| Basic Information | |
|---|---|
| Family ID | F014717 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 260 |
| Average Sequence Length | 46 residues |
| Representative Sequence | VTLLSVLPHGATGTWLDEIIEFGLPLIILIVLYVWSSRKPKEKQKSK |
| Number of Associated Samples | 186 |
| Number of Associated Scaffolds | 260 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 40.00 % |
| % of genes near scaffold ends (potentially truncated) | 23.85 % |
| % of genes from short scaffolds (< 2000 bps) | 78.85 % |
| Associated GOLD sequencing projects | 169 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.43 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (98.846 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (18.462 % of family members) |
| Environment Ontology (ENVO) | Unclassified (31.538 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (50.385 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 40.00% β-sheet: 0.00% Coil/Unstructured: 60.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.43 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 260 Family Scaffolds |
|---|---|---|
| PF13115 | YtkA | 32.69 |
| PF13442 | Cytochrome_CBB3 | 25.00 |
| PF01523 | PmbA_TldD | 5.00 |
| PF00034 | Cytochrom_C | 4.62 |
| PF05751 | FixH | 4.62 |
| PF05425 | CopD | 2.69 |
| PF05552 | TM_helix | 1.92 |
| PF01475 | FUR | 1.15 |
| PF06439 | 3keto-disac_hyd | 0.77 |
| PF13798 | PCYCGC | 0.77 |
| PF03379 | CcmB | 0.77 |
| PF04945 | YHS | 0.77 |
| PF00903 | Glyoxalase | 0.77 |
| PF00072 | Response_reg | 0.38 |
| PF13191 | AAA_16 | 0.38 |
| PF00127 | Copper-bind | 0.38 |
| PF00440 | TetR_N | 0.38 |
| PF04234 | CopC | 0.38 |
| PF16268 | DUF4921 | 0.38 |
| PF09828 | Chrome_Resist | 0.38 |
| PF07690 | MFS_1 | 0.38 |
| PF04977 | DivIC | 0.38 |
| PF01182 | Glucosamine_iso | 0.38 |
| PF13567 | DUF4131 | 0.38 |
| COG ID | Name | Functional Category | % Frequency in 260 Family Scaffolds |
|---|---|---|---|
| COG0312 | Zn-dependent protease PmbA/TldA or its inactivated homolog | General function prediction only [R] | 5.00 |
| COG5456 | Nitrogen fixation protein FixH | Inorganic ion transport and metabolism [P] | 4.62 |
| COG1276 | Putative copper export protein | Inorganic ion transport and metabolism [P] | 2.69 |
| COG0668 | Small-conductance mechanosensitive channel | Cell wall/membrane/envelope biogenesis [M] | 1.92 |
| COG3264 | Small-conductance mechanosensitive channel MscK | Cell wall/membrane/envelope biogenesis [M] | 1.92 |
| COG0735 | Fe2+ or Zn2+ uptake regulation protein Fur/Zur | Inorganic ion transport and metabolism [P] | 1.15 |
| COG2386 | ABC-type transport system involved in cytochrome c biogenesis, permease component | Posttranslational modification, protein turnover, chaperones [O] | 0.77 |
| COG0363 | 6-phosphogluconolactonase/Glucosamine-6-phosphate isomerase/deaminase | Carbohydrate transport and metabolism [G] | 0.38 |
| COG2372 | Copper-binding protein CopC (methionine-rich) | Inorganic ion transport and metabolism [P] | 0.38 |
| COG2919 | Cell division protein FtsB | Cell cycle control, cell division, chromosome partitioning [D] | 0.38 |
| COG4839 | Cell division protein FtsL | Cell cycle control, cell division, chromosome partitioning [D] | 0.38 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 98.85 % |
| Unclassified | root | N/A | 1.15 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000033|ICChiseqgaiiDRAFT_c2311276 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 979 | Open in IMG/M |
| 3300000956|JGI10216J12902_106272487 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 745 | Open in IMG/M |
| 3300000956|JGI10216J12902_107644937 | All Organisms → cellular organisms → Bacteria | 709 | Open in IMG/M |
| 3300000956|JGI10216J12902_112454888 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
| 3300001661|JGI12053J15887_10066142 | All Organisms → cellular organisms → Bacteria | 2004 | Open in IMG/M |
| 3300003319|soilL2_10007323 | All Organisms → cellular organisms → Bacteria | 11139 | Open in IMG/M |
| 3300003319|soilL2_10218948 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1664 | Open in IMG/M |
