| Basic Information | |
|---|---|
| Family ID | F014907 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 259 |
| Average Sequence Length | 42 residues |
| Representative Sequence | VYAIDAQDKVAAHAGHHVTVKGTVDGDTLKLASIEMAK |
| Number of Associated Samples | 193 |
| Number of Associated Scaffolds | 259 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 1.54 % |
| % of genes near scaffold ends (potentially truncated) | 97.68 % |
| % of genes from short scaffolds (< 2000 bps) | 86.49 % |
| Associated GOLD sequencing projects | 177 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.49 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (99.614 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (29.730 % of family members) |
| Environment Ontology (ENVO) | Unclassified (30.502 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (49.035 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 7.58% β-sheet: 28.79% Coil/Unstructured: 63.64% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.49 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 259 Family Scaffolds |
|---|---|---|
| PF01979 | Amidohydro_1 | 68.73 |
| PF13594 | Obsolete Pfam Family | 4.63 |
| PF02823 | ATP-synt_DE_N | 3.09 |
| PF00462 | Glutaredoxin | 1.93 |
| PF02874 | ATP-synt_ab_N | 1.54 |
| PF00430 | ATP-synt_B | 1.16 |
| PF00401 | ATP-synt_DE | 1.16 |
| PF00306 | ATP-synt_ab_C | 1.16 |
| PF07690 | MFS_1 | 0.77 |
| PF00248 | Aldo_ket_red | 0.39 |
| PF13468 | Glyoxalase_3 | 0.39 |
| PF04030 | ALO | 0.39 |
| PF00006 | ATP-synt_ab | 0.39 |
| PF16313 | DUF4953 | 0.39 |
| PF01797 | Y1_Tnp | 0.39 |
| PF14588 | YjgF_endoribonc | 0.39 |
| PF00702 | Hydrolase | 0.39 |
| COG ID | Name | Functional Category | % Frequency in 259 Family Scaffolds |
|---|---|---|---|
| COG0355 | FoF1-type ATP synthase, epsilon subunit | Energy production and conversion [C] | 4.25 |
| COG0055 | FoF1-type ATP synthase, beta subunit | Energy production and conversion [C] | 1.16 |
| COG0056 | FoF1-type ATP synthase, alpha subunit | Energy production and conversion [C] | 1.16 |
| COG0711 | FoF1-type ATP synthase, membrane subunit b or b' | Energy production and conversion [C] | 1.16 |
| COG1155 | Archaeal/vacuolar-type H+-ATPase catalytic subunit A/Vma1 | Energy production and conversion [C] | 1.16 |
| COG1156 | Archaeal/vacuolar-type H+-ATPase subunit B/Vma2 | Energy production and conversion [C] | 1.16 |
| COG0277 | FAD/FMN-containing lactate dehydrogenase/glycolate oxidase | Energy production and conversion [C] | 0.39 |
| COG1943 | REP element-mobilizing transposase RayT | Mobilome: prophages, transposons [X] | 0.39 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 99.61 % |
| Unclassified | root | N/A | 0.39 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000651|AP72_2010_repI_A10DRAFT_1059570 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 508 | Open in IMG/M |
| 3300000789|JGI1027J11758_11922067 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 666 | Open in IMG/M |
| 3300000955|JGI1027J12803_100857231 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 1204 | Open in IMG/M |
| 3300000955|JGI1027J12803_102242215 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 2495 | Open in IMG/M |
| 3300001661|JGI12053J15887_10648375 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300002886|JGI25612J43240_1071582 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
| 3300002908|JGI25382J43887_10432168 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 557 | Open in IMG/M |
| 3300002914|JGI25617J43924_10129976 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 881 | Open in IMG/M |
| 3300002914|JGI25617J43924_10159864 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 767 | Open in IMG/M |
| 3300004080|Ga0062385_10012602 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2940 | Open in IMG/M |
| 3300004082|Ga0062384_100787856 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 663 | Open in IMG/M |
| 3300004082|Ga0062384_100807872 | All Organisms → cellular organisms → Bacteria | 656 | Open in IMG/M |
| 3300004092|Ga0062389_100101187 | All Organisms → cellular organisms → Bacteria | 2552 | Open in IMG/M |
| 3300005167|Ga0066672_10976103 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 519 | Open in IMG/M |
| 3300005169|Ga0066810_10030330 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 962 | Open in IMG/M |
| 3300005174|Ga0066680_10288085 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1047 | Open in IMG/M |
| 3300005175|Ga0066673_10245591 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1035 | Open in IMG/M |
| 3300005332|Ga0066388_100359126 | All Organisms → cellular organisms → Bacteria | 2103 | Open in IMG/M |
| 3300005332|Ga0066388_102502362 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 938 | Open in IMG/M |
| 3300005436|Ga0070713_100050752 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3428 | Open in IMG/M |
| 3300005539|Ga0068853_101673105 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 617 | Open in IMG/M |
| 3300005553|Ga0066695_10698117 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 595 | Open in IMG/M |
| 3300005554|Ga0066661_10026361 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3159 | Open in IMG/M |
| 3300005555|Ga0066692_10085990 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1837 | Open in IMG/M |
| 3300005586|Ga0066691_10309109 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 933 | Open in IMG/M |
| 3300005993|Ga0080027_10407611 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300006163|Ga0070715_10752285 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 587 | Open in IMG/M |
| 3300006173|Ga0070716_101370125 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 574 | Open in IMG/M |
| 3300006176|Ga0070765_100978693 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 800 | Open in IMG/M |
| 3300006237|Ga0097621_102114411 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 538 | Open in IMG/M |
| 3300006354|Ga0075021_10439929 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 821 | Open in IMG/M |
| 3300006804|Ga0079221_10128242 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1293 | Open in IMG/M |
| 3300006806|Ga0079220_12049191 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 511 | Open in IMG/M |
| 3300006871|Ga0075434_102428242 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300006904|Ga0075424_101504666 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 714 | Open in IMG/M |
| 3300007076|Ga0075435_101276015 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 643 | Open in IMG/M |
| 3300007255|Ga0099791_10040090 | All Organisms → cellular organisms → Bacteria | 2078 | Open in IMG/M |
| 3300007255|Ga0099791_10317951 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 743 | Open in IMG/M |
| 3300007265|Ga0099794_10114733 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1352 | Open in IMG/M |
| 3300007265|Ga0099794_10323800 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 800 | Open in IMG/M |
| 3300007265|Ga0099794_10416723 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 702 | Open in IMG/M |
| 3300007265|Ga0099794_10583409 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 591 | Open in IMG/M |
| 3300009038|Ga0099829_10168318 | All Organisms → cellular organisms → Bacteria | 1759 | Open in IMG/M |
| 3300009038|Ga0099829_10212225 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1570 | Open in IMG/M |
| 3300009038|Ga0099829_10371904 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1179 | Open in IMG/M |
| 3300009088|Ga0099830_10030244 | All Organisms → cellular organisms → Bacteria | 3649 | Open in IMG/M |
| 3300009088|Ga0099830_10867148 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 746 | Open in IMG/M |
