| Basic Information | |
|---|---|
| Family ID | F014718 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 260 |
| Average Sequence Length | 43 residues |
| Representative Sequence | VKENKGYRVVSVMPALKDGHPVADVTLVKGTEWKTVSEKLD |
| Number of Associated Samples | 162 |
| Number of Associated Scaffolds | 260 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 4.67 % |
| % of genes near scaffold ends (potentially truncated) | 93.85 % |
| % of genes from short scaffolds (< 2000 bps) | 91.15 % |
| Associated GOLD sequencing projects | 147 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.67 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (90.385 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (24.231 % of family members) |
| Environment Ontology (ENVO) | Unclassified (35.385 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (58.462 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 40.58% Coil/Unstructured: 59.42% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.67 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 260 Family Scaffolds |
|---|---|---|
| PF07485 | DUF1529 | 11.92 |
| PF06439 | 3keto-disac_hyd | 10.00 |
| PF09828 | Chrome_Resist | 6.54 |
| PF00005 | ABC_tran | 3.85 |
| PF00578 | AhpC-TSA | 3.46 |
| PF13473 | Cupredoxin_1 | 3.08 |
| PF12773 | DZR | 2.69 |
| PF02518 | HATPase_c | 2.69 |
| PF02777 | Sod_Fe_C | 2.31 |
| PF02417 | Chromate_transp | 2.31 |
| PF13565 | HTH_32 | 1.54 |
| PF09990 | DUF2231 | 0.77 |
| PF00211 | Guanylate_cyc | 0.77 |
| PF01925 | TauE | 0.38 |
| PF13191 | AAA_16 | 0.38 |
| PF13379 | NMT1_2 | 0.38 |
| PF01451 | LMWPc | 0.38 |
| PF00486 | Trans_reg_C | 0.38 |
| PF03150 | CCP_MauG | 0.38 |
| PF00890 | FAD_binding_2 | 0.38 |
| PF05096 | Glu_cyclase_2 | 0.38 |
| PF07690 | MFS_1 | 0.38 |
| PF01865 | PhoU_div | 0.38 |
| COG ID | Name | Functional Category | % Frequency in 260 Family Scaffolds |
|---|---|---|---|
| COG0605 | Superoxide dismutase | Inorganic ion transport and metabolism [P] | 2.31 |
| COG2059 | Chromate transport protein ChrA | Inorganic ion transport and metabolism [P] | 2.31 |
| COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 0.77 |
| COG0730 | Sulfite exporter TauE/SafE/YfcA and related permeases, UPF0721 family | Inorganic ion transport and metabolism [P] | 0.38 |
| COG1392 | Phosphate transport regulator YkaA, distantly related to PhoU, UPF0111/DUF47 family | Inorganic ion transport and metabolism [P] | 0.38 |
| COG1858 | Cytochrome c peroxidase | Posttranslational modification, protein turnover, chaperones [O] | 0.38 |
| COG3823 | Glutamine cyclotransferase | Posttranslational modification, protein turnover, chaperones [O] | 0.38 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 90.38 % |
| Unclassified | root | N/A | 9.62 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2088090014|GPIPI_17050799 | All Organisms → cellular organisms → Bacteria | 1578 | Open in IMG/M |
| 3300000559|F14TC_101901044 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 773 | Open in IMG/M |
| 3300000787|JGI11643J11755_11124393 | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
| 3300000793|AF_2010_repII_A001DRAFT_10063768 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 805 | Open in IMG/M |
| 3300002558|JGI25385J37094_10085219 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 970 | Open in IMG/M |
| 3300002908|JGI25382J43887_10437366 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → unclassified Terrabacteria group → Terrabacteria group bacterium ANGP1 | 554 | Open in IMG/M |
| 3300003203|JGI25406J46586_10194350 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 592 | Open in IMG/M |
| 3300003659|JGI25404J52841_10072648 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 719 | Open in IMG/M |
| 3300004633|Ga0066395_10463901 | All Organisms → cellular organisms → Bacteria | 724 | Open in IMG/M |
| 3300005166|Ga0066674_10344898 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 699 | Open in IMG/M |
| 3300005174|Ga0066680_10637236 | All Organisms → cellular organisms → Bacteria | 663 | Open in IMG/M |
| 3300005174|Ga0066680_10901112 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 524 | Open in IMG/M |
| 3300005176|Ga0066679_10297478 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1049 | Open in IMG/M |
| 3300005178|Ga0066688_10037710 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2723 | Open in IMG/M |
| 3300005180|Ga0066685_10003807 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 7431 | Open in IMG/M |
| 3300005180|Ga0066685_10465378 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 877 | Open in IMG/M |
| 3300005181|Ga0066678_10743528 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
| 3300005187|Ga0066675_11331539 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 528 | Open in IMG/M |
| 3300005332|Ga0066388_102617978 | Not Available | 919 | Open in IMG/M |
| 3300005332|Ga0066388_108538633 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 510 | Open in IMG/M |
| 3300005444|Ga0070694_101238336 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017 | 626 | Open in IMG/M |
| 3300005444|Ga0070694_101712911 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
| 3300005446|Ga0066686_10261240 | All Organisms → cellular organisms → Bacteria | 1171 | Open in IMG/M |
| 3300005447|Ga0066689_10108560 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1602 | Open in IMG/M |
| 3300005447|Ga0066689_10319964 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 964 | Open in IMG/M |
| 3300005447|Ga0066689_10532053 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 743 | Open in IMG/M |
| 3300005450|Ga0066682_10355322 | All Organisms → cellular organisms → Bacteria | 943 | Open in IMG/M |
| 3300005450|Ga0066682_10445808 | All Organisms → cellular organisms → Bacteria | 823 | Open in IMG/M |
| 3300005450|Ga0066682_10924191 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 518 | Open in IMG/M |
| 3300005467|Ga0070706_100660963 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 970 | Open in IMG/M |
| 3300005468|Ga0070707_100138566 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2367 | Open in IMG/M |
| 3300005471|Ga0070698_100591005 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1050 | Open in IMG/M |
| 3300005471|Ga0070698_101504400 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 624 | Open in IMG/M |
| 3300005536|Ga0070697_100233431 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1569 | Open in IMG/M |
| 3300005540|Ga0066697_10273994 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 997 | Open in IMG/M |
| 3300005540|Ga0066697_10692008 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 558 | Open in IMG/M |
| 3300005552|Ga0066701_10239845 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1120 | Open in IMG/M |
| 3300005552|Ga0066701_10660048 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 631 | Open in IMG/M |
| 3300005555|Ga0066692_10851516 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017 | 559 | Open in IMG/M |
| 3300005557|Ga0066704_10843224 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium | 568 | Open in IMG/M |
| 3300005559|Ga0066700_10682248 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 707 | Open in IMG/M |
| 3300005569|Ga0066705_10431003 | All Organisms → cellular organisms → Bacteria | 826 | Open in IMG/M |
| 3300005574|Ga0066694_10305505 | All Organisms → cellular organisms → Bacteria | 757 | Open in IMG/M |
| 3300005598|Ga0066706_11276939 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 556 | Open in IMG/M |
| 3300005614|Ga0068856_101294608 | All Organisms → cellular organisms → Bacteria | 744 | Open in IMG/M |
