SoilGGAIVFVHGMRVLSLVSEPAERAVSPVPHAEKEQAEGG
Ga0075418_1103280813300009100Populus RhizosphereVFGYGMRVLNLTKEPTERAIAPVAHPEKEMAEGS*
Ga0066709_10235732733300009137Grasslands SoilTLGGWLGGAIVFVHGMRVLSLVEEPTERAVAPVSHPEKERAEGA*
Ga0066709_10412801123300009137Grasslands SoilFGLLTLGGWLGGAIVFVHGMRVLSLIEEPAGRAVAPVVTPEKERAEGA*
Ga0105242_1105511513300009176Miscanthus RhizosphereIVFVHGMRVLSLVDEPAGRAMAPAAHPEKKEAAEG*
Ga0105242_1131250733300009176Miscanthus RhizosphereGGWLGGAVVFTHGMRVLNLADESPQRAALPGGSEKEEAEA*
Ga0105340_115117533300009610SoilGSVVFVHGMRVLNLVDEPARRAAAPVATPEKREAEGA*
Ga0126304_1056181933300010037Serpentine SoilLLTAGGWLGGAVVYVHGMRVLKLVDEPAERAVAPVPHPEKEMAEGS*
Ga0126312_1003148253300010041Serpentine SoilGAVVFTHGMRVLNLVEEPTARAVTPGHPEKEHAEA*
Ga0127449_109416623300010117Grasslands SoilFVLNLIGFGLLTLGGWLGDAVVYVHGMRVLSLVEEPPGRAVAPVPHPEKEEASA*
Ga0127488_113936823300010122Grasslands SoilGFAVLTLGGWLGGAIVFTHGMRVLELVEEPTSRAISPLPKPEKEEAEA*
Ga0126320_130823613300010146SoilETGPFLLTLVGFGFLTLGGWLGGAIVFVHGMRVLSLTSEPPGRAVAPVPHPEKEEAEGG*
Ga0127503_1037635733300010154SoilGAFALTVAGFATMALGGWLGGAIVFVHGMRVLGLPKEPALRAVSPYPHEEKVAAQK*
Ga0126306_1034464413300010166Serpentine SoilLGGAVVFTHGMRVLNLVEEPTRRAVTPGHPEKEMAEE*
Ga0134082_1016514113300010303Grasslands SoilLGGWLGGAIVFVHGMRVLSLTGEPPGRAVAPVPHPEKEEAEGA*
Ga0134064_1051194523300010325Grasslands SoilWLGGSIVFVHGMRVLSLVQEPAGRAVSPVPKPEKEAAEGG*
Ga0134125_1075567713300010371Terrestrial SoilGGAIVFVHGMRVLSLPEEPSRRAIAPAPHPEKQAAEGA*
Ga0134126_1130574433300010396Terrestrial SoilFLTLGGWLGGAVVFVHGMRVLSLVDEPPDRAAAPVPHPEKEEAEA*
Ga0134127_1009108833300010399Terrestrial SoilGGAIVFVHGMRVLSLVDEPPARAVAPAPHPEKEEAEA*
Ga0126317_1018693913300011332SoilLVGFAFLTLGGWLGGAVVFVHGMRVLSLVDEPPDRAAAPVPHREKEEAEA*
Ga0120175_100689543300011971PermafrostVSAGPFILTLIGFALLTLGGIFGGSIVFVHGMRVLKLKDEPAKEALSPLNQRKEQAEG*
Ga0120152_100285413300012011PermafrostSSGAFVLTAIGFGLLTLGGWLGGAIVFVHGMRVLKLKSEPAGRAVSPIPHSEKERAEED*
Ga0120159_101092613300012014PermafrostGLLTLGGWLGGAIVFVHGMHVLSLVKEPASRATVPVPHPEKEMAEGS*
Ga0136622_1030405713300012187Polar Desert SandLTLIGFGLLTLGGWIGGSVVYVHGMRVLGLRDEPAEQAVTPGHTEKGQTQAS*