| 3300009088|Ga0099830_11085852 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 663 | Open in IMG/M |
| 3300009088|Ga0099830_11108628 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 656 | Open in IMG/M |
| 3300009137|Ga0066709_101164194 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1135 | Open in IMG/M |
| 3300009792|Ga0126374_10797792 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 721 | Open in IMG/M |
| 3300010043|Ga0126380_11112619 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 674 | Open in IMG/M |
| 3300010046|Ga0126384_11690869 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 598 | Open in IMG/M |
| 3300010048|Ga0126373_10236971 | All Organisms → cellular organisms → Bacteria | 1788 | Open in IMG/M |
| 3300010325|Ga0134064_10014443 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2173 | Open in IMG/M |
| 3300010360|Ga0126372_12075544 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 616 | Open in IMG/M |
| 3300010360|Ga0126372_12739285 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 545 | Open in IMG/M |
| 3300010360|Ga0126372_13102982 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 516 | Open in IMG/M |
| 3300010361|Ga0126378_10247580 | All Organisms → cellular organisms → Bacteria | 1875 | Open in IMG/M |
| 3300010361|Ga0126378_10331880 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1628 | Open in IMG/M |
| 3300010361|Ga0126378_11748975 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 707 | Open in IMG/M |
| 3300010361|Ga0126378_12486919 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 591 | Open in IMG/M |
| 3300010361|Ga0126378_12653206 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 572 | Open in IMG/M |
| 3300010362|Ga0126377_11038673 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 887 | Open in IMG/M |
| 3300010366|Ga0126379_10066087 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3060 | Open in IMG/M |
| 3300010373|Ga0134128_10059505 | All Organisms → cellular organisms → Bacteria | 4401 | Open in IMG/M |
| 3300010376|Ga0126381_103340223 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 632 | Open in IMG/M |
| 3300010863|Ga0124850_1074158 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1028 | Open in IMG/M |
| 3300010876|Ga0126361_10640577 | All Organisms → cellular organisms → Bacteria | 2578 | Open in IMG/M |
| 3300011120|Ga0150983_10375224 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 572 | Open in IMG/M |
| 3300011271|Ga0137393_10306324 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 1353 | Open in IMG/M |
| 3300012096|Ga0137389_11793609 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 509 | Open in IMG/M |
| 3300012189|Ga0137388_10086386 | All Organisms → cellular organisms → Bacteria | 2660 | Open in IMG/M |
| 3300012189|Ga0137388_10924599 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 806 | Open in IMG/M |
| 3300012200|Ga0137382_10644985 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 758 | Open in IMG/M |
| 3300012200|Ga0137382_10648124 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 756 | Open in IMG/M |
| 3300012202|Ga0137363_11692092 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 525 | Open in IMG/M |
| 3300012203|Ga0137399_11175926 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 646 | Open in IMG/M |
| 3300012203|Ga0137399_11196471 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 640 | Open in IMG/M |
| 3300012203|Ga0137399_11704585 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 519 | Open in IMG/M |
| 3300012205|Ga0137362_11020191 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 704 | Open in IMG/M |
| 3300012205|Ga0137362_11235564 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 632 | Open in IMG/M |
| 3300012207|Ga0137381_10019959 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 5293 | Open in IMG/M |
| 3300012207|Ga0137381_11107155 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 681 | Open in IMG/M |
| 3300012210|Ga0137378_11033684 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 736 | Open in IMG/M |
| 3300012211|Ga0137377_10553099 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 1089 | Open in IMG/M |
| 3300012212|Ga0150985_100460611 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 526 | Open in IMG/M |
| 3300012349|Ga0137387_10368023 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 1041 | Open in IMG/M |
| 3300012357|Ga0137384_11549459 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 512 | Open in IMG/M |
| 3300012361|Ga0137360_10881537 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 771 | Open in IMG/M |
| 3300012362|Ga0137361_10083309 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2739 | Open in IMG/M |
| 3300012362|Ga0137361_10327232 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 1405 | Open in IMG/M |
| 3300012362|Ga0137361_10707964 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 920 | Open in IMG/M |
| 3300012363|Ga0137390_10216530 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1902 | Open in IMG/M |
| 3300012363|Ga0137390_11280212 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 679 | Open in IMG/M |
| 3300012363|Ga0137390_11292319 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 675 | Open in IMG/M |
| 3300012363|Ga0137390_11841510 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 535 | Open in IMG/M |
| 3300012685|Ga0137397_10607234 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 814 | Open in IMG/M |
| 3300012917|Ga0137395_10000927 | All Organisms → cellular organisms → Bacteria | 13026 | Open in IMG/M |
| 3300012917|Ga0137395_10449832 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 925 | Open in IMG/M |
| 3300012917|Ga0137395_11121591 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
| 3300012918|Ga0137396_10298291 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1191 | Open in IMG/M |
| 3300012918|Ga0137396_10322654 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1142 | Open in IMG/M |
| 3300012922|Ga0137394_10674188 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 871 | Open in IMG/M |
| 3300012923|Ga0137359_11235799 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 635 | Open in IMG/M |
| 3300012924|Ga0137413_10466705 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 922 | Open in IMG/M |
| 3300012925|Ga0137419_10387460 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1089 | Open in IMG/M |
| 3300012925|Ga0137419_11640275 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 547 | Open in IMG/M |
| 3300012927|Ga0137416_11084659 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 718 | Open in IMG/M |
| 3300012927|Ga0137416_11694350 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 577 | Open in IMG/M |
| 3300012929|Ga0137404_11179914 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 704 | Open in IMG/M |
| 3300012929|Ga0137404_11599631 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 604 | Open in IMG/M |
| 3300012929|Ga0137404_11676768 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 590 | Open in IMG/M |
| 3300012944|Ga0137410_10394713 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1114 | Open in IMG/M |
| 3300012961|Ga0164302_11444585 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 564 | Open in IMG/M |
| 3300012971|Ga0126369_11018244 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 916 | Open in IMG/M |
| 3300013306|Ga0163162_13059015 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 537 | Open in IMG/M |
| 3300014157|Ga0134078_10032411 | All Organisms → cellular organisms → Bacteria | 1724 | Open in IMG/M |
| 3300014157|Ga0134078_10152550 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 910 | Open in IMG/M |