| 3300005713|Ga0066905_100440540 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1068 | Open in IMG/M |
| 3300005764|Ga0066903_101057095 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1491 | Open in IMG/M |
| 3300005764|Ga0066903_107446933 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
| 3300006046|Ga0066652_100583783 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1051 | Open in IMG/M |
| 3300006046|Ga0066652_101539080 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 615 | Open in IMG/M |
| 3300006049|Ga0075417_10247937 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 853 | Open in IMG/M |
| 3300006794|Ga0066658_10796965 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 532 | Open in IMG/M |
| 3300006796|Ga0066665_10143167 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1806 | Open in IMG/M |
| 3300006796|Ga0066665_10202401 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1542 | Open in IMG/M |
| 3300006796|Ga0066665_11376624 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
| 3300006797|Ga0066659_10741537 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 806 | Open in IMG/M |
| 3300006797|Ga0066659_11579652 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017 | 551 | Open in IMG/M |
| 3300006844|Ga0075428_100601725 | All Organisms → cellular organisms → Bacteria | 1174 | Open in IMG/M |
| 3300006845|Ga0075421_100452763 | All Organisms → cellular organisms → Bacteria | 1533 | Open in IMG/M |
| 3300006845|Ga0075421_100870514 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1031 | Open in IMG/M |
| 3300006845|Ga0075421_101024236 | All Organisms → cellular organisms → Bacteria | 933 | Open in IMG/M |
| 3300006847|Ga0075431_101327845 | All Organisms → cellular organisms → Bacteria | 680 | Open in IMG/M |
| 3300006871|Ga0075434_100645128 | All Organisms → cellular organisms → Bacteria | 1077 | Open in IMG/M |
| 3300006954|Ga0079219_11815308 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 571 | Open in IMG/M |
| 3300007255|Ga0099791_10066680 | All Organisms → cellular organisms → Bacteria | 1627 | Open in IMG/M |
| 3300007258|Ga0099793_10358867 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 713 | Open in IMG/M |
| 3300009012|Ga0066710_101814933 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 920 | Open in IMG/M |
| 3300009012|Ga0066710_102545614 | All Organisms → cellular organisms → Bacteria | 738 | Open in IMG/M |
| 3300009012|Ga0066710_103553647 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 589 | Open in IMG/M |
| 3300009012|Ga0066710_103618061 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 582 | Open in IMG/M |
| 3300009012|Ga0066710_103765412 | Not Available | 569 | Open in IMG/M |
| 3300009012|Ga0066710_104215304 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
| 3300009012|Ga0066710_104368381 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
| 3300009012|Ga0066710_104454472 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
| 3300009012|Ga0066710_104795957 | Not Available | 506 | Open in IMG/M |
| 3300009088|Ga0099830_11041549 | All Organisms → cellular organisms → Bacteria | 678 | Open in IMG/M |
| 3300009088|Ga0099830_11141945 | All Organisms → cellular organisms → Bacteria | 646 | Open in IMG/M |
| 3300009088|Ga0099830_11828536 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| 3300009088|Ga0099830_11875026 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300009089|Ga0099828_10096788 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 2546 | Open in IMG/M |
| 3300009089|Ga0099828_11287916 | All Organisms → cellular organisms → Bacteria | 647 | Open in IMG/M |
| 3300009089|Ga0099828_11506411 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
| 3300009089|Ga0099828_11918109 | Not Available | 519 | Open in IMG/M |
| 3300009090|Ga0099827_10242623 | All Organisms → cellular organisms → Bacteria | 1512 | Open in IMG/M |
| 3300009090|Ga0099827_10776514 | All Organisms → cellular organisms → Bacteria | 829 | Open in IMG/M |
| 3300009090|Ga0099827_11021061 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 718 | Open in IMG/M |
| 3300009090|Ga0099827_11389622 | Not Available | 611 | Open in IMG/M |
| 3300009090|Ga0099827_11437095 | Not Available | 600 | Open in IMG/M |
| 3300009090|Ga0099827_11452927 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
| 3300009137|Ga0066709_102295840 | All Organisms → cellular organisms → Bacteria | 740 | Open in IMG/M |
| 3300009137|Ga0066709_102521747 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 692 | Open in IMG/M |
| 3300009137|Ga0066709_103726904 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
| 3300009143|Ga0099792_10070181 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1765 | Open in IMG/M |
| 3300009143|Ga0099792_10972205 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 566 | Open in IMG/M |
| 3300009147|Ga0114129_11502987 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 827 | Open in IMG/M |
| 3300009176|Ga0105242_12699965 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
| 3300010043|Ga0126380_12283649 | Not Available | 502 | Open in IMG/M |
| 3300010046|Ga0126384_10386504 | All Organisms → cellular organisms → Bacteria | 1177 | Open in IMG/M |
| 3300010046|Ga0126384_12073844 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 545 | Open in IMG/M |
| 3300010047|Ga0126382_11904195 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
| 3300010048|Ga0126373_12511219 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 574 | Open in IMG/M |
| 3300010304|Ga0134088_10055705 | Not Available | 1821 | Open in IMG/M |
| 3300010304|Ga0134088_10066376 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1671 | Open in IMG/M |
| 3300010329|Ga0134111_10545851 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 514 | Open in IMG/M |
| 3300010333|Ga0134080_10222709 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 824 | Open in IMG/M |
| 3300010335|Ga0134063_10673318 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 533 | Open in IMG/M |
| 3300010336|Ga0134071_10564843 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 592 | Open in IMG/M |
| 3300010358|Ga0126370_10045822 | All Organisms → cellular organisms → Bacteria | 2746 | Open in IMG/M |
| 3300010358|Ga0126370_10184979 | All Organisms → cellular organisms → Bacteria | 1558 | Open in IMG/M |
| 3300010358|Ga0126370_10352199 | All Organisms → cellular organisms → Bacteria | 1190 | Open in IMG/M |
| 3300010358|Ga0126370_11848682 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
| 3300010359|Ga0126376_10073963 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 2505 | Open in IMG/M |
| 3300010359|Ga0126376_10528289 | All Organisms → cellular organisms → Bacteria | 1099 | Open in IMG/M |
| 3300010360|Ga0126372_10082207 | All Organisms → cellular organisms → Bacteria | 2346 | Open in IMG/M |
| 3300010360|Ga0126372_10278537 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1455 | Open in IMG/M |
| 3300010360|Ga0126372_10613562 | All Organisms → cellular organisms → Bacteria | 1046 | Open in IMG/M |
| 3300010360|Ga0126372_10703764 | All Organisms → cellular organisms → Bacteria | 987 | Open in IMG/M |
| 3300010360|Ga0126372_10823577 | All Organisms → cellular organisms → Bacteria | 922 | Open in IMG/M |
| 3300010360|Ga0126372_11163408 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 794 | Open in IMG/M |
| 3300010360|Ga0126372_11886086 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 642 | Open in IMG/M |
| 3300010360|Ga0126372_11929310 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 636 | Open in IMG/M |