Ga0137364_1063817733300012198Vadose Zone SoilVGFGFLTLGGWLGGAVVYVHGMRVLKLVKEPSERAVSPVPHKEKEMAEGA*
Ga0137399_1118638023300012203Vadose Zone SoilTLVGYGLLTLGGWLGGAIVFVHGMRVLSLVDEPATRAAAPVATPEKERAEGT*
Ga0137374_1000201283300012204Vadose Zone SoilVFVHGMRVLSLVEEPAERSIAPVATPEKEEAEGA*
Ga0137381_1028094513300012207Vadose Zone SoilAIVFVHGMRVLSLTGEPPGRAVAPVPRPEKEEAEGA*
Ga0137376_1061092123300012208Vadose Zone SoilGFGLLTLGGWLGGAIVFVHGMRVLSLVHEPASRAAAPVPHPEKEMAEGS*
Ga0137376_1066269813300012208Vadose Zone SoilGPFILTLVGFCFLTLGGWLGGAIVFVHGMRVLSLTSEPPGRAVAPVPHPEKEEAEGA*
Ga0150985_11487883023300012212Avena Fatua RhizosphereVVFVHGMRVLSLPGEPPGRAAAPVPHPEKEAAEGS*
Ga0137370_1029302713300012285Vadose Zone SoilTIGGWLGGAVVFVHGMRVLSLVDEPAGRAVAPIPHPEKEDAEA*
Ga0137372_1031826933300012350Vadose Zone SoilVYVHGMRVLNLRKEPTGRAVAPAAHPEKEMAEGS*
Ga0137367_1079050723300012353Vadose Zone SoilSLILTLVGFGILTLGGWLGGAVVFVHGMRVLSLVDEPAKRAASPVEYPEKEEAEGGS*
Ga0137366_1032501433300012354Vadose Zone SoilVFVHGMRVLNLTGEPPGRAIAPAAHPEKEMAEGS*
Ga0137371_1093963823300012356Vadose Zone SoilGWLGGAVVFVHGMRVLSLVKEPAARAAAPLPHPEKEAAEGG*
Ga0137371_1107926113300012356Vadose Zone SoilLAGFGFLTLGGWLGGAIVFVHGMRVLSLTSEPPGRAVAPRSHPEKEEAEGA*
Ga0137368_1006029233300012358Vadose Zone SoilIVFVHGMRVLSLVDEPASRAVSPIPHPEKEEAEGS*
Ga0137385_1080103013300012359Vadose Zone SoilIVFVHGMRVLSLVDEPAGRAVSPLPKPEKEKAEGS*
Ga0137375_1043975613300012360Vadose Zone SoilVYVHGMRVLNLLHEPTERAVAPAPQPEKERAEGS*
Ga0137375_1120320813300012360Vadose Zone SoilVFVHGMRVLSLVEEPTERAIAPAPHPEKEEAEGA*
Ga0134042_100645813300012373Grasslands SoilTLVGFAVLTLGGWLGGAIVFTHGMRVLELVEEPTSRAISPLPKPEKEEAEA*
Ga0134039_118514023300012374Grasslands SoilLLTLGGWLGGSIVFVHGMRVLSLVQEPASRAVSPVPKPEKEAAEGG*
Ga0134034_101515423300012375Grasslands SoilGAFALTLVGFGLMTLGGWLGGAVVYVHGMRVLSLVQEPTERAVAPVPHPEKEMAEGG*
Ga0134025_121308613300012378Grasslands SoilGFAFLTLGGWLGGAIVFVHGMRVLSLTGEPPGRAVSPLPHPEKEAAEGS*
Ga0134044_124659913300012395Grasslands SoilLVLTLVGYGLLATGGWLGGAIVFTHGMRVLKLVDEPTSRAVSPLPKPEKEEAEA*
Ga0134056_117181523300012397Grasslands SoilVSSGSYALTVIGFGFLTLGGWFGGAVVFVHGMRVLSLVDEPTGRAVAPVPHAGKERAEGG