| 3300004157|Ga0062590_101058512 | All Organisms → cellular organisms → Bacteria | 777 | Open in IMG/M |
| 3300004157|Ga0062590_101144245 | All Organisms → cellular organisms → Bacteria | 754 | Open in IMG/M |
| 3300004463|Ga0063356_100059148 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3915 | Open in IMG/M |
| 3300004463|Ga0063356_100469867 | All Organisms → cellular organisms → Bacteria | 1650 | Open in IMG/M |
| 3300004463|Ga0063356_101490973 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1001 | Open in IMG/M |
| 3300004463|Ga0063356_102054965 | All Organisms → cellular organisms → Bacteria | 866 | Open in IMG/M |
| 3300004463|Ga0063356_104405927 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 606 | Open in IMG/M |
| 3300004480|Ga0062592_101228389 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 702 | Open in IMG/M |
| 3300004480|Ga0062592_101661512 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 620 | Open in IMG/M |
| 3300005166|Ga0066674_10157404 | All Organisms → cellular organisms → Bacteria | 1074 | Open in IMG/M |
| 3300005172|Ga0066683_10104786 | All Organisms → cellular organisms → Bacteria | 1718 | Open in IMG/M |
| 3300005177|Ga0066690_10632630 | All Organisms → cellular organisms → Bacteria | 713 | Open in IMG/M |
| 3300005180|Ga0066685_10023635 | All Organisms → cellular organisms → Bacteria | 3723 | Open in IMG/M |
| 3300005181|Ga0066678_10183389 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1328 | Open in IMG/M |
| 3300005294|Ga0065705_10436999 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 827 | Open in IMG/M |
| 3300005295|Ga0065707_10235817 | All Organisms → cellular organisms → Bacteria | 1172 | Open in IMG/M |
| 3300005336|Ga0070680_100125946 | All Organisms → cellular organisms → Bacteria | 2140 | Open in IMG/M |
| 3300005336|Ga0070680_100186486 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1747 | Open in IMG/M |
| 3300005336|Ga0070680_101406869 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
| 3300005336|Ga0070680_101440270 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
| 3300005338|Ga0068868_100764532 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 869 | Open in IMG/M |
| 3300005338|Ga0068868_100865813 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 819 | Open in IMG/M |
| 3300005343|Ga0070687_100127552 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1464 | Open in IMG/M |
| 3300005343|Ga0070687_100942760 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
| 3300005353|Ga0070669_101716626 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
| 3300005406|Ga0070703_10210357 | All Organisms → cellular organisms → Bacteria | 768 | Open in IMG/M |
| 3300005440|Ga0070705_101343652 | Not Available | 594 | Open in IMG/M |
| 3300005444|Ga0070694_100223743 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1413 | Open in IMG/M |
| 3300005445|Ga0070708_100044421 | All Organisms → cellular organisms → Bacteria | 3907 | Open in IMG/M |
| 3300005450|Ga0066682_10035341 | All Organisms → cellular organisms → Bacteria | 2959 | Open in IMG/M |
| 3300005458|Ga0070681_10606384 | All Organisms → cellular organisms → Bacteria | 1009 | Open in IMG/M |
| 3300005459|Ga0068867_100570324 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 983 | Open in IMG/M |
| 3300005468|Ga0070707_101011685 | All Organisms → cellular organisms → Bacteria | 796 | Open in IMG/M |
| 3300005471|Ga0070698_100321597 | All Organisms → cellular organisms → Bacteria | 1478 | Open in IMG/M |
| 3300005529|Ga0070741_10008551 | All Organisms → cellular organisms → Bacteria | 20452 | Open in IMG/M |
| 3300005540|Ga0066697_10075038 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1946 | Open in IMG/M |
| 3300005540|Ga0066697_10094107 | All Organisms → cellular organisms → Bacteria | 1741 | Open in IMG/M |
| 3300005546|Ga0070696_100257878 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1321 | Open in IMG/M |
| 3300005549|Ga0070704_100228173 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1518 | Open in IMG/M |
| 3300005558|Ga0066698_10065741 | All Organisms → cellular organisms → Bacteria | 2327 | Open in IMG/M |