| 3300014166|Ga0134079_10407659 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 634 | Open in IMG/M |
| 3300015053|Ga0137405_1079040 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 725 | Open in IMG/M |
| 3300015053|Ga0137405_1154373 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1187 | Open in IMG/M |
| 3300015053|Ga0137405_1192267 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 728 | Open in IMG/M |
| 3300015053|Ga0137405_1348306 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4133 | Open in IMG/M |
| 3300015054|Ga0137420_1285319 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1270 | Open in IMG/M |
| 3300015054|Ga0137420_1305411 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 788 | Open in IMG/M |
| 3300015193|Ga0167668_1014512 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1771 | Open in IMG/M |
| 3300015357|Ga0134072_10320957 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 584 | Open in IMG/M |
| 3300015373|Ga0132257_100243553 | All Organisms → cellular organisms → Bacteria | 2145 | Open in IMG/M |
| 3300016319|Ga0182033_11956036 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 534 | Open in IMG/M |
| 3300016341|Ga0182035_10745095 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 856 | Open in IMG/M |
| 3300016341|Ga0182035_11664748 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 576 | Open in IMG/M |
| 3300016341|Ga0182035_11742460 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
| 3300016371|Ga0182034_11193813 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 662 | Open in IMG/M |
| 3300016387|Ga0182040_10256383 | All Organisms → cellular organisms → Bacteria | 1317 | Open in IMG/M |
| 3300016387|Ga0182040_10950844 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 714 | Open in IMG/M |
| 3300016387|Ga0182040_11596924 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
| 3300016404|Ga0182037_11187790 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 670 | Open in IMG/M |
| 3300016404|Ga0182037_11745429 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 555 | Open in IMG/M |
| 3300017657|Ga0134074_1119277 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 912 | Open in IMG/M |
| 3300017659|Ga0134083_10110005 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1092 | Open in IMG/M |
| 3300017822|Ga0187802_10019560 | All Organisms → cellular organisms → Bacteria | 2315 | Open in IMG/M |
| 3300017929|Ga0187849_1174803 | All Organisms → cellular organisms → Bacteria | 852 | Open in IMG/M |
| 3300017938|Ga0187854_10013409 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4917 | Open in IMG/M |
| 3300017955|Ga0187817_11041704 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300017961|Ga0187778_10564270 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 761 | Open in IMG/M |
| 3300017973|Ga0187780_10001279 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 18981 | Open in IMG/M |
| 3300017974|Ga0187777_10321206 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1061 | Open in IMG/M |
| 3300018001|Ga0187815_10354329 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
| 3300018015|Ga0187866_1045689 | All Organisms → cellular organisms → Bacteria | 2012 | Open in IMG/M |
| 3300018062|Ga0187784_10944513 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 686 | Open in IMG/M |
| 3300018064|Ga0187773_10352685 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 838 | Open in IMG/M |
| 3300018085|Ga0187772_11137260 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 574 | Open in IMG/M |
| 3300018086|Ga0187769_11494234 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 511 | Open in IMG/M |
| 3300018088|Ga0187771_11671624 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 540 | Open in IMG/M |
| 3300018433|Ga0066667_10341755 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1185 | Open in IMG/M |
| 3300018482|Ga0066669_10689900 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 899 | Open in IMG/M |
| 3300019789|Ga0137408_1142279 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1098 | Open in IMG/M |
| 3300020199|Ga0179592_10182089 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 956 | Open in IMG/M |
| 3300020579|Ga0210407_10818377 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 717 | Open in IMG/M |
| 3300020579|Ga0210407_10874587 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 690 | Open in IMG/M |
| 3300020579|Ga0210407_11162174 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 582 | Open in IMG/M |
| 3300020580|Ga0210403_10044207 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3559 | Open in IMG/M |
| 3300020581|Ga0210399_10816470 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 761 | Open in IMG/M |
| 3300020583|Ga0210401_10010533 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 9044 | Open in IMG/M |
| 3300020583|Ga0210401_10272753 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1551 | Open in IMG/M |
| 3300020583|Ga0210401_10682425 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 888 | Open in IMG/M |
| 3300020583|Ga0210401_10753718 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 834 | Open in IMG/M |
| 3300021088|Ga0210404_10118289 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1359 | Open in IMG/M |
| 3300021088|Ga0210404_10331297 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 842 | Open in IMG/M |
| 3300021168|Ga0210406_10176312 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1783 | Open in IMG/M |
| 3300021168|Ga0210406_11275061 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 530 | Open in IMG/M |
| 3300021170|Ga0210400_11256461 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 595 | Open in IMG/M |
| 3300021171|Ga0210405_11212949 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 558 | Open in IMG/M |
| 3300021171|Ga0210405_11251665 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 547 | Open in IMG/M |
| 3300021178|Ga0210408_10380680 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1124 | Open in IMG/M |
| 3300021180|Ga0210396_11254406 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 618 | Open in IMG/M |
| 3300021181|Ga0210388_11331802 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 605 | Open in IMG/M |
| 3300021420|Ga0210394_11555018 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 558 | Open in IMG/M |
| 3300021432|Ga0210384_10014975 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 7669 | Open in IMG/M |
| 3300021432|Ga0210384_10443499 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1169 | Open in IMG/M |
| 3300021433|Ga0210391_11073117 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 626 | Open in IMG/M |
| 3300021478|Ga0210402_11637568 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 570 | Open in IMG/M |
| 3300021478|Ga0210402_11939328 | Not Available | 515 | Open in IMG/M |
| 3300021479|Ga0210410_10552762 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1025 | Open in IMG/M |
| 3300021560|Ga0126371_10968481 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 993 | Open in IMG/M |
| 3300021560|Ga0126371_13536452 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 527 | Open in IMG/M |
| 3300023250|Ga0224544_1043278 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 643 | Open in IMG/M |
| 3300024288|Ga0179589_10435477 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 604 | Open in IMG/M |
| 3300024330|Ga0137417_1061931 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 878 | Open in IMG/M |
| 3300024330|Ga0137417_1316915 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1510 | Open in IMG/M |
| 3300025448|Ga0208037_1037961 | All Organisms → cellular organisms → Bacteria | 989 | Open in IMG/M |
| 3300025910|Ga0207684_10023750 | All Organisms → cellular organisms → Bacteria | 5233 | Open in IMG/M |