Ga0134059_121995013300012402Grasslands SoilTHANTSDGAYALTLIGFAFMTLGGWLGGAVVFVHGMRVLSLVKEPAERAVSPVPHAEKEQAEGG*
Ga0134049_118869813300012403Grasslands SoilVKSGPFLLTLVGYAVLTLGGWIGGSITFVHGMRVLGLQDEPTRRAISPLPKPEKEQSEG*
Ga0134053_133309623300012406Grasslands SoilVVFVHGMRVLSLVDEPPERAVAPAPHPEKEEAEA*
Ga0134050_117847913300012407Grasslands SoilGFAFLTLGGWLGGAVVFVHGMRVLSLVKEPAERAVAPVPHAEKEQAEGG*
Ga0134050_119598723300012407Grasslands SoilVGFAVLTLGGWLGGAIVFTHGMRVLELVEEPTSRAISPLPKPEKEEAEA*
Ga0134045_131886523300012409Grasslands SoilVLTVIGFGILTLGGWLGGAIVFVHGMRVLSLKSEPAGRAVSPIPHAEKEQAD*
Ga0150984_10423689813300012469Avena Fatua RhizosphereCSSDLVFVHVMRVLNLVDEPTDRAVAPVPHPEKEAAES*
Ga0150984_10881675813300012469Avena Fatua RhizosphereVVFVHGMRVLGLVDEPPGRAAAPVAHPEKEDAAAG*
Ga0157349_102851013300012489Unplanted SoilGGWLGGAVVFVHGMRVLSLVDEPPERAAAPAPHQEKEEAEA*
Ga0157335_100874633300012492Arabidopsis RhizosphereGWLGGAVVFVHGMRVLSLVDEPPERAAAPAPHQEKEEAEA*
Ga0136633_105817233300012527Polar Desert SandFGLLTLGGWLGGAIVFVHGMRVLGLEEEPTHRAVSPVPHPEEKRAES*
Ga0136633_128992713300012527Polar Desert SandVFVHGMRVLNLVDEPARRAAAPVATPEKREAEGA*
Ga0137373_1023910613300012532Vadose Zone SoilGFGFLTLGGWLGGAVVYVHGMRVLSLVQEPAERAVAPVPHPEKEMAEGT*
Ga0137373_1062053433300012532Vadose Zone SoilVYVHGMRVLSLVDEPTERAVSPKPHPEKEMAEGG*
Ga0157285_1004999633300012897SoilVVFVHGMRVLNLVDEPARRAAAPVATPEKREAEGA*
Ga0157285_1011341833300012897SoilRRLARGAVVFTHGMRVLNLVDEPAMRAVSPMPLPEKEEAEGGG*
Ga0157295_1020287433300012906SoilLTLGGWFGGAVVFVHGMRVLSLVDEPPERAVAPAPHPEKEEAEA*
Ga0157306_1020728233300012912SoilVGGWLGGAVVFTHGMRVLNLADESPQRAALPGGREKEEAEA*
Ga0157298_1032060213300012913SoilILTLVGFAFLTLGGWLGGAIVFVHGMRVLSLVDEPPDRAASPVPHPEKEEAEA*
Ga0157302_1014255923300012915SoilGWLGGAVVFTHGIRVLNLVEEPPERAAIPGGAEKEEAEA*
Ga0164301_1022810133300012960SoilVFVHGMRVLSLPEEPSGRAIAPAPHPEKEAAEGA*
Ga0126369_1180415013300012971Tropical Forest SoilGGAIVFVYGMRVLSLADEPPARALAPAPHPEKEEPEA*
Ga0134076_1022142313300012976Grasslands SoilLLTAGGWFGGAIVYVHGMRVLSLVDEPAERAVAPVPHAEKEMAEGS*