| 3300005559|Ga0066700_10286334 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1159 | Open in IMG/M |
| 3300005559|Ga0066700_10291325 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1149 | Open in IMG/M |
| 3300005561|Ga0066699_10187283 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1435 | Open in IMG/M |
| 3300005563|Ga0068855_102177200 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 557 | Open in IMG/M |
| 3300005564|Ga0070664_101081194 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 755 | Open in IMG/M |
| 3300005568|Ga0066703_10789850 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
| 3300005569|Ga0066705_10775688 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
| 3300005578|Ga0068854_101882810 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 550 | Open in IMG/M |
| 3300005719|Ga0068861_101234437 | All Organisms → cellular organisms → Bacteria | 724 | Open in IMG/M |
| 3300005841|Ga0068863_100547748 | All Organisms → cellular organisms → Bacteria | 1142 | Open in IMG/M |
| 3300005844|Ga0068862_101942630 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
| 3300006031|Ga0066651_10084927 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1564 | Open in IMG/M |
| 3300006049|Ga0075417_10001112 | All Organisms → cellular organisms → Bacteria | 7075 | Open in IMG/M |
| 3300006049|Ga0075417_10287125 | All Organisms → cellular organisms → Bacteria | 796 | Open in IMG/M |
| 3300006796|Ga0066665_10285740 | All Organisms → cellular organisms → Bacteria | 1320 | Open in IMG/M |
| 3300006845|Ga0075421_100820403 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1069 | Open in IMG/M |
| 3300006852|Ga0075433_10022551 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 5285 | Open in IMG/M |
| 3300006852|Ga0075433_10098852 | All Organisms → cellular organisms → Bacteria | 2583 | Open in IMG/M |
| 3300006852|Ga0075433_10182560 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1867 | Open in IMG/M |
| 3300006852|Ga0075433_11027234 | All Organisms → cellular organisms → Bacteria | 718 | Open in IMG/M |
| 3300006854|Ga0075425_100524905 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1363 | Open in IMG/M |
| 3300006854|Ga0075425_102846232 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 532 | Open in IMG/M |
| 3300006876|Ga0079217_10070399 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_40CM_4_68_4 | 1478 | Open in IMG/M |
| 3300006876|Ga0079217_10192030 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1034 | Open in IMG/M |
| 3300006894|Ga0079215_10130800 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1164 | Open in IMG/M |
| 3300006894|Ga0079215_10691435 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 687 | Open in IMG/M |
| 3300006918|Ga0079216_11391233 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
| 3300007004|Ga0079218_10967068 | All Organisms → cellular organisms → Bacteria | 847 | Open in IMG/M |
| 3300007004|Ga0079218_11126397 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 804 | Open in IMG/M |
| 3300007004|Ga0079218_13666633 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
| 3300007076|Ga0075435_101172658 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 672 | Open in IMG/M |
| 3300007255|Ga0099791_10002823 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 7050 | Open in IMG/M |
| 3300007255|Ga0099791_10352457 | All Organisms → cellular organisms → Bacteria | 705 | Open in IMG/M |
| 3300007265|Ga0099794_10137670 | All Organisms → cellular organisms → Bacteria | 1235 | Open in IMG/M |
| 3300007265|Ga0099794_10543353 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
| 3300009012|Ga0066710_100050353 | All Organisms → cellular organisms → Bacteria | 5144 | Open in IMG/M |
| 3300009012|Ga0066710_100442419 | All Organisms → cellular organisms → Bacteria | 1947 | Open in IMG/M |
| 3300009012|Ga0066710_102862548 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 679 | Open in IMG/M |
| 3300009038|Ga0099829_11295083 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 603 | Open in IMG/M |
| 3300009089|Ga0099828_10011014 | All Organisms → cellular organisms → Bacteria | 6745 | Open in IMG/M |