| 3300010360|Ga0126372_13017102 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 522 | Open in IMG/M |
| 3300010360|Ga0126372_13098076 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300010361|Ga0126378_11725431 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 712 | Open in IMG/M |
| 3300010361|Ga0126378_11891123 | Not Available | 679 | Open in IMG/M |
| 3300010361|Ga0126378_13140642 | Not Available | 526 | Open in IMG/M |
| 3300010362|Ga0126377_11333325 | All Organisms → cellular organisms → Bacteria | 790 | Open in IMG/M |
| 3300010362|Ga0126377_13113625 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
| 3300010366|Ga0126379_11077244 | Not Available | 909 | Open in IMG/M |
| 3300010366|Ga0126379_12740304 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
| 3300010376|Ga0126381_101516648 | All Organisms → cellular organisms → Bacteria | 969 | Open in IMG/M |
| 3300010376|Ga0126381_101940864 | All Organisms → cellular organisms → Bacteria | 849 | Open in IMG/M |
| 3300010376|Ga0126381_103216934 | All Organisms → cellular organisms → Bacteria | 645 | Open in IMG/M |
| 3300011269|Ga0137392_10098827 | All Organisms → cellular organisms → Bacteria | 2298 | Open in IMG/M |
| 3300011269|Ga0137392_11094255 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 654 | Open in IMG/M |
| 3300011271|Ga0137393_10474948 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1072 | Open in IMG/M |
| 3300012096|Ga0137389_10260805 | All Organisms → cellular organisms → Bacteria | 1459 | Open in IMG/M |
| 3300012096|Ga0137389_10700018 | Not Available | 871 | Open in IMG/M |
| 3300012096|Ga0137389_11823684 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| 3300012189|Ga0137388_11077107 | Not Available | 740 | Open in IMG/M |
| 3300012189|Ga0137388_11223268 | Not Available | 689 | Open in IMG/M |
| 3300012189|Ga0137388_11285843 | All Organisms → cellular organisms → Bacteria | 670 | Open in IMG/M |
| 3300012189|Ga0137388_11290525 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 669 | Open in IMG/M |
| 3300012198|Ga0137364_10260521 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1282 | Open in IMG/M |
| 3300012207|Ga0137381_11460286 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 576 | Open in IMG/M |
| 3300012211|Ga0137377_11894885 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 514 | Open in IMG/M |
| 3300012350|Ga0137372_10639304 | All Organisms → cellular organisms → Bacteria | 776 | Open in IMG/M |
| 3300012350|Ga0137372_11234140 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 502 | Open in IMG/M |
| 3300012355|Ga0137369_10169602 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1715 | Open in IMG/M |
| 3300012355|Ga0137369_10661335 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 721 | Open in IMG/M |
| 3300012356|Ga0137371_11033974 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 621 | Open in IMG/M |
| 3300012358|Ga0137368_10206005 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1394 | Open in IMG/M |
| 3300012358|Ga0137368_10811191 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobulbaceae → Desulfomarina → Desulfomarina profundi | 578 | Open in IMG/M |
| 3300012359|Ga0137385_11083384 | All Organisms → cellular organisms → Bacteria | 660 | Open in IMG/M |
| 3300012360|Ga0137375_10612814 | All Organisms → cellular organisms → Bacteria | 904 | Open in IMG/M |
| 3300012360|Ga0137375_10859837 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium CSP1-3 | 724 | Open in IMG/M |
| 3300012361|Ga0137360_10077768 | All Organisms → cellular organisms → Bacteria | 2478 | Open in IMG/M |
| 3300012361|Ga0137360_10079933 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2449 | Open in IMG/M |
| 3300012361|Ga0137360_11144948 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 672 | Open in IMG/M |
| 3300012361|Ga0137360_11365560 | Not Available | 611 | Open in IMG/M |
| 3300012361|Ga0137360_11630603 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 550 | Open in IMG/M |
| 3300012362|Ga0137361_10136371 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2178 | Open in IMG/M |
| 3300012362|Ga0137361_10511333 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1103 | Open in IMG/M |
| 3300012409|Ga0134045_1348199 | All Organisms → cellular organisms → Bacteria | 834 | Open in IMG/M |
| 3300012582|Ga0137358_11019550 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300012917|Ga0137395_10007593 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 5733 | Open in IMG/M |
| 3300012923|Ga0137359_10531383 | All Organisms → cellular organisms → Bacteria | 1036 | Open in IMG/M |
| 3300012925|Ga0137419_11783802 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 526 | Open in IMG/M |
| 3300012925|Ga0137419_11984731 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 500 | Open in IMG/M |
| 3300012930|Ga0137407_10330179 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1400 | Open in IMG/M |
| 3300012930|Ga0137407_11872382 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 572 | Open in IMG/M |
| 3300012948|Ga0126375_10803172 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 745 | Open in IMG/M |
| 3300012948|Ga0126375_11543872 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 569 | Open in IMG/M |
| 3300012948|Ga0126375_12002218 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300012971|Ga0126369_10334250 | All Organisms → cellular organisms → Bacteria | 1530 | Open in IMG/M |
| 3300012971|Ga0126369_11128839 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 873 | Open in IMG/M |
| 3300012971|Ga0126369_11166622 | All Organisms → cellular organisms → Bacteria | 860 | Open in IMG/M |
| 3300012971|Ga0126369_11786334 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 704 | Open in IMG/M |
| 3300012971|Ga0126369_11833734 | Not Available | 695 | Open in IMG/M |
| 3300012972|Ga0134077_10191295 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 831 | Open in IMG/M |
| 3300012975|Ga0134110_10567256 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 524 | Open in IMG/M |
| 3300012976|Ga0134076_10263435 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 738 | Open in IMG/M |
| 3300012976|Ga0134076_10476245 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| 3300012977|Ga0134087_10005419 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 4111 | Open in IMG/M |
| 3300012977|Ga0134087_10007588 | All Organisms → cellular organisms → Bacteria | 3616 | Open in IMG/M |
| 3300012977|Ga0134087_10497264 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
| 3300012986|Ga0164304_11525715 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
| 3300014150|Ga0134081_10048952 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1259 | Open in IMG/M |
| 3300014157|Ga0134078_10144934 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 929 | Open in IMG/M |
| 3300015200|Ga0173480_10973918 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 557 | Open in IMG/M |
| 3300015264|Ga0137403_10430557 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1196 | Open in IMG/M |
| 3300015358|Ga0134089_10223774 | Not Available | 762 | Open in IMG/M |
| 3300015372|Ga0132256_102744330 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
| 3300017656|Ga0134112_10210619 | All Organisms → cellular organisms → Bacteria | 762 | Open in IMG/M |
| 3300017657|Ga0134074_1364390 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 535 | Open in IMG/M |
| 3300017659|Ga0134083_10475231 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 556 | Open in IMG/M |