Ga0134076_1046571613300012976Grasslands SoilGLLATGGWLGGAIVFTHGMRVLKLVDEPTSRAVSPLPKPEKEEAEA*
Ga0134076_1058670613300012976Grasslands SoilVLTVIGFGILTLGGWLGGAIVFVHGMRVLSLKNEPAGRAVSPIPHAEKEQAEG*
Ga0157371_1037684913300013102Corn RhizosphereRGGVGVFTHGMRVLQLVDEPPARAVAPVSHPEKQEAEGG*
Ga0157374_1039971743300013296Miscanthus RhizosphereVLTLLGFGFLTLGGWLGGAVVFVHGMRVLSLVDEPPDRAAAPVPHPEKEEAEA*
Ga0157378_1021071733300013297Miscanthus RhizosphereLTLGGWLGGAVVFTHGMRVLQLVDEPPARAVAPVSHPEKQEAEGG*
Ga0120154_1000461213300013501PermafrostGNVSSGAFVLTVIGFGLLTLGGWLGGAIVFVHGMRVLKLKSEPAGRAVSPIPHSEKERAEGG*
Ga0120154_101895213300013501PermafrostGVVETGPFILTLVGFGFLTLGGWLGGAIVFVHGMRVLGLPDEPTARAISPTPYPEKQKAEG*
Ga0120154_109946323300013501PermafrostLLTLGGWLGGAIVFVHGMHVLSLVKEPASRATVPVPHPEKEMAEGS*
Ga0120172_104545623300013765PermafrostVFVHGMRVLSLVKEPASRATVPVPHPEKEMAEGS*
Ga0120123_100586913300013770PermafrostAGPFILTLIGFALLTLGGIFGGSIVFVHGMRVLKLKDEPAKEALSPLNQRKEQAEG*
Ga0134078_1034871233300014157Grasslands SoilLGGWLGGAIVYVHGMRVLSLVEEPTERAIAPVPHEEKEAAQA*
Ga0182000_1029786623300014487SoilSIVFVHGMRVLNLVEEPTSKAVTPGHSEKELAEEG*
Ga0182001_1010088813300014488SoilIVYVHGMRVLNLLQEPTERAVSPVPHPEKEMAEGA*
Ga0157377_1016654013300014745Miscanthus RhizosphereTLGGWLGGAIVFVHGMRVLSLVDEPPERAIAPAPHPEKEEAEA*
Ga0173478_1016262533300015201SoilGGAVVFVHGMRVLSLIDEPPARAAAPAPHPEKEEAEN*
Ga0182006_109784433300015261RhizosphereWLGGAVTYVHGMRVLSLVDEPAEKAVAPVPSDEKVEAEA*
Ga0134085_1057004113300015359Grasslands SoilGSIVFVHGMRVLSLVDEPTERAISPLPEKELADKS*
Ga0132256_10329308523300015372Arabidopsis RhizosphereGWVGGAIVFVHGMRVLSLVDEPAGRAMAPTGEEKAEAERS*
Ga0132257_10168576833300015373Arabidopsis RhizosphereVGFAFLTLGGWLGGAVVFVHGMRVLSLVDEPPDRAAAPVPHPEKEEAEA*
Ga0132255_10260860823300015374Arabidopsis RhizosphereWLGGAVVFTHGMRVLNLVDEPPQRAAIPGGAEKEEAEA*
Ga0184610_111608113300017997Groundwater SedimentAYALTLIGFALLTLGGWLGGAIVFVHGMRVLKLKSEPAGRAVSPIPHAEKEEAD
Ga0184634_1024071313300018031Groundwater SedimentGWLGGAVVFTHGMRVLNLVDEPPERAAIPGGAEKEEAEA
Ga0184618_1042007613300018071Groundwater SedimentTLGGWLGGAIVFVHGMRVLSLVYEPASRAAAPVPHPEKEMAEGS