| 3300009090|Ga0099827_10062086 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 2854 | Open in IMG/M |
| 3300009094|Ga0111539_11147609 | All Organisms → cellular organisms → Bacteria | 903 | Open in IMG/M |
| 3300009137|Ga0066709_100196053 | All Organisms → cellular organisms → Bacteria | 2647 | Open in IMG/M |
| 3300009137|Ga0066709_100498121 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1715 | Open in IMG/M |
| 3300009147|Ga0114129_10003872 | All Organisms → cellular organisms → Bacteria | 21107 | Open in IMG/M |
| 3300009147|Ga0114129_10985530 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1062 | Open in IMG/M |
| 3300009148|Ga0105243_12540354 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
| 3300009171|Ga0105101_10577926 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
| 3300009174|Ga0105241_11657244 | All Organisms → cellular organisms → Bacteria | 620 | Open in IMG/M |
| 3300009176|Ga0105242_10397991 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1284 | Open in IMG/M |
| 3300009799|Ga0105075_1023287 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 665 | Open in IMG/M |
| 3300010039|Ga0126309_10920324 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 581 | Open in IMG/M |
| 3300010301|Ga0134070_10236752 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 679 | Open in IMG/M |
| 3300010329|Ga0134111_10032096 | All Organisms → cellular organisms → Bacteria | 1837 | Open in IMG/M |
| 3300010333|Ga0134080_10367880 | All Organisms → cellular organisms → Bacteria | 658 | Open in IMG/M |
| 3300010362|Ga0126377_11283721 | All Organisms → cellular organisms → Bacteria | 804 | Open in IMG/M |
| 3300010399|Ga0134127_10379061 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1391 | Open in IMG/M |
| 3300010399|Ga0134127_10657500 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1083 | Open in IMG/M |
| 3300010403|Ga0134123_10205560 | All Organisms → cellular organisms → Bacteria | 1679 | Open in IMG/M |
| 3300011270|Ga0137391_10294069 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1402 | Open in IMG/M |
| 3300012003|Ga0120163_1133176 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 525 | Open in IMG/M |
| 3300012096|Ga0137389_10030578 | All Organisms → cellular organisms → Bacteria | 3902 | Open in IMG/M |
| 3300012199|Ga0137383_10021752 | All Organisms → cellular organisms → Bacteria | 4445 | Open in IMG/M |
| 3300012200|Ga0137382_10015384 | All Organisms → cellular organisms → Bacteria | 4242 | Open in IMG/M |
| 3300012203|Ga0137399_10514044 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1005 | Open in IMG/M |
| 3300012203|Ga0137399_10778089 | All Organisms → cellular organisms → Bacteria | 806 | Open in IMG/M |
| 3300012204|Ga0137374_10000424 | All Organisms → cellular organisms → Bacteria | 42490 | Open in IMG/M |
| 3300012204|Ga0137374_10072067 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 3396 | Open in IMG/M |
| 3300012204|Ga0137374_10854020 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 671 | Open in IMG/M |
| 3300012206|Ga0137380_10438796 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1156 | Open in IMG/M |
| 3300012206|Ga0137380_11545624 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300012208|Ga0137376_11510626 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
| 3300012210|Ga0137378_10519842 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1098 | Open in IMG/M |
| 3300012210|Ga0137378_10620178 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 992 | Open in IMG/M |
| 3300012285|Ga0137370_10721689 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 619 | Open in IMG/M |
| 3300012353|Ga0137367_10308758 | All Organisms → cellular organisms → Bacteria | 1131 | Open in IMG/M |
| 3300012355|Ga0137369_10169899 | All Organisms → cellular organisms → Bacteria | 1714 | Open in IMG/M |
| 3300012356|Ga0137371_11036538 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 620 | Open in IMG/M |
| 3300012358|Ga0137368_10681819 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
| 3300012360|Ga0137375_10105645 | All Organisms → cellular organisms → Bacteria | 2855 | Open in IMG/M |