| 3300018028|Ga0184608_10222209 | All Organisms → cellular organisms → Bacteria | 829 | Open in IMG/M |
| 3300018075|Ga0184632_10216506 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 842 | Open in IMG/M |
| 3300018078|Ga0184612_10077853 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1730 | Open in IMG/M |
| 3300018081|Ga0184625_10272863 | All Organisms → cellular organisms → Bacteria | 885 | Open in IMG/M |
| 3300018431|Ga0066655_10687412 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 692 | Open in IMG/M |
| 3300018431|Ga0066655_10893167 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 607 | Open in IMG/M |
| 3300018431|Ga0066655_11238471 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300018431|Ga0066655_11290515 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
| 3300018433|Ga0066667_10213062 | All Organisms → cellular organisms → Bacteria | 1431 | Open in IMG/M |
| 3300018433|Ga0066667_10266191 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1310 | Open in IMG/M |
| 3300018468|Ga0066662_11041326 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 813 | Open in IMG/M |
| 3300018482|Ga0066669_10411557 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1149 | Open in IMG/M |
| 3300018482|Ga0066669_11051775 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 735 | Open in IMG/M |
| 3300020170|Ga0179594_10151094 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 859 | Open in IMG/M |
| 3300021073|Ga0210378_10046053 | All Organisms → cellular organisms → Bacteria | 1721 | Open in IMG/M |
| 3300021560|Ga0126371_13411405 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
| 3300025910|Ga0207684_10042312 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3861 | Open in IMG/M |
| 3300025922|Ga0207646_10059453 | All Organisms → cellular organisms → Bacteria | 3414 | Open in IMG/M |
| 3300025941|Ga0207711_11497222 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 618 | Open in IMG/M |
| 3300025960|Ga0207651_11006738 | All Organisms → cellular organisms → Bacteria | 745 | Open in IMG/M |
| 3300026295|Ga0209234_1039039 | All Organisms → cellular organisms → Bacteria | 1806 | Open in IMG/M |
| 3300026296|Ga0209235_1240589 | Not Available | 567 | Open in IMG/M |
| 3300026310|Ga0209239_1213853 | All Organisms → cellular organisms → Bacteria | 681 | Open in IMG/M |
| 3300026313|Ga0209761_1090158 | All Organisms → cellular organisms → Bacteria | 1561 | Open in IMG/M |
| 3300026327|Ga0209266_1150124 | All Organisms → cellular organisms → Bacteria | 944 | Open in IMG/M |
| 3300026328|Ga0209802_1321779 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 511 | Open in IMG/M |
| 3300026329|Ga0209375_1160777 | All Organisms → cellular organisms → Bacteria | 929 | Open in IMG/M |
| 3300026331|Ga0209267_1029624 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 2631 | Open in IMG/M |
| 3300026332|Ga0209803_1033745 | All Organisms → cellular organisms → Bacteria | 2392 | Open in IMG/M |
| 3300026334|Ga0209377_1246206 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
| 3300026343|Ga0209159_1239777 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
| 3300026355|Ga0257149_1006506 | All Organisms → cellular organisms → Bacteria | 1447 | Open in IMG/M |
| 3300026480|Ga0257177_1005215 | All Organisms → cellular organisms → Bacteria | 1567 | Open in IMG/M |
| 3300026497|Ga0257164_1012104 | All Organisms → cellular organisms → Bacteria | 1121 | Open in IMG/M |
| 3300026537|Ga0209157_1283624 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 616 | Open in IMG/M |
| 3300026538|Ga0209056_10084632 | All Organisms → cellular organisms → Bacteria | 2656 | Open in IMG/M |
| 3300026542|Ga0209805_1282115 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 634 | Open in IMG/M |
| 3300026547|Ga0209156_10169801 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1051 | Open in IMG/M |
| 3300027360|Ga0209969_1075856 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 536 | Open in IMG/M |
| 3300027646|Ga0209466_1061495 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 758 | Open in IMG/M |
| 3300027846|Ga0209180_10474628 | All Organisms → cellular organisms → Bacteria | 703 | Open in IMG/M |
| 3300027862|Ga0209701_10234327 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1080 | Open in IMG/M |
| 3300027873|Ga0209814_10203287 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 856 | Open in IMG/M |
| 3300027875|Ga0209283_10652723 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 662 | Open in IMG/M |
| 3300027882|Ga0209590_10686911 | Not Available | 655 | Open in IMG/M |
| 3300027903|Ga0209488_10077025 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2478 | Open in IMG/M |
| 3300028381|Ga0268264_10183514 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1902 | Open in IMG/M |
| 3300031547|Ga0310887_10162295 | All Organisms → cellular organisms → Bacteria | 1182 | Open in IMG/M |
| 3300031720|Ga0307469_11188414 | All Organisms → cellular organisms → Bacteria | 720 | Open in IMG/M |
| 3300031720|Ga0307469_11597515 | All Organisms → cellular organisms → Bacteria | 626 | Open in IMG/M |
| 3300031744|Ga0306918_10254709 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → unclassified Terrabacteria group → Terrabacteria group bacterium ANGP1 | 1341 | Open in IMG/M |
| 3300031779|Ga0318566_10180238 | Not Available | 1048 | Open in IMG/M |
| 3300031781|Ga0318547_10350020 | All Organisms → cellular organisms → Bacteria | 902 | Open in IMG/M |
| 3300031835|Ga0318517_10568808 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
| 3300032025|Ga0318507_10199919 | All Organisms → cellular organisms → Bacteria | 863 | Open in IMG/M |
| 3300032180|Ga0307471_100290057 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1717 | Open in IMG/M |
| 3300032180|Ga0307471_101306019 | All Organisms → cellular organisms → Bacteria | 888 | Open in IMG/M |
| 3300032180|Ga0307471_101862758 | All Organisms → cellular organisms → Bacteria | 752 | Open in IMG/M |
| 3300032180|Ga0307471_103461534 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
| 3300032180|Ga0307471_104297986 | Not Available | 503 | Open in IMG/M |
| 3300032261|Ga0306920_102745336 | Not Available | 672 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 24.23% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 18.08% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 15.77% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 10.38% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 7.69% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.46% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.46% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.69% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.69% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.69% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.92% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.77% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.77% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.77% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.38% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.38% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.38% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.38% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.38% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.38% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.38% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.38% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.38% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.38% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.38% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.38% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2088090014 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000559 | Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly | Environmental | Open in IMG/M |