Ga0184609_1007563343300018076Groundwater SedimentGGAIVFTYDMRVLNLVDEPASRAVTPGHPEKERAEG
Ga0066667_1093927023300018433Grasslands SoilFLALTAGGWLGGAITYVHGMRVLSLVDEPALRAAAPLPHDEKVEAAEN
Ga0066667_1103942333300018433Grasslands SoilGFGLMTLGGWLGGAVVYVHGMRVLSLVQEPTERAVAPVPHPEKEMAEGG
Ga0066669_1098053823300018482Grasslands SoilFLLTLVGFGFLTLGGWLGGAIVFVHGMRVLSLTSEPPGRAVAPVPHPEKEEAEGG
Ga0184646_124942823300019259Groundwater SedimentTLGGWLGGAIVYVHGMRVLGLAKEPTGRAVSPLPHAEKEEAEGAS
Ga0184642_142142423300019279Groundwater SedimentLTLGGWLGGAIVFVHGMRVLSLVDEPTKRAVSPLPHEEKEAAEGS
Ga0193721_114840513300020018SoilLGGAIVFVHGMRVLSLVDEPAGRAASPLPKPEKEKAEGV
Ga0206350_1145708723300020080Corn, Switchgrass And Miscanthus RhizosphereTLIAFALLTLGGWLGGAVVFTHGMRVLRLVDEPTKRAVSPMPLPEKEEAEGGG
Ga0206353_1016326713300020082Corn, Switchgrass And Miscanthus RhizosphereLGGWLGGAIVFVHGMRVLSLVDEPPERAIAPAPHPEKEEAEA
Ga0210382_1000345653300021080Groundwater SedimentMSRDVGATVFVHGMRILNLESEPAGRAVSPIPHAEKERAEGG
Ga0210382_1012402433300021080Groundwater SedimentGGWLGGAIVYVHGMRVLGLAKEPTGRAVSPLPHAEKEEAEGA
Ga0213876_1054893713300021384Plant RootsGGTIVFVHGMRVLSLAKEPWRRAIAPVPHPEKEMAAGD
Ga0222623_1035335013300022694Groundwater SedimentVDGAIGGASLILTLVGFGLLTIGGWLGGAIVFVHGMRVLSLVDEPAARAVSPMPHPEKEEAEGS
Ga0222622_1081582813300022756Groundwater SedimentVVFVHGMRVLNLVDEPARRAAAPVATPEKREAEGV
Ga0247746_113246613300022886SoilANVFVHGMRVLNLVDEPTARAISPLPHPEKEEAEA
Ga0207707_1101217523300025912Corn RhizosphereGFVVLTLGGWLGGAVVFVHGMRVLGLVQLPWRRAVTPGGPPDDASA
Ga0207707_1153486923300025912Corn RhizosphereGSVSGGSLVLTLVAFGLLTLGGWLGGAIVFTHGMRVLSLVDEPTKRAVSPMPLPEKEEAEGGG
Ga0207695_1108812613300025913Corn RhizosphereGWLGGAVTFVHGMRVLSLVDEPAQKAVAPVPTREKVEAGEG
Ga0207660_1154810223300025917Corn RhizosphereGGWLGGAVVFTHGMRVLNLADESPQHAALPGGPEKEEAEA
Ga0207662_1043067613300025918Switchgrass RhizosphereAIVFVYGMRVLSLVNEPVSRAAVPLPHTEKERAEGS
Ga0207649_1055665333300025920Corn RhizosphereVLTLLGFAFLTLGGWLGGAVVFVHGMRVLSLVDEPPDRAAAPVPHPEKEEAEA
Ga0207681_1028565633300025923Switchgrass RhizosphereLIAFALLTLGGWLGGAVVFTHGMRVLSLVDEPTKRAVSPMPLPEKEEAEGGG