| 3300012360|Ga0137375_10115882 | All Organisms → cellular organisms → Bacteria | 2690 | Open in IMG/M |
| 3300012360|Ga0137375_10143058 | All Organisms → cellular organisms → Bacteria | 2350 | Open in IMG/M |
| 3300012363|Ga0137390_10909072 | All Organisms → cellular organisms → Bacteria | 835 | Open in IMG/M |
| 3300012363|Ga0137390_11946815 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 515 | Open in IMG/M |
| 3300012532|Ga0137373_10071265 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 3135 | Open in IMG/M |
| 3300012532|Ga0137373_10982456 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 613 | Open in IMG/M |
| 3300012685|Ga0137397_10012182 | All Organisms → cellular organisms → Bacteria | 6012 | Open in IMG/M |
| 3300012685|Ga0137397_10043372 | All Organisms → cellular organisms → Bacteria | 3217 | Open in IMG/M |
| 3300012685|Ga0137397_10374187 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1061 | Open in IMG/M |
| 3300012918|Ga0137396_10209964 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1432 | Open in IMG/M |
| 3300012918|Ga0137396_10472074 | All Organisms → cellular organisms → Bacteria | 930 | Open in IMG/M |
| 3300012918|Ga0137396_10616125 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 803 | Open in IMG/M |
| 3300012922|Ga0137394_10078316 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 2763 | Open in IMG/M |
| 3300012922|Ga0137394_10873795 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 751 | Open in IMG/M |
| 3300012922|Ga0137394_11455868 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 545 | Open in IMG/M |
| 3300012931|Ga0153915_13055435 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 545 | Open in IMG/M |
| 3300014150|Ga0134081_10231578 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 639 | Open in IMG/M |
| 3300014154|Ga0134075_10081227 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1360 | Open in IMG/M |
| 3300014745|Ga0157377_10123407 | All Organisms → cellular organisms → Bacteria | 1573 | Open in IMG/M |
| 3300015076|Ga0167656_1005140 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1619 | Open in IMG/M |
| 3300015241|Ga0137418_10659260 | All Organisms → cellular organisms → Bacteria | 811 | Open in IMG/M |
| 3300015248|Ga0180079_1018399 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 850 | Open in IMG/M |
| 3300015358|Ga0134089_10276068 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 693 | Open in IMG/M |
| 3300015359|Ga0134085_10609164 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 508 | Open in IMG/M |
| 3300015371|Ga0132258_10088781 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 7240 | Open in IMG/M |
| 3300015371|Ga0132258_11587278 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1652 | Open in IMG/M |
| 3300015371|Ga0132258_13063631 | All Organisms → cellular organisms → Bacteria | 1157 | Open in IMG/M |
| 3300015372|Ga0132256_101902445 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 702 | Open in IMG/M |
| 3300015372|Ga0132256_103741623 | Not Available | 512 | Open in IMG/M |
| 3300015373|Ga0132257_102056711 | All Organisms → cellular organisms → Bacteria | 737 | Open in IMG/M |
| 3300015374|Ga0132255_105283962 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 547 | Open in IMG/M |
| 3300017997|Ga0184610_1183518 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 695 | Open in IMG/M |
| 3300018000|Ga0184604_10004399 | All Organisms → cellular organisms → Bacteria | 2508 | Open in IMG/M |
| 3300018000|Ga0184604_10077976 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 983 | Open in IMG/M |
| 3300018027|Ga0184605_10014710 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 3059 | Open in IMG/M |
| 3300018027|Ga0184605_10033087 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 2142 | Open in IMG/M |
| 3300018028|Ga0184608_10000205 | All Organisms → cellular organisms → Bacteria | 14661 | Open in IMG/M |
| 3300018028|Ga0184608_10061534 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1504 | Open in IMG/M |
| 3300018031|Ga0184634_10300989 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 736 | Open in IMG/M |