| 3300025916|Ga0207663_10170738 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1544 | Open in IMG/M |
| 3300025939|Ga0207665_10114655 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1897 | Open in IMG/M |
| 3300026301|Ga0209238_1234691 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 542 | Open in IMG/M |
| 3300026304|Ga0209240_1212649 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 585 | Open in IMG/M |
| 3300026313|Ga0209761_1060358 | All Organisms → cellular organisms → Bacteria | 2066 | Open in IMG/M |
| 3300026316|Ga0209155_1000884 | All Organisms → cellular organisms → Bacteria | 14254 | Open in IMG/M |
| 3300026320|Ga0209131_1068029 | All Organisms → cellular organisms → Bacteria | 1954 | Open in IMG/M |
| 3300026446|Ga0257178_1035270 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 631 | Open in IMG/M |
| 3300026523|Ga0209808_1129830 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1016 | Open in IMG/M |
| 3300026548|Ga0209161_10059737 | All Organisms → cellular organisms → Bacteria | 2448 | Open in IMG/M |
| 3300026557|Ga0179587_10858477 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
| 3300026557|Ga0179587_10940489 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 569 | Open in IMG/M |
| 3300027460|Ga0207506_1004739 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1005 | Open in IMG/M |
| 3300027643|Ga0209076_1001623 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4656 | Open in IMG/M |
| 3300027660|Ga0209736_1085539 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 865 | Open in IMG/M |
| 3300027671|Ga0209588_1102460 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 921 | Open in IMG/M |
| 3300027680|Ga0207826_1139882 | All Organisms → cellular organisms → Bacteria | 662 | Open in IMG/M |
| 3300027748|Ga0209689_1218288 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 818 | Open in IMG/M |
| 3300027783|Ga0209448_10193788 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 675 | Open in IMG/M |
| 3300027829|Ga0209773_10043233 | All Organisms → cellular organisms → Bacteria | 1808 | Open in IMG/M |
| 3300027846|Ga0209180_10458530 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 718 | Open in IMG/M |
| 3300027862|Ga0209701_10008269 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 6804 | Open in IMG/M |
| 3300027862|Ga0209701_10415599 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 747 | Open in IMG/M |
| 3300027875|Ga0209283_10987142 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 503 | Open in IMG/M |
| 3300027882|Ga0209590_10496136 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 789 | Open in IMG/M |
| 3300027894|Ga0209068_10700939 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 593 | Open in IMG/M |
| 3300027894|Ga0209068_10820898 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 548 | Open in IMG/M |
| 3300027903|Ga0209488_10704432 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 723 | Open in IMG/M |
| 3300027911|Ga0209698_10634914 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 818 | Open in IMG/M |
| 3300027915|Ga0209069_10235753 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 946 | Open in IMG/M |
| 3300028047|Ga0209526_10809163 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
| 3300028573|Ga0265334_10233804 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
| 3300028673|Ga0257175_1094322 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 583 | Open in IMG/M |
| 3300029636|Ga0222749_10086927 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1447 | Open in IMG/M |
| 3300030991|Ga0073994_12364247 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 869 | Open in IMG/M |
| 3300031122|Ga0170822_10886813 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 766 | Open in IMG/M |
| 3300031128|Ga0170823_14454199 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 781 | Open in IMG/M |
| 3300031573|Ga0310915_10482048 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 881 | Open in IMG/M |
| 3300031640|Ga0318555_10095557 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1561 | Open in IMG/M |
| 3300031720|Ga0307469_10212325 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1522 | Open in IMG/M |
| 3300031720|Ga0307469_10243891 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1440 | Open in IMG/M |
| 3300031744|Ga0306918_10931353 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 676 | Open in IMG/M |
| 3300031753|Ga0307477_10003007 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 12721 | Open in IMG/M |
| 3300031753|Ga0307477_10425771 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 907 | Open in IMG/M |
| 3300031771|Ga0318546_10031610 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3159 | Open in IMG/M |
| 3300031771|Ga0318546_10092825 | All Organisms → cellular organisms → Bacteria | 1968 | Open in IMG/M |
| 3300031820|Ga0307473_10335147 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 966 | Open in IMG/M |
| 3300031879|Ga0306919_10785009 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 732 | Open in IMG/M |
| 3300031893|Ga0318536_10228111 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 948 | Open in IMG/M |
| 3300031912|Ga0306921_10602096 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1271 | Open in IMG/M |
| 3300031942|Ga0310916_10326595 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1301 | Open in IMG/M |
| 3300031946|Ga0310910_10417523 | All Organisms → cellular organisms → Bacteria | 1063 | Open in IMG/M |
| 3300031962|Ga0307479_10199772 | All Organisms → cellular organisms → Bacteria | 1969 | Open in IMG/M |
| 3300031962|Ga0307479_10397356 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1363 | Open in IMG/M |
| 3300032001|Ga0306922_10119724 | All Organisms → cellular organisms → Bacteria | 2799 | Open in IMG/M |
| 3300032052|Ga0318506_10053618 | All Organisms → cellular organisms → Bacteria | 1634 | Open in IMG/M |
| 3300032174|Ga0307470_10204744 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1264 | Open in IMG/M |
| 3300032180|Ga0307471_101636449 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 799 | Open in IMG/M |
| 3300032205|Ga0307472_100548491 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1008 | Open in IMG/M |
| 3300032261|Ga0306920_100100011 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4293 | Open in IMG/M |
| 3300032783|Ga0335079_10887000 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 917 | Open in IMG/M |
| 3300032892|Ga0335081_11769376 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 670 | Open in IMG/M |
| 3300033290|Ga0318519_10969571 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 527 | Open in IMG/M |
| 3300033433|Ga0326726_11048938 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 792 | Open in IMG/M |
| 3300033820|Ga0334817_049436 | All Organisms → cellular organisms → Bacteria | 826 | Open in IMG/M |