Ga0207704_1091365233300025938Miscanthus RhizosphereGAVVFTYGMRVLQLVDEPPARAVAPVPHPEKQEAEGG
Ga0207677_1025936033300026023Miscanthus RhizosphereAVVFTYGMRVLQLVDEPPARAVAPVPHPEKQEAEGG
Ga0207702_1173043913300026078Corn RhizosphereWLGGAIVFVHGMRVLSLPEEPSGRAIAPAPHPEKEAAEGA
Ga0208291_109333513300026111Natural And Restored WetlandsTAGGWLGGAITFVHGMRVLGLADEPATRAAAPLPREEDAADG
Ga0207683_1144580013300026121Miscanthus RhizosphereGGAVVFTHGMRVLNLADESPQRAALPGGSEKEEAEA
Ga0209153_113556833300026312SoilTAGPFVLTVVGFGLLALGGWFGGAVVYVHGMRVLSLVREPAVRAASPVPKPEKEAAEGG
Ga0209801_118398913300026326SoilFLFMTLGGWLGGAIVFVHGMRVLSLVSEPAERAVAPVPHAEKEQAEGG
Ga0209801_119889933300026326SoilLLTLGGWLGGAIVFVHGMRVLSLVGEPTERAVSPAPKPEKEAAEGG
Ga0209473_128319813300026330SoilSIVFVHGMRVLSLVQEPAGRAVSPVPKPEKEAAEGS
Ga0209267_131363513300026331SoilFILTLVGFAFLTLGGWLGGAIVFVHGMRVLSLTGEPPGRAVSPLPHPEKEAAEGS
Ga0209057_101221513300026342SoilGFGFLTLGGWLGGAIVFVHGMRVLSLTGEPPGRAVAPVPHPEKEEAEGA
Ga0209058_134143323300026536SoilNVGSGAYTLTVIGFLFMTLGAWLGGAIVFVHGMRVLSLVSEPAERAVSPVPHAEKEQAEG
Ga0209056_1070614223300026538SoilFVLTVVGFGLLTLGGWLGGSIVFVHGMRVLSLVGEPTERAVSPVPKPEKEAAEGS
Ga0209577_1006709713300026552SoilGNVSGGAYTLTVIGFLFMTLGGWLGGAIVFVHGMRVLSLVKEPAERAVSPVPHAEKKQAEGG
Ga0209074_1049874823300027787Agricultural SoilTLVGFAVLTLGGWLGGAIVYVHGMRVLSLVDEPPARAVAPAPHPEKEEAEA
Ga0247820_1070755113300028597SoilSIVFVHGMRVLGLVDEPPERAVAPVAHPEKEEAAA
Ga0307322_1001130313300028710SoilLVLTLVGYILLAAGGWLGGAIVFTHGMRVLKLADEPTSRAISPLPKPEKEEAEA
Ga0307322_1011601533300028710SoilVVFTHGMRVLQLVDEPPARAVAPVPHPEKQEAEGG
Ga0307293_1003326333300028711SoilANVGAGAYALTLIGFGFLTLGGWLGGAIVYVHGMRVLGLAKEPTGRAVSPLPHAEKEEAEGA
Ga0307285_1007555733300028712SoilVETGPFILTLVGFGFLTLGGWLGGAVVFTHGMRVLQLVDEPPARAVAPVPHPEKQESEGG
Ga0307311_1015537313300028716SoilVVYVHGMRVLSLVKEPAGRAVSPVPHAEKEQAEGG
Ga0307298_1008938413300028717SoilTLIGFASMTIGGWLGGAIVFVHGMRVLSLVDEPAMRAASPLPKPEKERAEGS
Ga0307315_1004367413300028721SoilTLGGWLGGAIVFVHGMRVLGLKSEPAGRAVSPIPHAEKEEAD
Ga0307318_1028713113300028744SoilLILTLVGFGLLTLGGWLGGAIVFVHGMRVLSLVDEPAARAVSPLPHPEKEEAEGG
Ga0307318_1034879823300028744SoilILTLVGFGFLTLGGWLGGAVVFTHGMRVLQLVDEPPARAVAPVPHPEKQEAEGG