| 3300018052|Ga0184638_1151364 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 837 | Open in IMG/M |
| 3300018056|Ga0184623_10047610 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1954 | Open in IMG/M |
| 3300018056|Ga0184623_10259078 | All Organisms → cellular organisms → Bacteria | 792 | Open in IMG/M |
| 3300018061|Ga0184619_10542255 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 510 | Open in IMG/M |
| 3300018071|Ga0184618_10051252 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1501 | Open in IMG/M |
| 3300018074|Ga0184640_10058040 | All Organisms → cellular organisms → Bacteria | 1616 | Open in IMG/M |
| 3300018075|Ga0184632_10031301 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 2272 | Open in IMG/M |
| 3300018076|Ga0184609_10308533 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 740 | Open in IMG/M |
| 3300018431|Ga0066655_10104413 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1595 | Open in IMG/M |
| 3300018431|Ga0066655_11451463 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300018433|Ga0066667_11179083 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 665 | Open in IMG/M |
| 3300018468|Ga0066662_10226140 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1505 | Open in IMG/M |
| 3300018482|Ga0066669_10004616 | All Organisms → cellular organisms → Bacteria | 6213 | Open in IMG/M |
| 3300019255|Ga0184643_1283677 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
| 3300019878|Ga0193715_1090397 | All Organisms → cellular organisms → Bacteria | 626 | Open in IMG/M |
| 3300020003|Ga0193739_1008996 | All Organisms → cellular organisms → Bacteria | 2641 | Open in IMG/M |
| 3300021073|Ga0210378_10181672 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 807 | Open in IMG/M |
| 3300021078|Ga0210381_10307890 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 573 | Open in IMG/M |
| 3300021080|Ga0210382_10024065 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 2231 | Open in IMG/M |
| 3300021080|Ga0210382_10039820 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1809 | Open in IMG/M |
| 3300021080|Ga0210382_10524960 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 524 | Open in IMG/M |
| 3300021344|Ga0193719_10156351 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 983 | Open in IMG/M |
| 3300022534|Ga0224452_1010989 | All Organisms → cellular organisms → Bacteria | 2371 | Open in IMG/M |
| 3300025901|Ga0207688_10650182 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 666 | Open in IMG/M |
| 3300025904|Ga0207647_10630376 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
| 3300025908|Ga0207643_10047598 | All Organisms → cellular organisms → Bacteria | 2427 | Open in IMG/M |
| 3300025910|Ga0207684_10000024 | All Organisms → cellular organisms → Bacteria | 322180 | Open in IMG/M |
| 3300025911|Ga0207654_11229484 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
| 3300025912|Ga0207707_10517206 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1017 | Open in IMG/M |
| 3300025917|Ga0207660_10707542 | All Organisms → cellular organisms → Bacteria | 822 | Open in IMG/M |
| 3300025918|Ga0207662_10205914 | All Organisms → cellular organisms → Bacteria | 1275 | Open in IMG/M |
| 3300025918|Ga0207662_10300511 | Not Available | 1067 | Open in IMG/M |
| 3300025921|Ga0207652_10486481 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1111 | Open in IMG/M |
| 3300025921|Ga0207652_11679323 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
| 3300025923|Ga0207681_11339664 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
| 3300025935|Ga0207709_10372000 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1085 | Open in IMG/M |
| 3300025935|Ga0207709_10747223 | All Organisms → cellular organisms → Bacteria | 786 | Open in IMG/M |
| 3300025935|Ga0207709_11051958 | All Organisms → cellular organisms → Bacteria | 667 | Open in IMG/M |
| 3300025940|Ga0207691_11104095 | All Organisms → cellular organisms → Bacteria | 660 | Open in IMG/M |
| 3300025942|Ga0207689_10758829 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 819 | Open in IMG/M |
| 3300025960|Ga0207651_11287025 | All Organisms → cellular organisms → Bacteria | 657 | Open in IMG/M |