| 3300000787 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000793 | Forest soil microbial communities from Amazon forest - 2010 replicate II A001 | Environmental | Open in IMG/M |
| 3300002558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002908 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
| 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Host-Associated | Open in IMG/M |
| 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Host-Associated | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
| 3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
| 3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012358 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012409 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_16_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
| 3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300014150 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300015200 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2) | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300017656 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015 | Environmental | Open in IMG/M |
| 3300017657 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015 | Environmental | Open in IMG/M |
| 3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
| 3300018054 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1 | Environmental | Open in IMG/M |
| 3300018075 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1 | Environmental | Open in IMG/M |
| 3300018078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coex | Environmental | Open in IMG/M |
| 3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redo | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026295 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026296 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026313 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026327 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 (SPAdes) | Environmental | Open in IMG/M |
| 3300026328 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes) | Environmental | Open in IMG/M |
| 3300026329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 (SPAdes) | Environmental | Open in IMG/M |
| 3300026331 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 (SPAdes) | Environmental | Open in IMG/M |
| 3300026332 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes) | Environmental | Open in IMG/M |
| 3300026334 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes) | Environmental | Open in IMG/M |
| 3300026343 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 (SPAdes) | Environmental | Open in IMG/M |
| 3300026355 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-02-A | Environmental | Open in IMG/M |
| 3300026480 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-07-B | Environmental | Open in IMG/M |
| 3300026497 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-08-B | Environmental | Open in IMG/M |
| 3300026537 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 (SPAdes) | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300026542 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes) | Environmental | Open in IMG/M |
| 3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
| 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027646 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300031547 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031835 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21 | Environmental | Open in IMG/M |
| 3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| GPIPI_02199170 | 2088090014 | Soil | VKENKGYRVVSVMPALKDGHPVADVTLVKGAEWKTVSEKLD |
| F14TC_1019010442 | 3300000559 | Soil | AVKENKGYRVVSVMPALKDGHPVADVTLVKGTDWKTVSEKLD* |
| JGI11643J11755_111243932 | 3300000787 | Soil | AVKENKGYRAVSVMPALKEGHPVADVTLVKGSEWKTVSEKLD* |
| AF_2010_repII_A001DRAFT_100637681 | 3300000793 | Forest Soil | QGYRAVSVTPSLKDGHPVAEVTLVKDAEFKTASEKLD* |
| JGI25385J37094_100852192 | 3300002558 | Grasslands Soil | MAKATRSLAAATETAVKANRGFRAVSVMPALKDGHPIADVTLVKGDEWTTVSEKLE* |
| JGI25382J43887_104373661 | 3300002908 | Grasslands Soil | KANKGYRAVSVIPTLKEGHPVADVTLVKGNEFKTVSDKLD* |
| JGI25406J46586_101943502 | 3300003203 | Tabebuia Heterophylla Rhizosphere | AASEAVKENKGYRVVSVFPTLKDGHPVADVTLVKGNEWKTVSEKLD* |
| JGI25404J52841_100726482 | 3300003659 | Tabebuia Heterophylla Rhizosphere | GYXAVSALPRLEEGHPVAAVTLLKGSDWKTVSERLDSAQ* |
| Ga0066395_104639012 | 3300004633 | Tropical Forest Soil | KENKGYRVVSVTPELKDGHPVADVTLVKDTDWKTVSEKLD* |
| Ga0066674_103448983 | 3300005166 | Soil | AVDAAVKKNPGFRPVSVIAALKDGHPVADVTLIKGDELKTASERLD* |
| Ga0066680_106372362 | 3300005174 | Soil | LDAAASEAVKDNKGYRVVSVMPALKEGHPVADVTLVKGSEWKTVSEKLD* |
| Ga0066680_109011121 | 3300005174 | Soil | ENKGYRVVSVMPALKDGHPVADVTLVKGEEWKTVSERLD* |
| Ga0066679_102974784 | 3300005176 | Soil | HAKEQSEAMAKARRSLGAAASEAVKENKGYRVVSVMPAVQEGHPVADVTLVKGTEWKTVSEKLD* |
| Ga0066688_100377101 | 3300005178 | Soil | AVKDNKGYRAVSVMPALKDGHPVADVMLVKGTEWKTVSEKLD* |
| Ga0066685_100038079 | 3300005180 | Soil | GAVDAAVKKNPGFRPVSVIAALKDGHPVADVTLIKGDELRTASERLD* |
| Ga0066685_104653783 | 3300005180 | Soil | GAVDAAVKKNPGFRPVSVIAALKDGHPVADVTLIKGDELKTASERLD* |
| Ga0066678_107435282 | 3300005181 | Soil | SEAVKENKGYRVVSVMPALKDGHPVADVTLVKGTEWKTVSEKLD* |
| Ga0066675_113315392 | 3300005187 | Soil | AVKENKGYRVVSVFPALKDGHPVADVTLVKGTDWRMVSEKLD* |
| Ga0066388_1026179783 | 3300005332 | Tropical Forest Soil | AEHDGYRAISAMPMLKNGDAVAEIELLKGTDWKTETEKLR* |
| Ga0066388_1085386332 | 3300005332 | Tropical Forest Soil | AKAKRSLAAAASGAEKANAGFHAIAVIPAMKDDHPGAEVTLLKGTEWKTVTAKLD* |
| Ga0070694_1012383361 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | KENKGYRVVSVFPTMKDDHPVADVTLVKGNDWKTVSEKLD* |
| Ga0070694_1017129112 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | ATKENKGYRVVSVMPALKDGHPVAEVTMVKGSEFKAVSEKLD* |
| Ga0066686_102612403 | 3300005446 | Soil | AAASEAVKENKGYRVVSVMPAMKDGHPVADVTLVKGSEWKTVSEKLD* |
| Ga0066689_101085601 | 3300005447 | Soil | VKENKGYRVVSVFPALKDGHPVADVTLVKGTDWKTVSEKLD* |
| Ga0066689_103199641 | 3300005447 | Soil | VKENKGYRAVSVMPALKDGHPVADVTLVKGSEWKTVSEKLD* |
| Ga0066689_105320532 | 3300005447 | Soil | EALKENKGYRAVSVMPALKDGHPVAEVELVKGADWKTVSEKLD* |
| Ga0066682_103553223 | 3300005450 | Soil | GNPGFRAVSIFPALKDGHPVAEVSLTKGDEWKTVSEKLD* |
| Ga0066682_104458082 | 3300005450 | Soil | KKNPGFRPVSVSPALKDGHPVADVTLIKGDELKTVSERLD* |
| Ga0066682_109241911 | 3300005450 | Soil | AASEAVKENKGYRVVSVFPALKDGHPVADVTLVKGTDWKTVSEKLD* |
| Ga0070706_1006609633 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | AVKKNPGFRPVSVIPALKDGHPVADVTLIKGDEVKTASERLD* |
| Ga0070707_1001385664 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | KENKGYRVVSVMPALKDGHPVAEVTMVKGSEFKAVSEKLD* |
| Ga0070698_1005910051 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | LSLRAATENVVKANKGFRAVSVTPSLKDGHPVAEFTVLKGEEFKTASEKLD* |
| Ga0070698_1015044001 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | TATDQAAKENKGYRVVSVMPSLKDAHPVAEVTLVKGTEFKTVSEKLD* |
| Ga0070697_1002334311 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | GAAASEAIKENRGYRVVSVMPALKDDHPVADVTLVKGTEWKTVSEKLD* |
| Ga0066697_102739941 | 3300005540 | Soil | KAKRSLEAAASEAVKANKGYHAVSAFPALKDGHPVVDVTLVKGTEWKTASEKLD* |
| Ga0066697_106920081 | 3300005540 | Soil | LDAAASEAVKENKGYRVVSVFPALKDGHPVADVTLVKGADWKTVSEKLD* |