Ga0307297_1017100433300028754SoilGPFILTLVGFGFLTLGGWFGGAVVFTHGMRVLQLVDEPPARAVAPVPHPEKQEAEGG
Ga0307316_1015848213300028755SoilVEAGPFVLTLLGFAFLTLGGWLGGAVVFVHGMRVLSLVDEPPARAASPAPHPEKEDAAS
Ga0307320_1014964413300028771SoilVGAGAYALTLIGFGFLTLGGWLGGAIVYVHGMRVLGLAKEPTGRAVSPLPHAEKEEAEGA
Ga0307320_1030926313300028771SoilVVYVHGMRVLSLTGEPPGRAVAPVPHPEKEEAEGS
Ga0307288_1040741323300028778SoilTLIGFGLLTLGGWLGGAIVFVHGMRVLSLVHEPASRAAAPVPHPEKERAEGS
Ga0307282_1020033413300028784SoilWLGGAIVFVHGMRVLSLVDEPAGRAASPLPKPEKEKAEGV
Ga0307323_1025422513300028787SoilAVEAGPFVLTLLGFAFLTLGGWLGGAVVFVHGMRVLSLVDEPPSRAASPAPHPEKEDAAS
Ga0307290_1014780913300028791SoilFLTLGGWLGGAVVFVHGMRVLSLVDEPPARAAAPVPHSEKEEAEA
Ga0307299_1015388713300028793SoilLIGFALLTLGGWLGGAIVFVHGMRVLGLKSEPAGRAVSPIPHAEKEEAEGG
Ga0307287_1007743613300028796SoilGGSLVLTLVGYILLAAGGWLGGAIVFTHGMRVLKLVDEPTSRAISPLPKPEKEEAEA
Ga0307284_1033100523300028799SoilGGWLGGAITYVHGMRVLSLVYEPALRAAAPLPHDEKVEAAED
Ga0307503_1068884423300028802SoilWFGGTVVFTHGMRVLKLADEPTSRATSPLPKPEQEEAEA
Ga0307305_1019030233300028807SoilGGANVFVHGMRVLSLVDEPTKRAVSPLPHEEKEEAEGG
Ga0307294_1007124433300028810SoilTLVGFGFLTLGGWLGGAVVFTHGMRVLQLVDEPPARAVAPVPHPEKQEAEGG
Ga0307302_1004680533300028814SoilGGAIVFTHGMRVLKLVDEPTSRAISPLPKPEKEEAEA
Ga0307296_1051884733300028819SoilLGGSIVFVHGMRVLNLVDEPPDRAAAPVAHPEKKEAEA
Ga0307296_1062116013300028819SoilAIVFVHGMRVLKLKSEPAGRAVSPIPHPEKEKAEGG
Ga0307312_1011781333300028828SoilANVSAGAYVLTVIGFGFLTLGGWLGGAIVYVHGMRVLGLAKEPTERAVAPMPHPEKEKAEGA
Ga0307314_1021131813300028872SoilGAYALTLIAFGLLTLGGWLGGAVVYVHGMRVLSLVKEPAGRAVSPVPHAEKEQAEGG
Ga0307278_1028276333300028878SoilHGAVRTWPFIATLIGFGFLTLGGWLGGAVVYVHGMRVLSLTSEPPGRAVSPVPHPEKDEAEGG
Ga0307278_1031850813300028878SoilLGGAIVFTHGMRVLKLVDEPTSRAISPLPKPEKEEAEA
Ga0307278_1054191723300028878SoilLTLGGWLGGAVVFVHGMRVLSLVDEPPARAAAPVPHSEKEEAEA
Ga0307308_1007112313300028884SoilTLGGWLGGAIVFVHGMRVLSLTGEPPGRAVSPLPHPEKEEAEA
Ga0307308_1010578433300028884SoilIVFVYGMRVLKLKDEPAGRAVSPIPHTEKEKAESS
Ga0307304_1039611623300028885SoilEAYALTLIGFALLTLGGWLGGAIVFVRGMRVLKLKSEPAGRAVSPIPHPEKEKAEGG