| 3300034091|Ga0326724_0283175 | All Organisms → cellular organisms → Bacteria | 931 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 29.73% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 15.06% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 6.95% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.79% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.63% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 4.25% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.86% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 3.09% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.70% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.32% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.32% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.93% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.54% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.54% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.16% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.16% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.16% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.16% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.77% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.77% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.77% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.77% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.77% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.39% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.39% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.39% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.39% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.39% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.39% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.39% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.39% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.39% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.39% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.39% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.39% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.39% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.39% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.39% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000651 | Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A10 | Environmental | Open in IMG/M |
| 3300000789 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
| 3300002886 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm | Environmental | Open in IMG/M |
| 3300002908 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002914 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm | Environmental | Open in IMG/M |
| 3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005169 | Soil and rhizosphere microbial communities from Laval, Canada - mgHPA | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005993 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010863 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (PacBio error correction) | Environmental | Open in IMG/M |
| 3300010876 | Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
| 3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015193 | Arctic soil microbial communities from a glacier forefield, Rabots glacier, Tarfala, Sweden (Sample Rb6, proglacial stream) | Environmental | Open in IMG/M |
| 3300015357 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300017657 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015 | Environmental | Open in IMG/M |
| 3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
| 3300017929 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_100 | Environmental | Open in IMG/M |
| 3300017938 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_150 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300018001 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_5 | Environmental | Open in IMG/M |
| 3300018015 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_150 | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018064 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300023250 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P1 10-14 | Environmental | Open in IMG/M |
| 3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025448 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_100 (SPAdes) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026313 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026316 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 (SPAdes) | Environmental | Open in IMG/M |
| 3300026320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026446 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-11-B | Environmental | Open in IMG/M |
| 3300026523 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 (SPAdes) | Environmental | Open in IMG/M |
| 3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027460 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-ROWE17-C (SPAdes) | Environmental | Open in IMG/M |
| 3300027643 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027660 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027680 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 80 (SPAdes) | Environmental | Open in IMG/M |
| 3300027748 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes) | Environmental | Open in IMG/M |
| 3300027783 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027829 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027915 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Host-Associated | Open in IMG/M |
| 3300028673 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-69-B | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030991 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-1A (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031122 | Oak Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031128 | Oak Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032052 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| 3300033820 | Peat soil microbial communities from Stordalen Mire, Sweden - 713 E-2-D | Environmental | Open in IMG/M |
| 3300034091 | Peat soil microbial communities from McLean, Ithaca, NY, United States - MB00N | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| AP72_2010_repI_A10DRAFT_10595701 | 3300000651 | Forest Soil | KKIYAIDDQDKVAAHAGHHVTVKGTATGDSIKLASIDMAPEKGN* |
| JGI1027J11758_119220672 | 3300000789 | Soil | DADKKVYVVDAQDKVAAHAGHHVTVKGSVDGETLKLSSIEMAPPAKGM* |
| JGI1027J12803_1008572312 | 3300000955 | Soil | DQDKVAAHAGHHVTVKGSASGDSIKLASIDMAPEKGT* |
| JGI1027J12803_1022422151 | 3300000955 | Soil | DQDKVAAHAGHHVTVKGTASGDAIKLASIDMAPEKGM* |
| JGI12053J15887_106483751 | 3300001661 | Forest Soil | QDKVAAHAGHHVTVKGSVDGETLKLTSIDMAPAKGM* |
| JGI25612J43240_10715822 | 3300002886 | Grasslands Soil | VNDEDKKVYAIADQDKVTPHAGHHVAVKGSVEGDTLTIASIDMAPAKSK* |
| JGI25382J43887_104321681 | 3300002908 | Grasslands Soil | IDAQDKVAAHAGHHVTVKGSADGDTIKLSAVEMAPEPSK* |
| JGI25617J43924_101299761 | 3300002914 | Grasslands Soil | VFVNDADKKIYVVDAQDKVAAHAGHHVTVKGTVEGETLKLSSIDMAPAKSM* |
| JGI25617J43924_101598642 | 3300002914 | Grasslands Soil | VFVNDADKKIYVVDAQDKVAAHAGHHVTVKGTVDGENLKLTSIDMAPAKSM* |
| Ga0062385_100126025 | 3300004080 | Bog Forest Soil | KVYAIDNQDIVAAHAGHHVTVKGSVDGDTLKLASIDMAK* |
| Ga0062384_1007878562 | 3300004082 | Bog Forest Soil | YVVDAQDKVADHAGHHVIVKGTVDGGTLELESIDMAPASGK* |
| Ga0062384_1008078722 | 3300004082 | Bog Forest Soil | VFVNDADKKVYMIDDQDKVAAHAGHHVTVKGSVDGDTLKLKSIDMAKAM* |
| Ga0062389_1001011875 | 3300004092 | Bog Forest Soil | YVVDAQDKVADHAGHHVTVKGTVDGDTLKLESIDMAPANGK* |
| Ga0066672_109761031 | 3300005167 | Soil | VFVNDADKKVYVVDAQDKVAEHAGHHVTVKGTVEGDTLKLDSIEMAGK* |
| Ga0066810_100303301 | 3300005169 | Soil | VVDAQDKVAAHAGHHVTVKGTVDGETLKLDSIEMAAAGGK* |
| Ga0066680_102880852 | 3300005174 | Soil | DADKKVYVVDAQDKVAPHAGHHVTVKGAVEGDTLKLTSIDMAAATK* |
| Ga0066673_102455911 | 3300005175 | Soil | VNDTDKKVYAIDDQDKVAAHAGHHVTVKGKVEGDTLKLSSIEMASEKGM* |
| Ga0066388_1003591264 | 3300005332 | Tropical Forest Soil | DKKVYAIDAQDKVAAHAGHHVTVKGSVDGDSLKLTSIDMAK* |
| Ga0066388_1025023622 | 3300005332 | Tropical Forest Soil | YVFVNDADKKVYTIEDQSKVAEHAGHHVSIKGKVEGNTVKLSSIEMAARGK* |
| Ga0070713_1000507525 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | VYSLDDQSKVAEHAGHHVTVTGSVDGDSLKLSSIAMAAPKTK* |
| Ga0068853_1016731051 | 3300005539 | Corn Rhizosphere | KIFAIDDQSKVAEHAGHHVTVRGTVEGDALKLSSIEMAAKSK* |
| Ga0066695_106981171 | 3300005553 | Soil | AQDKVAAHAGHHVAVKGTVDGETLKLDSIDMAPATK* |
| Ga0066661_100263611 | 3300005554 | Soil | AQDKVAAHAGHHVTVKGTVDGETLKLSSIDMAPAVK* |