| Ga0066701_102398451 | 3300005552 | Soil | NKGYRVVSVMPALKDGHPVADVTLVKGEEWKTVSERLD* |
| Ga0066701_106600482 | 3300005552 | Soil | NKGYRVVSVFPALKDGHPVADVTLVKGTDWRMVSEKLD* |
| Ga0066692_108515162 | 3300005555 | Soil | ATETAVKANRGFRAVSVMPAVKDSHPVADVSLVKGDEWKTVVEKLD* |
| Ga0066704_108432242 | 3300005557 | Soil | VKENKGYRVVSVMPALKDGHPVADVTLVKGTEWKTVSEKLD* |
| Ga0066700_106822482 | 3300005559 | Soil | NKGYRVVSVMPALKDGHPVADVTLVKGTEWKTVAEKLD* |
| Ga0066705_104310031 | 3300005569 | Soil | AAASEAVKENKGYRVVSVMPALKEGHPVADVTLVRDSEWKTVSEKLD* |
| Ga0066694_103055052 | 3300005574 | Soil | NKGYRVVSVMPALKDGHPVADVTLVRDSEWKTVPEKLD* |
| Ga0066706_112769391 | 3300005598 | Soil | RSLEAAASGAVKENKGYRVVSVMPALKEGHPVADVTLVKGTEWKTVSEKLD* |
| Ga0068856_1012946081 | 3300005614 | Corn Rhizosphere | NAGYRAVSVMPAVKNGHPVAEVRLTSGTTVKAVEQKLD* |
| Ga0066905_1004405401 | 3300005713 | Tropical Forest Soil | QGYRAVSVTPSLKDGHPVAEVTLVKDTEFKTASEKLD* |
| Ga0066903_1010570953 | 3300005764 | Tropical Forest Soil | NAGYRAISVMPSIKDDHPVAEVTLLKGTEWKTVSERLD* |
| Ga0066903_1074469331 | 3300005764 | Tropical Forest Soil | SEAVKENKGFRVVSIMPSLKDGHPVADVTLVKGTEWKMVSEKLD* |
| Ga0066652_1005837832 | 3300006046 | Soil | KRSLAAAASEAVKANKGFRVVSVFPALKDGHPVAEVTLVKGTEWKTATEKLD* |
| Ga0066652_1015390802 | 3300006046 | Soil | AAASEAVKENKGYRVVSVMPAMKEGHPVADVTLVKGTEWKTVSEKLD* |
| Ga0075417_102479372 | 3300006049 | Populus Rhizosphere | KENKGYRVVSVFPTLKDGHPVADVTIVKGNEWKTVSEKLD* |
| Ga0066658_107969652 | 3300006794 | Soil | AKRSLAAAASEAVKANKGFRVVSVFPALKDGHPVVEVTLVKGTEWKAATEKLD* |
| Ga0066665_101431674 | 3300006796 | Soil | GYRVVSVMPAVKDGHPVADVTLVKGSDWKNVSEKLD* |
| Ga0066665_102024011 | 3300006796 | Soil | NKGYRVVSVMPALKDGHPVAEVTLVQDSEWKTVSEKLD* |
| Ga0066665_113766241 | 3300006796 | Soil | YRVVSVFPALKDGHPVADVTLVKGTDWRMVSEKLD* |
| Ga0066659_107415373 | 3300006797 | Soil | AIDAAVKKNPEFRPVSVVPALKEGHPVADVTLIKGDELKTASDRLD* |
| Ga0066659_115796521 | 3300006797 | Soil | AVKANRGFRAVSVMPAVKDSHPVADVSLVKGDEWKTVVEKLD* |
| Ga0075428_1006017253 | 3300006844 | Populus Rhizosphere | LDRAIKDNPGSRPVSVMPSLKDGHAVADVTLIKGNALSTTMETLE* |
| Ga0075421_1004527633 | 3300006845 | Populus Rhizosphere | KGYRVVSVFPAMKDGHPVADVTLVKGNEWKTVSEKLD* |
| Ga0075421_1008705141 | 3300006845 | Populus Rhizosphere | GAAASEAVKENKGYRVISVMPAMKDGHPVADVTLAKGTEWKTVSEKLD* |
| Ga0075421_1010242361 | 3300006845 | Populus Rhizosphere | SVAMKQNKDYRVVSVMPALKGGHPVAEVTLVKGKDWKTVSEKLD* |
| Ga0075431_1013278451 | 3300006847 | Populus Rhizosphere | KGYRVVSIFPTMKDGHPVADVTLVKGNEWKTVSEKLD* |
| Ga0075434_1006451281 | 3300006871 | Populus Rhizosphere | ASEAVKANKGYRVVSVMPALKDGHPVADVTLLKETAWKTVAEKLD* |
| Ga0079219_118153081 | 3300006954 | Agricultural Soil | ASRENKGYRVVSVMPALKDGHPVADVTLLKGTEWRTVSEKLD* |
| Ga0099791_100666804 | 3300007255 | Vadose Zone Soil | SGRRPIRPKESKGYRVVSVMPALKDGHPVAEVTLVKGSEFKAVSEKLD* |
| Ga0099793_103588671 | 3300007258 | Vadose Zone Soil | GNPGFRAVSIFPVLKDGHPVAAVTLTKGDEWKTVSDKLD* |
| Ga0066710_1018149332 | 3300009012 | Grasslands Soil | GYRVVSVMPALKDGHPVADVTLVRDSEWKTVSEKLD |
| Ga0066710_1025456142 | 3300009012 | Grasslands Soil | AKAKRSVEAAAAAAVKENKGFSAVSVMPAMKEDHPVADVTLVKGTEWKTVTEKLD |
| Ga0066710_1035536471 | 3300009012 | Grasslands Soil | KENKGYRVVSVMPALKDGHPVADVTLVKGAEWKTVSEKLD |
| Ga0066710_1036180612 | 3300009012 | Grasslands Soil | AASEAVKANKGFRVVSVFPALKDGHPVAEVTLVKGAEWKAATEKLD |
| Ga0066710_1037654121 | 3300009012 | Grasslands Soil | KENKGYRVVSVMPALKDGHPVADVTLVKGEEWKTVSERLD |
| Ga0066710_1042153041 | 3300009012 | Grasslands Soil | RGYRAVSVFPSLKDGHPVAEITLYKGEDWKTVTENLD |
| Ga0066710_1043683812 | 3300009012 | Grasslands Soil | SSEVGNENTWYRVFSVMPALKDGHPVADVTLVKGAEWKTVSEKLD |
| Ga0066710_1044544722 | 3300009012 | Grasslands Soil | AVKENKGYRVVSVFPALKDGHPVADVTLVKGTDWRMVSEKLD |
| Ga0066710_1047959572 | 3300009012 | Grasslands Soil | DAVAKAVAAHSGYRAVSVVPSLKNGHPVAKVELVKGGKWKTATEKLD |
| Ga0099830_110415492 | 3300009088 | Vadose Zone Soil | AASEAVKENKGYRVVSVMPALKDGHPVADVTLVKGTEWKTVSEKLD* |
| Ga0099830_111419451 | 3300009088 | Vadose Zone Soil | VKENKGYRVVSVMPALKDSHPVADVTLVKGTEWKTVSEKLD* |
| Ga0099830_118285361 | 3300009088 | Vadose Zone Soil | AASEAVNENKGFRAVSVMPALKDGHPVADVTLVKGSEFKTVSEKLD* |
| Ga0099830_118750261 | 3300009088 | Vadose Zone Soil | NPGFHAVSIYPVLKDGHPVAEVTLATGDKWKTVLEKLD* |
| Ga0099828_100967881 | 3300009089 | Vadose Zone Soil | GSQAVSITPSLKEGHPVAEVILVKNDHFNKISSPLD* |
| Ga0099828_112879161 | 3300009089 | Vadose Zone Soil | ASAAVKENKGFRAVSAMPSLKDGHPVADVGLVKGTEWKTVSEKLD* |
| Ga0099828_115064111 | 3300009089 | Vadose Zone Soil | KGYRAVSVMPSLKDGHSVADVTLVKGTEWKTVSEKLD* |
| Ga0099828_119181091 | 3300009089 | Vadose Zone Soil | HGVSVFPSLKDGRPVAEVSLHKGADWRTTTEKLD* |
| Ga0099827_102426233 | 3300009090 | Vadose Zone Soil | YRVVSVMPALKDGHPVADVTLVKGGEWKTVSEKLD* |
| Ga0099827_107765141 | 3300009090 | Vadose Zone Soil | AVKKNPGFRPVSVIPTLKDGHPVADLTLIKGDELKTVSERLE* |
| Ga0099827_110210611 | 3300009090 | Vadose Zone Soil | GAVKENKGYRVVSVMPALKDGHPVADVTLVKGAEWKTVSEKLD* |
| Ga0099827_113896221 | 3300009090 | Vadose Zone Soil | MAKAKRSLRMVADQGAKENKGYRVVSVMPALKEGHPVAEVTLVKGNEFKTVSEKLD* |
| Ga0099827_114370952 | 3300009090 | Vadose Zone Soil | VKANKGYRAGSVFPALKDGHPVAEVMLVKGAEWKAATEKLD* |
| Ga0099827_114529271 | 3300009090 | Vadose Zone Soil | VKENKGYRVVSVMPVVKDGHPVADVALVKGSEWKTVSEKLD* |
| Ga0066709_1022958403 | 3300009137 | Grasslands Soil | GGAVDAAVKKNPGFRPVSVIAALKDGHPVADVTLIKGDELKTASERLD* |
| Ga0066709_1025217472 | 3300009137 | Grasslands Soil | GGAVDAAVKKNPGFRPVSVIAALKDGHPVADVTLIKGDELRTASERLD* |
| Ga0066709_1037269042 | 3300009137 | Grasslands Soil | SEAVKENKGYRVVSVFPALKDGHPVADVTLVKGADWKTVSEKLD* |
| Ga0099792_100701813 | 3300009143 | Vadose Zone Soil | MAKAKRSLRTVADQAAKENKGYRVVSVMPALKEGHPVAEVTLVKGSEFKAVSEK |
| Ga0099792_109722051 | 3300009143 | Vadose Zone Soil | LKSNPGFRAVSIFPALKDGHPVAEITLTKGDEWKTVSEKLD* |
| Ga0114129_115029872 | 3300009147 | Populus Rhizosphere | GYRAVSVMPALKDGHPVAEVELVKGTDWKTVSEKLD* |
| Ga0105242_126999651 | 3300009176 | Miscanthus Rhizosphere | SRDTKDVRMFSFFSVMPALKDGHPVADVTLVKGSDWKTVSEKLD* |
| Ga0126380_122836491 | 3300010043 | Tropical Forest Soil | DAVKANAGFSAIAVMPAMKDDHPVADVTLLKGAEWKTVSEKLD* |
| Ga0126384_103865041 | 3300010046 | Tropical Forest Soil | EAVKENKGFRVVSIMPSLKDGHPVADVTLVKGAQWKTVSEKLD* |
| Ga0126384_120738441 | 3300010046 | Tropical Forest Soil | AKRSLAAATADAAKANAGSRAISVMPTMKDDHPVAEVTLVKGTEWKAVTEKLD* |
| Ga0126382_119041952 | 3300010047 | Tropical Forest Soil | EAVKDNKGYRVVSVFPAVKDGHPVADVTLVKGNEWKTVSEKLD* |
| Ga0126373_125112191 | 3300010048 | Tropical Forest Soil | EAVRENKGYRVVSVTAELKDGHPVAEVTLVKGADWKTVSEKLD* |
| Ga0134088_100557051 | 3300010304 | Grasslands Soil | DAAASEAVKENKGYRVVSVFPALKDGHPVADVTLVKGTDWRMVSEKLD* |
| Ga0134088_100663763 | 3300010304 | Grasslands Soil | VDAAVKKNPGFRPVSVIAALKDGHPVADVTLIKGDELRTASERLD* |
| Ga0134111_105458511 | 3300010329 | Grasslands Soil | YRAVSVMPALKDGHPVADVTLVKGTEWKTVSEKLD* |
| Ga0134080_102227091 | 3300010333 | Grasslands Soil | KGYRVVSVFPALKAGHPVADVTLVKGADWKTVSEKLD* |
| Ga0134063_106733183 | 3300010335 | Grasslands Soil | AVKKNPGFRPVSVVPALKDGHPVADVTLIKGDELKTASERLD* |
| Ga0134071_105648431 | 3300010336 | Grasslands Soil | AVKENKGYRVVSVMPALKDGHAVADVTLLKGADWKTVSEKLD* |
| Ga0126370_100458221 | 3300010358 | Tropical Forest Soil | SLEAAASEAAKENKGYRVVSVTPELKDGHPVADVTLVKNTDWKTVSEKLD* |
| Ga0126370_101849791 | 3300010358 | Tropical Forest Soil | RAVSVMPDLRDGHPVAKVTLVNGTRWKTVYETLE* |
| Ga0126370_103521993 | 3300010358 | Tropical Forest Soil | SLDAAASEAVKENKGYRVVEVTPTLKDGHPVADVTLVKGTDWKTVAEKLD* |
| Ga0126370_118486821 | 3300010358 | Tropical Forest Soil | LEAAASEAAKENKGYRVVSVTPELKDGHPVADVMLVKDTDWKTVSEKLD* |