Ga0308202_111965623300030902SoilLVGFGFLTLGGWLGGAVVFTHGMRVLQLVDEPPARAVAPVPHPEKQESEGG
Ga0308202_115544523300030902SoilVGFAALSAGGWLGGAITYVHGMRVLSLPDEPATRAASPVPHEEKVEAEA
Ga0308206_114659213300030903SoilIGGGSLILTLVGFGLLTLGGWLGGAIVFVHGMRVLSLVDEPAGRAVSPLPHPEKEEAEGG
Ga0308189_1054622013300031058SoilLGGAVVFTHGMRVLSLVDEQTNRAVSPMPLPEKEEAEGAG
Ga0308204_1011630123300031092SoilGAVVFTHGMRVLNLADEPPERAAIPGGAEKEEAEA
Ga0308204_1034340113300031092SoilTLVGFGVLTLGGWLGGAIVFVHGMRVLSLVDEPAARAVSPMPHPEKEEAEGG
Ga0308197_1031156313300031093SoilSVGGGSLVLTIVGYVLLAAGGWLGGAIVFTHGMRVLKLVAEPTSRAVSPLPKPEKEEAEA
Ga0308199_118339323300031094SoilWLGGAIVFTHGMRVLKLVDEPTSRAISPLPKPEKEEAGA
Ga0308193_108241323300031096SoilSVGGGSLILTLVAYVLLAAGGWLGGAIVFTHGMRVLKLVDEPTSRAISPLPKPEKEEAEA
Ga0308181_114567723300031099SoilLAAGGWLGGAIVFTHGMRVLKLVDEPTSRAISPLPKPEKEEAEA
Ga0308181_118031013300031099SoilVIGFGFLTLGGWLGGAIVYVHGMRVLGLAKEPTERAVAPMPHPEKEKAEGA
Ga0307498_1024508623300031170SoilGAIVFVHGMRVLSLVDEPPSRAATPVPHAEKERAEGS
Ga0299913_1144133213300031229SoilVFVHGMRVLELPEEPAARAATPGGEEKERAEGRRG
Ga0310888_1097940723300031538SoilGFAALTAGGWLGGAVVFTHGMRVLDLVDEPPKRAAIPGGSEKKEAEA
Ga0307469_1214116423300031720Hardwood Forest SoilLAAGGWLGGAIVFTHGMRVLKLVDEPTSRAISSLPKPEKEEAEA
Ga0308176_1113132423300031996SoilTLIGFGLLTLGGWLGGAIVYVHGMRVLSLVQEPAPRAAAPVAHPEKELAEGS
Ga0308173_1131195633300032074SoilILTLIGFGLLTLGGWLGGAVVYVHGMRVLQLVGEPTGRAVAPVPHPEKEMAEGS
Ga0307415_10032301513300032126RhizosphereLTLGGWLGGSIVFVHGMRVLSLVQEPVERAVSPAPKPEKEAAEGSD
Ga0307415_10221044313300032126RhizosphereVSSSALVLTLVAYGVLAVGGWVGGAITYVHGMRVLELVDEPASRAVQPLTPEKEEAERS
Ga0310810_1026304013300033412SoilWLGGAVVFVHGMRVLSLVDEPPDRAAAPVPHPEKEEAEA
Ga0370545_059866_102_2933300034643SoilMAAAAGSPSLKRTIVGYVLLAAGGWLGGAIVFTHGMRVLKLVDEPTSRAVSPLEKPEKEEAEA
Ga0370548_111991_1_1593300034644SoilLTLIGFSLLTLGGIFGGSIVFVHGMRVLKLRDEPAKEALSPLPNERKEQAEG
Ga0370548_132306_355_5133300034644SoilLTVVGYVLLAAGGWLGGAIVFTHGMRVLKLVDEPTSRAISPLPKPEKEEAEA
Ga0370541_043560_457_5733300034680SoilGGAIVYVHGMRVLGLAKEPTGRAVSPLPHAEKEEAEGA


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.