| Ga0066692_100859904 | 3300005555 | Soil | IDAQDKVAAHAGHHVTVKGTVEGDTLKLESIEMAPAAK* |
| Ga0066691_103091092 | 3300005586 | Soil | HKVYMIDAQDKVAAHAGHHVTVKGSVDGDNLKLAGLEMAK* |
| Ga0080027_104076111 | 3300005993 | Prmafrost Soil | VNDADKKVYAIDDQDKVAAHAGHHVTVTGSVTGDSLKLGTVSMAAAK* |
| Ga0070715_107522852 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | KKVYAIADQEKASAHAGHHVAVKGSVEGDTLTIASIDMAPAKSK* |
| Ga0070716_1013701252 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | DADKKVYVVDAQDKVAAHAGHHVTVKGTVEGETLELTSIDMAAAKSM* |
| Ga0070765_1009786931 | 3300006176 | Soil | YVVDAQDKVADHAGHHVIVKGTVDGGTLKLESIEMAPASGK* |
| Ga0097621_1021144112 | 3300006237 | Miscanthus Rhizosphere | FAIDDQSKVAEHAGHHVTVRGTVEGDTLKLSSIEMAAKSK* |
| Ga0075021_104399292 | 3300006354 | Watersheds | DKVAAHAGHHVTVKGTVDGENLKLSSIDMAAPAKTM* |
| Ga0079221_101282421 | 3300006804 | Agricultural Soil | VVDAQEKVAEHAGHHVTVKGTVEGETLKLSSIEMAAK* |
| Ga0079220_120491911 | 3300006806 | Agricultural Soil | QDKVAAHAGHHVTVKGSASGDSIKLASIDMAPEKGM* |
| Ga0075434_1024282422 | 3300006871 | Populus Rhizosphere | FVNDGDKKIFAIDDQSKVAEHAGHHVTVRGTVEGDTLKLSSIEMAAKSK* |
| Ga0075424_1015046661 | 3300006904 | Populus Rhizosphere | ADKKVYVVDAQDKVADHAGHHVTVKGTVEGDTLKLASIDMAAK* |
| Ga0075435_1012760151 | 3300007076 | Populus Rhizosphere | DKKIYAIDAQDQVAAHAGHHVTVKGSAEGDTIKLSAIEMAPDQGK* |
| Ga0099791_100400901 | 3300007255 | Vadose Zone Soil | VFVNDADKKVYVVDAQDKVAAHAGHHVTVKGTVEGETLKLTSIDMAAAATK* |
| Ga0099791_103179512 | 3300007255 | Vadose Zone Soil | VFVNDADKKVYVVDAQDKVAAHAGHHVTVKGTVEGETLKLTSIDMAAAAATK* |
| Ga0099794_101147331 | 3300007265 | Vadose Zone Soil | KKVYVVDAQDKVAAHAGHHVTVKGTVEGETLKLTSIDMAAAATK* |
| Ga0099794_103238002 | 3300007265 | Vadose Zone Soil | ADKKVYVVDAQDKVAAHAGHHVTVKGSVDGETLKLTSIDMAPAKGM* |
| Ga0099794_104167232 | 3300007265 | Vadose Zone Soil | VNDADKKIYVVDAQDKVAAHAGHHVTVKGTVDGETLKLTSIDMAAAATK* |
| Ga0099794_105834091 | 3300007265 | Vadose Zone Soil | DADKKVYVVDAQDKVAAHAGHHVTVKGTVEGETLKLTSIDMAAAAATK* |
| Ga0099829_101683183 | 3300009038 | Vadose Zone Soil | YAIDDQEKVSAHAGHHVTVKGSVEGDNLKLTSIDMAPAKGK* |
| Ga0099829_102122253 | 3300009038 | Vadose Zone Soil | VAAHAGHHVTVKGTVEGETLKLTSIDMAAPAKSM* |
| Ga0099829_103719042 | 3300009038 | Vadose Zone Soil | DAQDKVAAHSGHHVTVKGTVDGETLKLTSIDMAPAKSM* |
| Ga0099830_100302445 | 3300009088 | Vadose Zone Soil | FVNDADKKVYVVDAQDKVAPHAGHHVTVKGTVDGETLKLTSIDMAAAAK* |
| Ga0099830_108671482 | 3300009088 | Vadose Zone Soil | VAAHAGHHVTVKGTVDGETLKLTSIDMAAAAPAAK* |
| Ga0099830_110858522 | 3300009088 | Vadose Zone Soil | QDKVAAHAGHHVTVKGTVDGETLKLSSIDMVPAAK* |
| Ga0099830_111086282 | 3300009088 | Vadose Zone Soil | AIDDQEKVSAHAGHHVTVKGSVEGDNLKLTSIDMAPAKGK* |
| Ga0066709_1011641941 | 3300009137 | Grasslands Soil | TIKCVTAGATYVFANDGDKKIFAINDQAKVAEHAVDHVTVKGAVEGDTLKLSSIEMAAKSK* |
| Ga0126374_107977921 | 3300009792 | Tropical Forest Soil | KIYAIDDQDKVAAHAGHHVTVKGTASGDAIKLASIEMAADKGM* |
| Ga0126380_111126191 | 3300010043 | Tropical Forest Soil | QDKVAAHAGHHVTVKGSVDGDSLKLTSIDMAAAASK* |
| Ga0126384_116908692 | 3300010046 | Tropical Forest Soil | DADKKVYAIDDQDKVAAHAGHHVTVKGTASGDSIKLASVDMAPEKGM* |
| Ga0126373_102369713 | 3300010048 | Tropical Forest Soil | VYVVDAQDKVAEHAGHHVTVKGTVEGETLKLSSIEMAAK* |
| Ga0134064_100144434 | 3300010325 | Grasslands Soil | VDAQDKVAAHAGHHVTVKGSVEGDTLKLTSIDMAAAATK* |
| Ga0126372_120755442 | 3300010360 | Tropical Forest Soil | VYAIDAQDKVAAHAGHHVTVKGSVDGDSLKLTSIDMAK* |
| Ga0126372_127392852 | 3300010360 | Tropical Forest Soil | IDAQDKVAAHAGHHVTVKGSVDGDSLKLTSIDMAK* |
| Ga0126372_131029821 | 3300010360 | Tropical Forest Soil | AIDDQDKVAAHAGHHVTVKGTASGDSIKLASIDMAPEKSM* |
| Ga0126378_102475801 | 3300010361 | Tropical Forest Soil | GSYVFVNDANHQVYNITDQDKVAAHAGHHVTVKGNLDGDKLTVASLEMAK* |
| Ga0126378_103318801 | 3300010361 | Tropical Forest Soil | DSDKKVYALDAQEKAAPHAGHHVTVKGSVDGNTLKLTSIEMAK* |
| Ga0126378_117489752 | 3300010361 | Tropical Forest Soil | AQDKVAEHAGHHVTVKGSVEGETLKLASIDMAAK* |
| Ga0126378_124869192 | 3300010361 | Tropical Forest Soil | YAIDAQDKVAAHAGHHVTVKGSVDGNKLKLSSIEMAK* |
| Ga0126378_126532061 | 3300010361 | Tropical Forest Soil | VVDAQDKVAEHAGHHVTVKGTVEGDTLKLTSIDMAGK* |
| Ga0126377_110386732 | 3300010362 | Tropical Forest Soil | DAQDKVAAHAGHHVTVKGSVDGDSLKLTSIDMAK* |
| Ga0126379_100660872 | 3300010366 | Tropical Forest Soil | ADHKVYNIEAQDKVAAHAGHHVTVKGSVDGDNLKLSGLEMAK* |
| Ga0134128_100595055 | 3300010373 | Terrestrial Soil | DKVAAHAGHHVTVTGTVEGDTLKLKSIEMAPAKSN* |
| Ga0126381_1033402232 | 3300010376 | Tropical Forest Soil | VFVNDADKKVYAIDDQDKVAAHAGHHVTVKGTASGDSIKLASVDMAPEKGM* |
| Ga0124850_10741582 | 3300010863 | Tropical Forest Soil | DADHKVYNIDAQDKVAAHAGHHVTVKGSVDGDNLKLSGLEMAK* |
| Ga0126361_106405775 | 3300010876 | Boreal Forest Soil | VDDADKKVYVVDAQDKVAAHAGHHVTVKGTVDGETLKLESIEMAASSGK* |
| Ga0150983_103752241 | 3300011120 | Forest Soil | DKKVYVVDAQDKVADHAGHHVTVKGTVDGDTLKLESIDMAPANGK* |
| Ga0137393_103063242 | 3300011271 | Vadose Zone Soil | VKEHGAKYVFVNDADKKVYVVDAQDKVAAHSGHHVTVKGSVDGENLKLSSIDMAPAKSM* |
| Ga0137389_117936091 | 3300012096 | Vadose Zone Soil | KVAAHAGHHVTVKGSVEGDTLTVASVEMAPAKGK* |
| Ga0137388_100863865 | 3300012189 | Vadose Zone Soil | EKVSAHAGHHVTVKGSVEGDNLKLTSIDMAPAKGK* |
| Ga0137388_109245991 | 3300012189 | Vadose Zone Soil | VFVNDADQKVYVVDAQDKVAPHSGHHVTVKGTVEGDTLKLSSIEMVPAKGM* |
| Ga0137382_106449851 | 3300012200 | Vadose Zone Soil | FVNDADKKVYVVDAQDKVAAHAGHHVTVKGSVDGETLKLDSIDMAPSTK* |
| Ga0137382_106481242 | 3300012200 | Vadose Zone Soil | FVNDADKKVYVVDAQDKVAAHAGHHVTVKGSVDGETLKLDTIDMAPSTK* |
| Ga0137363_116920922 | 3300012202 | Vadose Zone Soil | FVNDADKKVYAIADQDKVAAHPGHHVAVKGSVEGDTLSIASIDMAPAKSSK* |
| Ga0137399_111759261 | 3300012203 | Vadose Zone Soil | VVDAQDKVAAHAGHHVTVKGTVDGETLKLSSIDMAPAVK* |
| Ga0137399_111964712 | 3300012203 | Vadose Zone Soil | YAIDAQDQVAPHAGHHVTVKGNVEGDTIKLSAIEMAPEKGM* |
| Ga0137399_117045851 | 3300012203 | Vadose Zone Soil | VYAISDQDKVAAHAGHHVAVKGSVEGDTLTVASIDMAPSKSKQP* |
| Ga0137362_110201911 | 3300012205 | Vadose Zone Soil | VFVNDADKKVYVVDAQDKVAAHAGHHVTVKGTVEGETLKLASIDMAAAATK* |
| Ga0137362_112355642 | 3300012205 | Vadose Zone Soil | DAQDKVAAHAGHHVTVKGTVEGETLKLTSIDMAAAATK* |
| Ga0137381_100199591 | 3300012207 | Vadose Zone Soil | DAQDKVASHAGRHVTVKGSVDGETLKLDSIDMAPATK* |
| Ga0137381_111071551 | 3300012207 | Vadose Zone Soil | QDKVAAHAGHHVTVKGTVEGDTLKLESIEMAPAAK* |
| Ga0137378_110336842 | 3300012210 | Vadose Zone Soil | NDADKKIYVVDAQDKVAEHAGHHVTVKGTVEGETLKLTSIEMAAK* |
| Ga0137377_105530991 | 3300012211 | Vadose Zone Soil | DADKKVYVVDAQDKVAAHAGHHVTVKGTVDGETLKLSSIDMAPAVK* |
| Ga0150985_1004606111 | 3300012212 | Avena Fatua Rhizosphere | DQSKVAEHAGHHVTLKGSIDGDTLKVASIEMAAKKK* |
| Ga0137387_103680231 | 3300012349 | Vadose Zone Soil | YTIDAQDKVAAHAGHHVTVKGTVEGDTLKLESIEMAPAAK* |
| Ga0137384_115494591 | 3300012357 | Vadose Zone Soil | AQDKVAAHAGHHVTVKGTVEGDTLKLTSIDMAASASK* |
| Ga0137360_108815372 | 3300012361 | Vadose Zone Soil | VIDAQDKVAAHAGHHVTVKGTVDGETLKLTSIDMAPAKGM* |
| Ga0137361_100833095 | 3300012362 | Vadose Zone Soil | ADKKVYVVDAQDKVAAHAGHHVTVKGSVEGEMLKLTSVDMAPAAK* |
| Ga0137361_103272321 | 3300012362 | Vadose Zone Soil | ADKKVYAVADQDKVAAHAGHHVTVKGSVEGDTLTVASVEMASAKGK* |
| Ga0137361_107079642 | 3300012362 | Vadose Zone Soil | VDAQDKVAAHAGHHVTVKGTVDGETLKLSSIDMVPAAK* |
| Ga0137390_102165301 | 3300012363 | Vadose Zone Soil | TVDAQEKVAPHAGHHVIVKGTVDGSALKLTSIEMAK* |
| Ga0137390_112802121 | 3300012363 | Vadose Zone Soil | KVYAIDAQDKVAAHAGHHVTVKGSVDGENLKLASLEMAK* |
| Ga0137390_112923192 | 3300012363 | Vadose Zone Soil | ADKKVYVVDAQDKVADHAGHHVKVTGTVDGDTLKLVSIDMAK* |
| Ga0137390_118415102 | 3300012363 | Vadose Zone Soil | YVFVNDADKKVYAIADQDKVAAHAGHHVAVKGSVEGDTLTIASIDMAPAKSSK* |
| Ga0137397_106072342 | 3300012685 | Vadose Zone Soil | VNDADKKVYVIDAQDKVAAHAGHHVTVKGSVDGENLKLTSIDMAAAKTM* |