| Ga0126376_100739631 | 3300010359 | Tropical Forest Soil | VKANNGYRAVSVTPSVKDGHPVADITLVKGTEFKTTSEKLD* |
| Ga0126376_105282891 | 3300010359 | Tropical Forest Soil | ASEAVKENKGYRVVEVTPTLKDGHPVADVTLVKGTDWKTVAEKLD* |
| Ga0126372_100822072 | 3300010360 | Tropical Forest Soil | AAASEAIKENKGYRVVSVTPELKDGHPVADVTLVKDTDWKTVSEKLD* |
| Ga0126372_102785373 | 3300010360 | Tropical Forest Soil | AAAASDAVKANAGYRAISVMPSMKDDHPVAEVTLLKGTDWKTVTEKLD* |
| Ga0126372_106135621 | 3300010360 | Tropical Forest Soil | NQGFRAVSIFPSVKDGHPVAEITLVKGEEWKTLSEKLD* |
| Ga0126372_107037643 | 3300010360 | Tropical Forest Soil | YRVVSVTPEMKDGHPVADVTLVKDTDWKTVSEKLD* |
| Ga0126372_108235771 | 3300010360 | Tropical Forest Soil | QGYRAVNVTPSLKDGHPVAEVTLVKDTEFKTASEKLD* |
| Ga0126372_111634081 | 3300010360 | Tropical Forest Soil | AIEAVKENKGYRVVSVTPTMKDGHPVADVTLVKGTDWKTVAEKLD* |
| Ga0126372_118860862 | 3300010360 | Tropical Forest Soil | AAAATEAMKANAGFRAVAVVPAVKDDHPMAEVTLLKGAEWKTVTEKLD* |
| Ga0126372_119293102 | 3300010360 | Tropical Forest Soil | VKQNKGYRVVSVFPEMKDGHPVADVTLVKGNEWKTVSEKLD* |
| Ga0126372_130171022 | 3300010360 | Tropical Forest Soil | AASEAVKANAGYRAISVMPAMKEDHPVADVTLLKGTDWKTVTEKLD* |
| Ga0126372_130980761 | 3300010360 | Tropical Forest Soil | KANNGYRAVSVTPSVKDGHPVADITLVKGTEFKTTSEKLD* |
| Ga0126378_117254312 | 3300010361 | Tropical Forest Soil | SLAAAASDAAKANTGYRVISVMPAVKDDHAVAEVTLLKGAEWKTVTEKLD* |
| Ga0126378_118911232 | 3300010361 | Tropical Forest Soil | ASEAAKENKGYRVVSVTPELKDGHPVADVTLVKDTDWKTVSEKLD* |
| Ga0126378_131406422 | 3300010361 | Tropical Forest Soil | AVDAAVKENPGFRPVSVIPALKDGHPTADVTLIKGDERKTASERLD* |
| Ga0126377_113333251 | 3300010362 | Tropical Forest Soil | SGFRVVSVTPGLKDGHPVAEVTLAKDAEWKTVSEKLD* |
| Ga0126377_131136251 | 3300010362 | Tropical Forest Soil | NPGYRAVSITPSLKDGHPVAEVTLVKDAEFKTASEKLD* |
| Ga0126379_110772441 | 3300010366 | Tropical Forest Soil | KENKGYRVVSVTPELKDGHPVADVTLVKNTDWKTVSEKLD* |
| Ga0126379_127403041 | 3300010366 | Tropical Forest Soil | SEAAKENKGYRVVSVTPELKDGHPVADVTLVKDTDWKTVSEKLD* |
| Ga0126381_1015166483 | 3300010376 | Tropical Forest Soil | VKENKGYRVVEVTPTLKDGHPVADVTLVKGTDWKTVSETLD* |
| Ga0126381_1019408641 | 3300010376 | Tropical Forest Soil | MAKAKRSLDAAAANAVRANQGFRAVSVMPALKADHPVAEVTVVKGTEWKTVAEKLD* |
| Ga0126381_1032169341 | 3300010376 | Tropical Forest Soil | KAKRSLEAAASEAAKENKGYRVVSVTPELKDGHPVADVTLVKDTDWKTVSEKLD* |
| Ga0126383_131514062 | 3300010398 | Tropical Forest Soil | VNANQGFRAVSIVPSLKGGHPVAEVTLVKDGTFKTVTETLE* |
| Ga0137392_100988273 | 3300011269 | Vadose Zone Soil | GYRVVNVTPALKEGHPVAEVTLVKGGEFKAVSEKLD* |
| Ga0137392_110942552 | 3300011269 | Vadose Zone Soil | VKDNTGYHVVSVTPVLKDGHPVAEVTLVRGSEWKTVSRKLD* |
| Ga0137393_104749481 | 3300011271 | Vadose Zone Soil | KENKGYRVVSAMPALKDGHPVADVTLVKGTEWKTVAEKLD* |
| Ga0137389_102608053 | 3300012096 | Vadose Zone Soil | VLKGNPGFRAVSVFPSLKDGHPIAEVTLVKGDEWKTVSEKLD* |
| Ga0137389_107000181 | 3300012096 | Vadose Zone Soil | TAASEAVKENKGYRAVSVMPSLKDGHSVADVTLVKGTEWKTVSEKLD* |
| Ga0137389_118236841 | 3300012096 | Vadose Zone Soil | NENKGFRAVSVMPALKDGHPVADVTLVKGSEFKTVSEKLD* |
| Ga0137388_110771071 | 3300012189 | Vadose Zone Soil | YRVVSVMPALKDGHPVADVTLVKGTEWKTVSEKLD* |
| Ga0137388_112232682 | 3300012189 | Vadose Zone Soil | EAVKENKGYRVVSVMPALKDGHPVADVTLVKGAEWKTVSEKLD* |
| Ga0137388_112858431 | 3300012189 | Vadose Zone Soil | NKGFRAVSVTPTLKDGHPVADVSLFKGHEWKTMSEKPD* |
| Ga0137388_112905251 | 3300012189 | Vadose Zone Soil | HKGYRAVSVMPALKDGHPVADVTLVKGADWKTVSEKLD* |
| Ga0137364_102605211 | 3300012198 | Vadose Zone Soil | GYRAVSVMPNLKDGHPVADVTLIKGTEWKTVSEKLD* |
| Ga0137381_114602861 | 3300012207 | Vadose Zone Soil | PLGGAVDAAVKKNPGFRPVSVIAALKDGHPVADVTLIKGDELKTASERLD* |
| Ga0137377_118948851 | 3300012211 | Vadose Zone Soil | ATEAVKENKGYRAVSVMPAVKDGHPVADVTLVKGSEWKTVSEKLD* |
| Ga0137372_106393041 | 3300012350 | Vadose Zone Soil | ENKGYRVVSVMPAVKDGHPVADVALVKGSEWKTVSEKLD* |
| Ga0137372_112341402 | 3300012350 | Vadose Zone Soil | DNKGFRVVSVMPALKDGHPVADVTLVKGTEWKTVSEKLD* |
| Ga0137369_101696022 | 3300012355 | Vadose Zone Soil | MAKAKRSLDAAASAAVKQNTGFRAVSVMPAMKDARPVADVTLLKGTEWKTVTEKLD* |
| Ga0137369_106613352 | 3300012355 | Vadose Zone Soil | VKVNKWYRVVSVMPALKDGHPVADVTLVKDTEWKTVSEKLD* |
| Ga0137371_110339742 | 3300012356 | Vadose Zone Soil | AAASEAVKDNKGFRVVSVRPVLKDGHPVADVTLVKGTEWKTVSEKLD* |
| Ga0137368_102060051 | 3300012358 | Vadose Zone Soil | AAASAAVKENTGFRAVSVMPAMKDAHPVADVTLLKGTEWKTVTEKLD* |
| Ga0137368_108111911 | 3300012358 | Vadose Zone Soil | KGFVAVSVTPSLKDGHPVAEVTLAKGEEFKTVSEKLD* |
| Ga0137385_110833842 | 3300012359 | Vadose Zone Soil | ASEAVKENKGYRVVSVMPAVKDGHPVADVALVKGSEWKTVSEKLD* |
| Ga0137375_106128141 | 3300012360 | Vadose Zone Soil | SAAVKENTGFRAVSVMPAMKDAHPVADVTLLKGTNWKTVTEKLD* |
| Ga0137375_108598371 | 3300012360 | Vadose Zone Soil | KAKRSFEAAASEAVKENKGFRVVSVMPSLKEGHPMADVTLVKGDQWKTVSEKLD* |
| Ga0137360_100777683 | 3300012361 | Vadose Zone Soil | MAKAKRSLRTAADQAAKENKGYRVVNVTPALKEGHPVAEVTLVKGGEFKAVSEKLD* |
| Ga0137360_100799331 | 3300012361 | Vadose Zone Soil | EAVKENMGYRVVSVMPALKDGHPVADVTLVKGTEWKTVSEKLD* |
| Ga0137360_111449482 | 3300012361 | Vadose Zone Soil | LATVLKGNPGFRGVSIFPALKDGHPIAEVTITKGNEWKTVSEKLD* |
| Ga0137360_113655601 | 3300012361 | Vadose Zone Soil | RSLRTAADQAAKENKGYRVVSVMPALKEGHPVAEVTLVKGSEFKAVSEKLD* |
| Ga0137360_116306031 | 3300012361 | Vadose Zone Soil | KKNPGFRPVSAIPALKEGHPVADVSLIKGDELKTASERLD* |
| Ga0137361_101363711 | 3300012362 | Vadose Zone Soil | DAAASEAVKENKGYRVVSVMPVLKDGHPVADVTLVKGTEWKTVAEKLD* |
| Ga0137361_105113333 | 3300012362 | Vadose Zone Soil | MAKAKRSVEAAAAAAVKENKGFRAVSVMPAMKEDHPVADVTLVKGTEWKTVTEKLD* |
| Ga0134045_13481991 | 3300012409 | Grasslands Soil | ANKGFRVVSVFPALRDGHPVAEVTLVKGAEWKAATEKLD* |
| Ga0137358_110195502 | 3300012582 | Vadose Zone Soil | RAVSVMPSLKDGHPVAEITLVKDEEFKTVSEKLD* |
| Ga0137395_100075932 | 3300012917 | Vadose Zone Soil | MAKAKRSLRAVADQAAKENKGYRVVSVTPALKEGHPVAEVTLVKGGEFKAVSEKLD* |
| Ga0137359_105313831 | 3300012923 | Vadose Zone Soil | ENTGYRVVSVMPALKDGHPVADVTLVKGNDWKNVSEKLD* |
| Ga0137419_117838021 | 3300012925 | Vadose Zone Soil | MAKAKRSLGAAASEAVKENKGYRVVSVMPTVKDGHPIADVTLVKGADWKTVSEKLD* |
| Ga0137419_119847312 | 3300012925 | Vadose Zone Soil | VAEATKANKGFRAVSAYPGMKDGHPVADVTLVKGTEWKTEAEKLD* |
| Ga0137407_103301793 | 3300012930 | Vadose Zone Soil | KENKGYRVVSVMPVLKDGHPVADVTLVKGTEWKTVAEKLD* |
| Ga0137407_118723821 | 3300012930 | Vadose Zone Soil | KRSLEAAASEAAKENTGYRVVSVMPAVKDGHPVADVTLVKGSDWKNVSEKLD* |
| Ga0126375_108031721 | 3300012948 | Tropical Forest Soil | RTLADAVGRAVKANAGYRAISVTPAVSEGHPVAEVVLLKGADWKTVSEKLD* |
| Ga0126375_115438722 | 3300012948 | Tropical Forest Soil | ASEAAKENKGYQVVSVTPGLKDGHPVADVTLVKDTDWKTVSEKLD* |
| Ga0126375_120022181 | 3300012948 | Tropical Forest Soil | RAVSVTPSLKDGHPVAEVTLVKGAEFKTASEKLD* |
| Ga0126369_103342501 | 3300012971 | Tropical Forest Soil | KGSRAVSVMPALKEGHPVADVTLVKGGESKTVSERLD* |
| Ga0126369_111288391 | 3300012971 | Tropical Forest Soil | ENKGYRVVSVTPELKDGHPVADVTLVKDTDWKTVSEKLD* |
| Ga0126369_111666222 | 3300012971 | Tropical Forest Soil | VKENKGYRVVSVTPELKDGHPVADVTLVKDTDWKTVSEKLD* |
| Ga0126369_117863341 | 3300012971 | Tropical Forest Soil | ASEAAKANKGYRVISVMPTLKDGHPVADVTLVKGTDWKAVSEKLD* |
| Ga0126369_118337341 | 3300012971 | Tropical Forest Soil | ENKGYRVVSVTPALKEGHPVADVILVKGSEWKTVSEKLD* |
| Ga0134077_101912951 | 3300012972 | Grasslands Soil | VKENKGYRAVSVMPALKDGHPVADVTLVKGAEWKTVSEKLD* |
| Ga0134110_105672562 | 3300012975 | Grasslands Soil | EAVKENKGYRVVSVMPASKDGHPVADVTLVKGEEWKTVSEKLD* |
| Ga0134076_102634352 | 3300012976 | Grasslands Soil | ASEAVKENKGCRAVSVMPALKDGHPVADVTVVKGTEWKTVSEKLD* |
| Ga0134076_104762452 | 3300012976 | Grasslands Soil | KKNPGFRPVSVIPTLKDGHPVADVTLIKGDELKTVSEGLD* |