| Ga0137395_100009271 | 3300012917 | Vadose Zone Soil | VDAQDKVAAHAGHHVTVKGTVDGETLKLTSIDMAAAATK* |
| Ga0137395_104498322 | 3300012917 | Vadose Zone Soil | DAQDQVAPHAGHHVTVKGNVEGDTIKLSAIEMAPEKGM* |
| Ga0137395_111215911 | 3300012917 | Vadose Zone Soil | NDADKKVYVVDAQDKVAAHAGHHVTVKGTVDGETLKLSSIDMAPAIK* |
| Ga0137396_102982911 | 3300012918 | Vadose Zone Soil | KVAAHAGHHVTVKGTVDGETLKLTSIDMVPAKGM* |
| Ga0137396_103226542 | 3300012918 | Vadose Zone Soil | YVVDAQDKVAAHAGHHVTVKGTVDGETLKLSSIDMAPAVK* |
| Ga0137394_106741881 | 3300012922 | Vadose Zone Soil | KVYAISDQDKVAAHAGHHVAVKGSVEGDTLTVASIDMAPSKSKQP* |
| Ga0137359_112357992 | 3300012923 | Vadose Zone Soil | DKVAAHAGHHVTVKGTVEGDTLKMESIEMAPAAK* |
| Ga0137413_104667051 | 3300012924 | Vadose Zone Soil | NDADKKVYVVDAQDKVAAHAGHHVTVKGTVEGETLKLTSIDMAAAATK* |
| Ga0137419_103874602 | 3300012925 | Vadose Zone Soil | DKVAAHAGHHVSVKGSVEGDTLTVASIDMAPSKSKQP* |
| Ga0137419_116402751 | 3300012925 | Vadose Zone Soil | KVYVIDAQDKVAAHAGHHVTVKGSVDGENLKLASLEMAK* |
| Ga0137416_110846591 | 3300012927 | Vadose Zone Soil | KVAAHAGHHVTVKGAVDGDTLKLTSIDMAAAATK* |
| Ga0137416_116943501 | 3300012927 | Vadose Zone Soil | SDQDKVAAHAGHHVAVKGSVEGDTLTVASIDMAPSKSKQP* |
| Ga0137404_111799142 | 3300012929 | Vadose Zone Soil | NDGDKKVYTVDAQDKVAPHAGHHVVVKGSVDGSALKLTSIEMAK* |
| Ga0137404_115996311 | 3300012929 | Vadose Zone Soil | VDAQDKVAAHAGHHVTVKGSVDGETLKLSSIDMAPAKGM* |
| Ga0137404_116767681 | 3300012929 | Vadose Zone Soil | AQDKVAAHAGHHVTVKGSVEGETLKLTSIDMAPAAK* |
| Ga0137410_103947131 | 3300012944 | Vadose Zone Soil | AQDKVAAHAGHHVTVKGSVDGETLKLTSIDMAPAKGM* |
| Ga0164302_114445851 | 3300012961 | Soil | DKKVYAINDQNKVAEHAGHHVTVRGTVNGDTLALTSIEIAAKSK* |
| Ga0126369_110182442 | 3300012971 | Tropical Forest Soil | NDADKKVYVVDAQDKVAEHAGHHVIVKGTVDGESLKLTSIKMAAKAE* |
| Ga0163162_130590152 | 3300013306 | Switchgrass Rhizosphere | VFVNDADKKVYTIDDQDKVAAHAGHHVTVKGSASGDSIKLASIDMAPEKGT* |
| Ga0134078_100324111 | 3300014157 | Grasslands Soil | ADKKVYVVDAQDKVAAHAGHHVTVKGTVEGETLKLTSIDMAAAATK* |
| Ga0134078_101525501 | 3300014157 | Grasslands Soil | KKVYVVDAQDKVADHAGHHVTVKGTVEGDTLKLASIDMAGK* |
| Ga0134079_104076591 | 3300014166 | Grasslands Soil | VYVVDAQDKVADHAGHHVTVKGTVEGDTLKLASIDMAGK* |
| Ga0137405_10790401 | 3300015053 | Vadose Zone Soil | AIDAQDKVAAHAGHHVTVKGSVDGDTIKLASIDMAAAK* |
| Ga0137405_11543731 | 3300015053 | Vadose Zone Soil | VFVNDADKKVYVVDAQDKVAAHAGHHVTVKGSVEGETLKLTSIDMAPAAK* |
| Ga0137405_11922672 | 3300015053 | Vadose Zone Soil | IDAQDKVAAHAGHHVTVKGSVDGDTIKLASIDMAAAK* |
| Ga0137405_13483063 | 3300015053 | Vadose Zone Soil | MPTKKIYVVDAQDKVAAHAGHHVTVKGTVDGETLKLTGIDMAAAATK* |
| Ga0137420_12853191 | 3300015054 | Vadose Zone Soil | FVNDADKKVYVVDAQDDKVAAHAGHHVTVKGTVEGETLKLTSIDMAAAATK* |
| Ga0137420_13054112 | 3300015054 | Vadose Zone Soil | NDADKKVYVVDAQDKVAAHAGHHVTVKGTVDGDTLKLSSVDMAPAAAK* |
| Ga0167668_10145121 | 3300015193 | Glacier Forefield Soil | KVYAIDAQDKVAAHAGHHVTVKGSVEGDTLKLSGIDMAPAAK* |
| Ga0134072_103209571 | 3300015357 | Grasslands Soil | AQDKVAAHAGHHVTVKGTVDGETLKLSSIDMAPAIK* |
| Ga0132257_1002435531 | 3300015373 | Arabidopsis Rhizosphere | KKVYAIDDQDKVAAHAGHHVTVKGTASGDSIKLASIDMAPEKGM* |
| Ga0182033_119560362 | 3300016319 | Soil | YVVDAQDKVAEHAGHHVTVKGSVDGDSLKLASISMAK |
| Ga0182035_107450952 | 3300016341 | Soil | DADKKVYAIDDQDKVAAHAGHHVTVKGTANGDSIKLSSISMAAEKGM |
| Ga0182035_116647482 | 3300016341 | Soil | EKVAPHAGHHVVVKGTVEGDTLKLDSIDMASKKSS |
| Ga0182035_117424603 | 3300016341 | Soil | VNDTDKKVYAIADQDKVAAHAGHHVTVKGSVTGDSMTVASVDMAK |
| Ga0182034_111938132 | 3300016371 | Soil | KVYAVDAQDKVAEHAGHHVTVKGSVDGDNLKLASISMAK |
| Ga0182040_102563834 | 3300016387 | Soil | YNITDQDKVAAHAGHHVTVKGSLDGDKLTVASLEMAK |
| Ga0182040_109508442 | 3300016387 | Soil | YNIDAQDKVAAHAGHHVTVKGSVDGDNLKLASIEMSK |
| Ga0182040_115969242 | 3300016387 | Soil | DKKVYAIDDQDKVAAHAGHHVTVKGTANGDSIKLSSISMAAEKGM |
| Ga0182037_111877901 | 3300016404 | Soil | ADHKVYAIDAQDKVAAHAGHHVTVTGSVEGDNLKLAGIDMAK |
| Ga0182037_117454291 | 3300016404 | Soil | DHKVYNIDAQDKVAAHAGHHVTVKGSVDGDNLKLTGLDMAK |
| Ga0134074_11192772 | 3300017657 | Grasslands Soil | DKKVYVIDAQDQVAAHAGHHVTVKGTIEGDSLKLSGIEMAAK |
| Ga0134083_101100051 | 3300017659 | Grasslands Soil | QDKVAAHAGHHVTVKGSAEGDTIKLSAVEMAPEPSK |
| Ga0187802_100195604 | 3300017822 | Freshwater Sediment | VNDADKKVYAVDAQDKVAEHAGQHVTVKGSVDGDTLKLASISMAK |
| Ga0187849_11748032 | 3300017929 | Peatland | DKKVYAIDAQDKVAAHAGHHVTVKGSVEGDNLKLTSIEMAK |
| Ga0187854_100134098 | 3300017938 | Peatland | VNDADKKVYAIDAQDKVAAHAGHHVTVKGSVEGDNLKLTSIEMAK |
| Ga0187817_110417041 | 3300017955 | Freshwater Sediment | KVYVVDAQDKVAEHAGHHVTVKGTVNGDTLKLERIEMAAATGK |
| Ga0187778_105642702 | 3300017961 | Tropical Peatland | FVNDADKKVYAIDDQDKVAAHAGHHVTVKGSVEGDTLKLKSIDMASGK |
| Ga0187780_100012797 | 3300017973 | Tropical Peatland | VVDAQDKVAAHAGHHVTVKGTVDGDTLKLTSIDMAK |
| Ga0187777_103212061 | 3300017974 | Tropical Peatland | TDHKVYAIDAQDKAAEHAGHHVTVTGSLSGDNLKLSGIAMAK |
| Ga0187815_103543292 | 3300018001 | Freshwater Sediment | VYAIDAQDKVAAHAGHHVTVKGTVDGDTLKLASIEMAK |
| Ga0187866_10456891 | 3300018015 | Peatland | AIDAQDKVAAHAGHHVTVKGSVEGDNLKLTSIEMAK |
| Ga0187784_109445132 | 3300018062 | Tropical Peatland | VYAIDAQDKVAAHAGHHVIVKGTVDGDNLKLTSIEMAK |
| Ga0187773_103526852 | 3300018064 | Tropical Peatland | VYAIDAQDKVAAHAGHHVTVKGSVEGDNLKLASIDMAK |
| Ga0187772_111372602 | 3300018085 | Tropical Peatland | ADHKVYAVDAQDKVAAHAGHHVTVKGAVDGDHLKLASIEMAK |
| Ga0187769_114942342 | 3300018086 | Tropical Peatland | AIDAQDKVADHAGHHVTVKGTVEGDTLKLTSIAMAK |
| Ga0187771_116716242 | 3300018088 | Tropical Peatland | FVNDTDKKVYAIDAQDKVAAHAGHHVIVKGTVDGDNLKLTSIEMAK |
| Ga0066667_103417551 | 3300018433 | Grasslands Soil | CCRTKCAKEHGTKDVFVKDADKKVYVVDPQEQVAVQAGDHLTAKGTVDGETLKLSSIDMAPSVK |
| Ga0066669_106899001 | 3300018482 | Grasslands Soil | KVYAIDDQDKVAAHAGHHVTVKGKVEGDTLKLSSIEMASDKSL |
| Ga0137408_11422791 | 3300019789 | Vadose Zone Soil | FVNDADKKVYAIDAQAQDKVAAHAGHHVTVKGSVDGDTIKLASIDMAAAK |
| Ga0179592_101820892 | 3300020199 | Vadose Zone Soil | VFVNDADKKVYVVDAQDKVAAHAGHHVTVKGTVEGETLKLTSIDMAAAKTM |
| Ga0210407_108183772 | 3300020579 | Soil | AIDAQDKVAAHAGHHVTVKGSVDGENLKLASLEMAK |
| Ga0210407_108745871 | 3300020579 | Soil | VDAQDKVAAHAGHHVTVKGTVDGETLKLESIEMAATSGK |
| Ga0210407_111621742 | 3300020579 | Soil | DADKKVYVVDAQDKVAAHAGHHVTVKGTVDGETLKLETIEMAAPSGK |
| Ga0210403_100442074 | 3300020580 | Soil | NDADHKVYAIDAQDKVAAHAGHHVTVKGSVDGDNLKLASLEMAK |
| Ga0210399_108164702 | 3300020581 | Soil | AQDKVADHAGHHVTVKGTVDGDTLKLESIDMAPANGK |
| Ga0210401_100105331 | 3300020583 | Soil | DAQDKVAAHAGHHVTVKGSVDGDTLKLTSIDMAAAKSM |
| Ga0210401_102727531 | 3300020583 | Soil | KYVFVNEGDKKVYTVDAQDKVAPHAGHHVVVKGTVDGSALKLTSIEMAK |
| Ga0210401_106824252 | 3300020583 | Soil | YVIDAQDKVAAHAGHHVTVKGTVEGENLKLTSIDMAAAKSM |
| Ga0210401_107537181 | 3300020583 | Soil | AIDDQDKVAEHAGHHVTVKGTVDGDTLKLSSVDMAPAKNI |
| Ga0210404_101182891 | 3300021088 | Soil | KVYVVDAQDKVADHAGHHVTVKGTVDGDTLKLESIDMAPANGK |
| Ga0210404_103312972 | 3300021088 | Soil | IDAQDKVAAHAGHHVTVKGTVDGENLKLTSIDMAPAKSM |
| Ga0210406_101763121 | 3300021168 | Soil | YVFVNESDKKVYTVDAQDKVAPHAGHHVVVKGTVDGSALKLTSIEMAK |
| Ga0210406_112750611 | 3300021168 | Soil | VFVNDADKKVYAIADQDKVAAHAGHHVTVKGSVTGDSMTVASVDMAK |
| Ga0210400_112564611 | 3300021170 | Soil | KVYAIDAQDKVAAHAGHHVTVKGSVDGDNLKLASLEMVK |
| Ga0210405_112129492 | 3300021171 | Soil | AIADQDKVAAHAGHHVTVKGSVEGDTLTVASIDMAPAKSK |
| Ga0210405_112516651 | 3300021171 | Soil | VFVNDADKKVYLVDAQDKVAEHAGHHVTVKGTVDGGTLKLESIDMAPPDSK |
| Ga0210408_103806802 | 3300021178 | Soil | AQDKVAAHAGHHVTVKGTVDGETLKLTSIDMAAAKSM |
| Ga0210396_112544062 | 3300021180 | Soil | DKVAAHAGHHLTVKGTVDGDTLKLDSIEMAAATGK |
| Ga0210388_113318022 | 3300021181 | Soil | GAKYVFVHDADKKVYVVDAQDKVADHAGHHVIVKGTVDGGTLKLESIDMAPANGK |