| Ga0134087_100054197 | 3300012977 | Grasslands Soil | SLAAATETAVKANRGFRAVSVMPALKDGHPIADVTLVKGDEWTTVSEKLE* |
| Ga0134087_100075881 | 3300012977 | Grasslands Soil | KVLKSNPGFRAVSIFPALKDGHPVSEITLTKGDEWRTVSEKLD* |
| Ga0134087_104972642 | 3300012977 | Grasslands Soil | LKKNPGFRPVSVSPSLKDGHPVADVTLIKGDELKTVSERLD* |
| Ga0164304_115257151 | 3300012986 | Soil | AADQATKENKGYRVVSVMPALKDGHPVAEVTMVRGREFKAVSEKLD* |
| Ga0134081_100489521 | 3300014150 | Grasslands Soil | ENKGYRVVSVMPALKDGHPVADVTLVKGTEWKTVSEKLD* |
| Ga0134078_101449341 | 3300014157 | Grasslands Soil | RVVSVFPALKDGHPVAEVTLVKGTEWKTATEKLD* |
| Ga0173480_109739181 | 3300015200 | Soil | RVVSVMPELRNDHPVAEVTLVKGTEWETVSEKLD* |
| Ga0137403_104305572 | 3300015264 | Vadose Zone Soil | EAAASEAAKENTGYRVVSVMPAVKDEHPVADVTLVKGSDWKNVSEKLD* |
| Ga0137403_105286312 | 3300015264 | Vadose Zone Soil | ANEGYRAVSVFPGLKEGRPVAEVTLVKDDTFKTVAAKLD* |
| Ga0134089_102237742 | 3300015358 | Grasslands Soil | LDAAASEAVKENKGYRVVSVFPALKDGHPVADVTLVKGTDWRMVSEKLD* |
| Ga0132256_1027443302 | 3300015372 | Arabidopsis Rhizosphere | LKAVTVPTCCSLAAAASDAVKANAGYRAISVMPSRKDDHAVAEVTLLKGTDWKTATEKLD |
| Ga0134112_102106191 | 3300017656 | Grasslands Soil | RSLEAAASEAVKENKGYRVVSVMPALKDGHPVADVTLVRDSEWKTVPEKLD |
| Ga0134074_13643901 | 3300017657 | Grasslands Soil | FRAVSVMPALKDGHPVADVTLVKGDEWTTVSEKLE |
| Ga0134083_104752312 | 3300017659 | Grasslands Soil | LAKVLKGNPGFRAVSVFPSLKDGHPMAEVTLTKGDEWKTVSEKLE |
| Ga0184608_102222091 | 3300018028 | Groundwater Sediment | KANKGFVAVSVTPSLKDGHPVAEVTLAKGEEFKTVSAKLD |
| Ga0184621_103750722 | 3300018054 | Groundwater Sediment | VKANKGFVAVSVTPSLKDGHAVAEVTLAKGEEFKTVSEKLD |
| Ga0184632_102165061 | 3300018075 | Groundwater Sediment | RSLDAAASEAGRENKGYRVVSVMPALKDGHPVADVTLVKGTEWKTVSEKLD |
| Ga0184612_100778531 | 3300018078 | Groundwater Sediment | KGYRVVSVMPAMKDGHPVADVTLVKGTEWKTVSEKLD |
| Ga0184625_102728631 | 3300018081 | Groundwater Sediment | KANKGFVAVSVTPSLKDGHPVAEVTLAKGEEFKTVAEKLD |
| Ga0066655_106874122 | 3300018431 | Grasslands Soil | GGAVDAAVKKNPGFRPVSVIAALKDGHPVADVTLIKGDELRTASERLD |
| Ga0066655_108931673 | 3300018431 | Grasslands Soil | GGAVDAAVKKNPGFRPVSVIAALKDGHPVADVTLIKGDELKTASERLD |
| Ga0066655_112384712 | 3300018431 | Grasslands Soil | TPGFRPVSVVPALKEGHPVADVTLIKGNELKTASEELD |
| Ga0066655_112905151 | 3300018431 | Grasslands Soil | QTAIDAAVKKNPGFRPVSAIPALKEGHPVADVSLIKGDELKTASERLD |
| Ga0066667_102130622 | 3300018433 | Grasslands Soil | AAAASEAVKANKGFRVVSVFPALKDGHPVAEVTLVKGTEWKTATEKLD |
| Ga0066667_102661911 | 3300018433 | Grasslands Soil | NKGYRVVSVMPALKDGHPVAEVTLVQDSEWKTVSEKLD |
| Ga0066662_110413263 | 3300018468 | Grasslands Soil | ANKDFRAVSVFPEIKDGHAIATVTLVKGQDRKTVSEVLD |
| Ga0066669_104115573 | 3300018482 | Grasslands Soil | MAKAKRSLGAAASEAVKENKGYRVVSVMPAVKEGHPVADVTLVKGTEWKTVSEKLD |
| Ga0066669_110517751 | 3300018482 | Grasslands Soil | MAKAKRSLGAAASEAVKENKGYRVVSVMPAMKEGHPVADVTLVKGTEWKTVSEKLD |
| Ga0179594_101510942 | 3300020170 | Vadose Zone Soil | AVKANRGFRAVSVMPALKDGHPVADVTLVKGDEWTTVSEKLE |
| Ga0210378_100460533 | 3300021073 | Groundwater Sediment | SGAVKENKGYRVVSIMPAMKDGHPVAEVTLVNGAEWKTVSEKLD |
| Ga0126371_134114051 | 3300021560 | Tropical Forest Soil | GFHVVSVMPALKDGHPVADVTLVKGSEWKTVSEKLD |
| Ga0207684_100423121 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | ATKENKGYRVVSVVPALKDGHPVAEVTMVRGREFKAVSEKLD |
| Ga0207646_100594535 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | KGNSRSRAVSILPVLKDGHPIAEVTLTKGDEWKIVSEKLN |
| Ga0207711_114972221 | 3300025941 | Switchgrass Rhizosphere | AKAKRSLATAASEAVKENKGFRAVSVMPSLKEGHPVADVELVKGTEWKTVSEKLD |
| Ga0207651_110067382 | 3300025960 | Switchgrass Rhizosphere | MFSVFSVMPALKDGHPVADVTLVKGSDWKTVSEKLD |
| Ga0209234_10390394 | 3300026295 | Grasslands Soil | AEALKANKGYRAVSVVPALKEGHPVAEVTLVKGAEWKTESETLD |
| Ga0209235_12405891 | 3300026296 | Grasslands Soil | VKENKGYRVVSVMPALKDGHPVADVTLVKGEEWKTVSERLD |
| Ga0209239_12138532 | 3300026310 | Grasslands Soil | KANKGFRVVSVFPALKDGHPVAEVTLVKGTEWKTATEKLD |
| Ga0209761_10901583 | 3300026313 | Grasslands Soil | YRVVSVFPALKDGHPVADVTLVKGTDWRMVSEKLD |
| Ga0209266_11501242 | 3300026327 | Soil | ATKGFRVVSVFPALKDGHPVAEVTLVKGTEWKAATEKLD |
| Ga0209802_13217792 | 3300026328 | Soil | KGFRAVSAIPTLKEMHPVAEITLAKGSEFKTVTERLD |
| Ga0209375_11607773 | 3300026329 | Soil | AAEALKANKGYRAVSVVPALKEGHPVAEVTLVKGAEWKTESETLD |
| Ga0209267_10296245 | 3300026331 | Soil | KENKGYRVVSVFPALKDGHPVADVTLVKGTDWRMVSEKLD |
| Ga0209803_10337454 | 3300026332 | Soil | AVKANKGFRLVSVFPALKDGHPVAEVTLVKGTEWKTATEKLD |
| Ga0209377_12462062 | 3300026334 | Soil | VKENKGYRVVSVMPALKDGHPVADVTLVKGTEWKTVSEKLD |
| Ga0209159_12397772 | 3300026343 | Soil | EALKANKGYRAVSVVPALKEGHPVAEVTLVKGAEWKTESETLD |
| Ga0257149_10065061 | 3300026355 | Soil | LRAVADQAAKENKGYRVVNVTPALKEGHPVAEVTLVKGGEFKAVSEKLD |
| Ga0257177_10052152 | 3300026480 | Soil | LRAVADQAAKENKGYRVVSVTPALKEGHPVAEVTLVKGGEFKAVSEKLD |
| Ga0257164_10121041 | 3300026497 | Soil | GFRAVSIFPALKDGHPVAEITLTKGDEWKNVSETLD |
| Ga0209157_12836241 | 3300026537 | Soil | AASEAVKENKGYRVVSVMPALKDGHPVADVTLVRDSEWKTVSEKLD |
| Ga0209056_100846324 | 3300026538 | Soil | KANKGYRAVSAFPALKDGHPVVDVTLVKGTEWKTASEKLD |
| Ga0209805_12821151 | 3300026542 | Soil | SNTGFRAVSIFPALKDGHPVSEITLTKGDEWKTVSEKLD |
| Ga0209156_101698011 | 3300026547 | Soil | KATRSLAAATETAVKANRGFRAVSVMPALKDGHPIADVTLVKGDEWTTVSEKLE |
| Ga0209969_10758561 | 3300027360 | Arabidopsis Thaliana Rhizosphere | YRVVSVMPELRNDHPVAEVTLVKGTEWKTVSEKLD |
| Ga0209466_10614951 | 3300027646 | Tropical Forest Soil | ANAGYRAISVTPAVSEGHPVAEVVLLKGADWKTVSEKLD |
| Ga0209180_104746282 | 3300027846 | Vadose Zone Soil | AVQENKGYRVVSVMPALKDGHPVADVTLVKGTEWKTVSEKLD |
| Ga0209701_102343273 | 3300027862 | Vadose Zone Soil | QENKGYRVVSVMPALKDSHPVADVTLVKGTEWKTVSEKLD |
| Ga0209814_102032872 | 3300027873 | Populus Rhizosphere | VKENKGYRVVSVFPTVKDGHPVADVTLVKGNEWKTVSEKLD |
| Ga0209283_106527232 | 3300027875 | Vadose Zone Soil | VKENRGYRVVSVMPALKDGHPVADVTLVKGTEWKTVSEKLD |
| Ga0209590_106869112 | 3300027882 | Vadose Zone Soil | AKESKGYRAVSVMPSLKDGHPVAEVILVKDNEFKTISEKLD |
| Ga0209488_100770252 | 3300027903 | Vadose Zone Soil | MAKAKRSLRAVADQAAKENKGYRVVSVTPALKEGHPVAEVTLVKGGEFKAVSEKLD |
| Ga0268264_101835141 | 3300028381 | Switchgrass Rhizosphere | GYRAVSVMPALKDGHPVAEVELVKGTDWKTVSEKLD |
| Ga0310887_101622952 | 3300031547 | Soil | KENKGYRAVSVMPALKDGHPVAEVELVKGTDWKTVSEKLD |
| Ga0307469_111884141 | 3300031720 | Hardwood Forest Soil | EAVKENKGYRVVSVMPALKDGHPVADVTLVKGSEWKTVSEKLD |
| Ga0307469_115975151 | 3300031720 | Hardwood Forest Soil | VKKNKGYRVVSVFPAMKDGHPVADVTLVKGNEWKTVSEKLD |
| Ga0306918_102547091 | 3300031744 | Soil | KANAGYRAVSALPALKDGHPVAAVTVAKGDEFKTVSEKLD |
| Ga0318566_101802381 | 3300031779 | Soil | VKANAGYRAVSALPALKDGHPVAAVTVAKGDEFKTVSEKLD |
| Ga0318547_103500202 | 3300031781 | Soil | ENKGYRVVSVTPELKDGHPVADVTLVKDTDWKTVSEKLD |
| Ga0318517_105688081 | 3300031835 | Soil | AKENKGYRVVSVTPELKDGHPVADVTLVKDTDWKTVSEKLD |
| Ga0318507_101999193 | 3300032025 | Soil | YRAVSALPALKDGHPVAAVTVAKGDEFKTVSEKLD |
| Ga0307471_1002900574 | 3300032180 | Hardwood Forest Soil | AVAEATKTNKGFRAVSAYPAMKDGHPVADVTLVKGTEWKTESEKLD |
| Ga0307471_1013060193 | 3300032180 | Hardwood Forest Soil | GFRGVSIFPALKDGHPVAEITLTKGDEWKTVSETLD |
| Ga0307471_1018627582 | 3300032180 | Hardwood Forest Soil | QGFRAVSAMPALKDGHPVADITLVKGTEWKTVSEKLD |
| Ga0307471_1034615342 | 3300032180 | Hardwood Forest Soil | VKKNPGFRPVSAIPALKEGHPVADVSLIKGDELKTTSERLD |
| Ga0307471_1042979862 | 3300032180 | Hardwood Forest Soil | FRAVSVMPSVKDDHPVADVTLVKGTEWKTVSEKLD |
| Ga0306920_1027453361 | 3300032261 | Soil | SLEAAASEAVKENKGYRVVSVTPELKDGHPVADVTLVKDTDWKTVSEKLD |
| ⦗Top⦘ |