| Ga0210394_115550182 | 3300021420 | Soil | VNDADHKVYVIDAQDKVAAHAGHHVTVKGSVDGENLKLASLEMAK |
| Ga0210384_1001497510 | 3300021432 | Soil | KKVYVVDAQDKVAAHAGHHVTVKGSVDGDTLKLTSIDMAAAKSM |
| Ga0210384_104434992 | 3300021432 | Soil | VVDAQDKVAAHAGHHVTVKGTVDGETLKLTSIDMAAATK |
| Ga0210391_110731172 | 3300021433 | Soil | KYVFVKDADKKVYVVDAQDKVADHAGHHVTVKGTVDGDTLKLESIDMAPANGK |
| Ga0210402_116375682 | 3300021478 | Soil | VYVVDAQDKVAGHAGHHVTVKGSVDGDTLKLSSIDMAAAKTM |
| Ga0210402_119393281 | 3300021478 | Soil | DKKVYTVDAQDKVSPHAGHHVVVKGTVDGSALKLTSIEMAK |
| Ga0210410_105527621 | 3300021479 | Soil | NDSDKKVYTVDAQDKVAPHAGHHVVVKGIVDGGALKLTSIEMAK |
| Ga0126371_109684813 | 3300021560 | Tropical Forest Soil | DANHQVYNITDQDKVAAHAGHHVTVKGSLDGDKLTVASLEMAK |
| Ga0126371_135364521 | 3300021560 | Tropical Forest Soil | DADKKIYAIDDQDKVAAHAGHHVTVKGTASGDSIKLASIEMAADKGM |
| Ga0224544_10432782 | 3300023250 | Soil | DKVAENAGHHVTVKGTIDGDTLKLSSIDMAPAKGN |
| Ga0179589_104354771 | 3300024288 | Vadose Zone Soil | YAIDAQDQVAPHAGHHVTVKGNVEGDTIKLSAIEMAPEKGM |
| Ga0137417_10619312 | 3300024330 | Vadose Zone Soil | DKVAAHAGHHVTVKGTVDGDTLKLSSVDMAPAAAK |
| Ga0137417_13169151 | 3300024330 | Vadose Zone Soil | APHAAQDKVAPHAGHHVVVKGTVDGSTLKLTSIEMAK |
| Ga0208037_10379612 | 3300025448 | Peatland | FVNDADKKVYAIDDQDKVAAHAGHHVTVKGSVEGDNLKLTSIEMAK |
| Ga0207684_100237506 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | QDKVAAHAGHHVTVTGTVEGDTLKLKSIEMAPAKSN |
| Ga0207663_101707381 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | QDKVAAHAGHHVTVKGSVDGDTLKLSSIDMAAEKGM |
| Ga0207665_101146554 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | KVYAIDAQDQVAAHAGHHVTVKGDVKGDAIKLSAIEMAPEKGM |
| Ga0209238_12346912 | 3300026301 | Grasslands Soil | DKKVYVVDAQDKVAAHAGHHVTVKGTVDGETLKLSSIDMAPAIK |
| Ga0209240_12126492 | 3300026304 | Grasslands Soil | DKVAAHAGHHVTVKGTVDGETLKLTSIDMAAAAPAAK |
| Ga0209761_10603581 | 3300026313 | Grasslands Soil | ADKKVYVVDAQDKVAAHAGHHVTVKGSVEGDTLKLTSIDMAAAATK |
| Ga0209155_10008841 | 3300026316 | Soil | DKKVYVVDAQDKVAAHAGHHVTVKGTVEGETLKLTSIDMAAAATK |
| Ga0209131_10680291 | 3300026320 | Grasslands Soil | YVVDAQDKVAAHAGHHVTVKGTVEGETLKLTSIDMGAAATK |
| Ga0257178_10352701 | 3300026446 | Soil | AIDAQDQVAPHAGHHVTVKGNVEGDTIKLSAIEMAPEKGM |
| Ga0209808_11298302 | 3300026523 | Soil | VYVVDAQDKVAAHAGHHVTVKGTVEGETLKLTSIDMAAAATK |
| Ga0209161_100597375 | 3300026548 | Soil | YVFVNDADKKVYVVDAQDKVAAHAGHHVAVKGTVDGETLKLDSIDMAPATK |
| Ga0179587_108584772 | 3300026557 | Vadose Zone Soil | VYVVDAQDKVAAHAGHHVTVKGTVDGDTLKLSSVDMAPAAAK |
| Ga0179587_109404892 | 3300026557 | Vadose Zone Soil | KVAAHAGHHVAVKGSVEGDTLTVASIDMAPSKSKQP |
| Ga0207506_10047391 | 3300027460 | Soil | VNDADKKVYVVDAQDKVAEHAGHHVTVKGSVDGDNLKLASISMAK |
| Ga0209076_10016231 | 3300027643 | Vadose Zone Soil | VYVVDAQDKVAAHAGHHVTVKGTVDGETLKLSSIDMAPAVK |
| Ga0209736_10855392 | 3300027660 | Forest Soil | VFVNDADKKVYVVDAQDKVAAHAGHHVIVKGTVDGETLKLSSIDMAPAVK |
| Ga0209588_11024602 | 3300027671 | Vadose Zone Soil | DKKVYVIDAQDKVAAHAGHHVTVKGTVDGETLKLTSIDMAPAKGM |
| Ga0207826_11398822 | 3300027680 | Tropical Forest Soil | ADKKVYAIDAQDKVAAHAGHHVTVTGTVTGDSLKLDTVSMAK |
| Ga0209689_12182882 | 3300027748 | Soil | QDKAAAHAGHHVTVKGTVDGDTIKVSSIEMAKEKSEKPKS |
| Ga0209448_101937882 | 3300027783 | Bog Forest Soil | KKVYVVDAQDKVADHAGHHVIVKGTVDGGTLKLESIDMAPANGK |
| Ga0209773_100432331 | 3300027829 | Bog Forest Soil | YVFVNDADKKVYVVDAQDKVADHAGHHVIVKGTVDGGTLELESIDMAPASGK |
| Ga0209180_104585301 | 3300027846 | Vadose Zone Soil | KKIYAIDDQEKVSAHAGHHVTVKGSVEGDNLKLTSIDMAPAKGK |
| Ga0209701_100082698 | 3300027862 | Vadose Zone Soil | KEHGAKYVFVNDADKKVYVVDAQDKVAAHSGHHVTVKGTVDGETLKLTSIDMAPAKSM |
| Ga0209701_104155991 | 3300027862 | Vadose Zone Soil | KEHGAKYVFVNDADKKVYVVDAQDKVAAHSGHHVTVKGSVDGENLKLSSIDMAPAKSM |
| Ga0209283_109871422 | 3300027875 | Vadose Zone Soil | DKVAAHAGHHVSVKGSVEGDTLTVASIDMAPAKSK |
| Ga0209590_104961362 | 3300027882 | Vadose Zone Soil | TIDDQEKVSAHAGHHVTVKGSVEGDNLKLTSIDMAPAKGK |
| Ga0209068_107009392 | 3300027894 | Watersheds | VFVNDADKKVYVIDAQDKVAAHAGHHVTVKGTVDGENLKLTSIDMAAAKTM |
| Ga0209068_108208981 | 3300027894 | Watersheds | DKVAAHAGHHVTVKGTVDGENLKLSSIDMAAPAKTM |
| Ga0209488_107044321 | 3300027903 | Vadose Zone Soil | DAQDKVAAHSGHHVTVKGSVDGETLKLTSIDMAPAAK |
| Ga0209698_106349142 | 3300027911 | Watersheds | VYVVDAQEKAAPHAGHHVVVTGTVDGGNLKLTSIEMAK |
| Ga0209069_102357532 | 3300027915 | Watersheds | VDAQDKVAAHAGHHVTVTGSVDGENLKLTSIEMAK |
| Ga0209526_108091632 | 3300028047 | Forest Soil | DADKKVYTIDDQDKVAEHAGHHVTVTGSIDGDTLKLSAIDMAPAKSK |
| Ga0265334_102338041 | 3300028573 | Rhizosphere | VNDADKKVYAIDDQDKVAAHAGHHVTVTGSVSGDSLKLTSLSMAK |
| Ga0257175_10943222 | 3300028673 | Soil | QDQVAPHAGHHVTVKGNVEGDTIKLSAIEMAPEKGM |
| Ga0222749_100869272 | 3300029636 | Soil | VFVNDADKKVYMIDDQDKVAAHAGHHVTVKGSVDGDNLKLKSIDMAKAM |
| Ga0073994_123642471 | 3300030991 | Soil | IDAQDKVAAHAGHHVTVKGTVDGDTLKLSSVDMAPAAAK |
| Ga0170822_108868131 | 3300031122 | Forest Soil | RFYAIDAQDQVAAHAGHHVTVKGNVEGDSIKLSAIEMTPEKGV |
| Ga0170823_144541992 | 3300031128 | Forest Soil | DQVAAHAGHHVTVKGDLKGDAIKLSAIEMAPEKGM |
| Ga0310915_104820482 | 3300031573 | Soil | KVYNIDAQDKVAAHAGHHVTVKGSVDGDNLKLASIEMAK |
| Ga0318555_100955573 | 3300031640 | Soil | VYVVDAQDKVAAHAGHHVTVKGTVEGETLKLTSIDMAGK |
| Ga0307469_102123253 | 3300031720 | Hardwood Forest Soil | DKVAAHAGHHVTVKGSVEGDNMKVASVDMAPAKGK |
| Ga0307469_102438911 | 3300031720 | Hardwood Forest Soil | KVYAIADQDKVAAHAGDHVTVKGSVEGDTLTVASIDMAPAKSK |
| Ga0306918_109313531 | 3300031744 | Soil | AIDDQDKVAAHAGHHVVVKGTANGDSIKLTSVSMAAEKSM |
| Ga0307477_100030071 | 3300031753 | Hardwood Forest Soil | PDKVAAHAGHHVSVKGSVEGDTLTVASIDMAPAKTSK |
| Ga0307477_104257711 | 3300031753 | Hardwood Forest Soil | NDADKKVYVVDAQDKVAAHAGHHVTVKGTVEGETLKLTSIDMAAAATK |
| Ga0318546_100316101 | 3300031771 | Soil | KVYNIDAQDKVAAHAGHHVTVKGSVDGDNLKLASIEMSK |
| Ga0318546_100928251 | 3300031771 | Soil | IYAIDDQDKVAAHAGHHVTVKGAASGDSIKLASIEMAADKGM |
| Ga0307473_103351472 | 3300031820 | Hardwood Forest Soil | DKKIYAIDAQDKVAAHAGHHVTVKGSAEGDTIKLSAVEMAPEPSK |
| Ga0306919_107850092 | 3300031879 | Soil | YNIDAQEKVAAHAGHHVTVKGSVDGDSLKLASIEMAK |
| Ga0318536_102281111 | 3300031893 | Soil | VYNIDAQDKVAAHAGHHVTVKGSVDGDNLKLASIEMSK |
| Ga0306921_106020961 | 3300031912 | Soil | AKYVFVNEADKKVFAVGAQDKVAPHAGHHVVVKGTLDGNTLKLTSVEMAK |
| Ga0310916_103265951 | 3300031942 | Soil | VFVNDANHQVYNITDQDKVAAHAGHHVTVKGSLDGDKLTVASLEMAK |
| Ga0310910_104175231 | 3300031946 | Soil | HQVYNITDQDKVAAHAGHHVTVKGSLDGDKLTVASLEMAK |
| Ga0307479_101997724 | 3300031962 | Hardwood Forest Soil | DADKKVYVVDAQDKVAAHAGHHVTVKGTVEGETLKLTSIDMAAKTM |
| Ga0307479_103973561 | 3300031962 | Hardwood Forest Soil | DAQDKVAEHAGHHVTVKGTVEGDTLKLTSIDMAGK |
| Ga0306922_101197241 | 3300032001 | Soil | VDAQEKAAPHAGHHVTVKGSVDGNTLKLTSIEMAK |
| Ga0318506_100536183 | 3300032052 | Soil | VVDAQDKVAAHAGHHVTVKGTVEGETLKLTSIDMAGK |
| Ga0307470_102047441 | 3300032174 | Hardwood Forest Soil | DHKVYAIDAQDKVAAHAGHHVTVKGSVDGENLKLASLEMAK |
| Ga0307471_1016364491 | 3300032180 | Hardwood Forest Soil | KYVFVNDGDKKVYTIDAQDKVAPHAGHHVVVKGIVDGSALKLTSIEMVK |
| Ga0307472_1005484912 | 3300032205 | Hardwood Forest Soil | GADKKVYVVDAQDKVAEHAGHHVTVKGSIDGDNLKLASIAMAK |
| Ga0306920_1001000116 | 3300032261 | Soil | KVYNIDAQDKVAAHAGHHVTVKGSVDGDNLKVASIEMAK |
| Ga0335079_108870001 | 3300032783 | Soil | DKKVYAISDQDKVAAHAGHHVTVKGSVDGDTMTVAAVDMAK |
| Ga0335081_117693761 | 3300032892 | Soil | VHDGDKKVYAIDAQDKVAEHAGHHVTVKGTIDGETLKLQSIEMAAANAK |
| Ga0318519_109695712 | 3300033290 | Soil | VYNIDAQDKVAAHAGHHVTVKGSVDGDSLKLASIEMAK |
| Ga0326726_110489382 | 3300033433 | Peat Soil | KVFAIDDQDKVASHAGHHVTVKGSVDGDNLKLTSIEMAK |
| Ga0334817_049436_3_137 | 3300033820 | Soil | NDADKKVYAIDAQDKVAAHAGHHVTVKGTVDGDNLTLTSIEMAK |
| Ga0326724_0283175_2_115 | 3300034091 | Peat Soil | YTIDAQDKVAAHAGHHVTVKGTVEGDNLKLTSIEMAK |
| ⦗Top⦘ |