| 3300025961|Ga0207712_10736431 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 863 | Open in IMG/M |
| 3300025981|Ga0207640_11431606 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 620 | Open in IMG/M |
| 3300026023|Ga0207677_10251506 | All Organisms → cellular organisms → Bacteria | 1435 | Open in IMG/M |
| 3300026075|Ga0207708_11359011 | All Organisms → cellular organisms → Bacteria | 623 | Open in IMG/M |
| 3300026307|Ga0209469_1095980 | All Organisms → cellular organisms → Bacteria | 837 | Open in IMG/M |
| 3300026320|Ga0209131_1017331 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4378 | Open in IMG/M |
| 3300026324|Ga0209470_1003582 | All Organisms → cellular organisms → Bacteria | 10642 | Open in IMG/M |
| 3300026342|Ga0209057_1196317 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
| 3300027181|Ga0208997_1040761 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 685 | Open in IMG/M |
| 3300027388|Ga0208995_1096815 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 513 | Open in IMG/M |
| 3300027462|Ga0210000_1081094 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 532 | Open in IMG/M |
| 3300027633|Ga0208988_1017874 | All Organisms → cellular organisms → Bacteria | 1809 | Open in IMG/M |
| 3300027645|Ga0209117_1005388 | All Organisms → cellular organisms → Bacteria | 4387 | Open in IMG/M |
| 3300027645|Ga0209117_1045650 | All Organisms → cellular organisms → Bacteria | 1313 | Open in IMG/M |
| 3300027655|Ga0209388_1036449 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1414 | Open in IMG/M |
| 3300027669|Ga0208981_1113701 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 691 | Open in IMG/M |
| 3300027678|Ga0209011_1186865 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 570 | Open in IMG/M |
| 3300027835|Ga0209515_10280517 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 942 | Open in IMG/M |
| 3300027862|Ga0209701_10430839 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 729 | Open in IMG/M |
| 3300027873|Ga0209814_10003808 | All Organisms → cellular organisms → Bacteria | 5656 | Open in IMG/M |
| 3300027873|Ga0209814_10110591 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1169 | Open in IMG/M |
| 3300027873|Ga0209814_10118115 | All Organisms → cellular organisms → Bacteria | 1130 | Open in IMG/M |
| 3300027875|Ga0209283_10039940 | All Organisms → cellular organisms → Bacteria | 2956 | Open in IMG/M |
| 3300027875|Ga0209283_10080508 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 2109 | Open in IMG/M |
| 3300027882|Ga0209590_10066425 | All Organisms → cellular organisms → Bacteria | 2062 | Open in IMG/M |
| 3300027886|Ga0209486_10065721 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1851 | Open in IMG/M |
| 3300027886|Ga0209486_10574089 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 711 | Open in IMG/M |
| 3300027909|Ga0209382_11722745 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 614 | Open in IMG/M |
| 3300028705|Ga0307276_10020066 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1302 | Open in IMG/M |
| 3300028811|Ga0307292_10458826 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 545 | Open in IMG/M |
| 3300028814|Ga0307302_10033923 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 2353 | Open in IMG/M |
| 3300028819|Ga0307296_10031532 | All Organisms → cellular organisms → Bacteria | 2796 | Open in IMG/M |
| 3300028819|Ga0307296_10374867 | All Organisms → cellular organisms → Bacteria | 777 | Open in IMG/M |
| 3300028819|Ga0307296_10717147 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 546 | Open in IMG/M |
| 3300028819|Ga0307296_10744583 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 535 | Open in IMG/M |
| 3300028828|Ga0307312_10284225 | All Organisms → cellular organisms → Bacteria | 1076 | Open in IMG/M |
| 3300028878|Ga0307278_10430371 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 579 | Open in IMG/M |
| 3300028884|Ga0307308_10044230 | All Organisms → cellular organisms → Bacteria | 2089 | Open in IMG/M |
| 3300031720|Ga0307469_10732648 | All Organisms → cellular organisms → Bacteria | 900 | Open in IMG/M |
| 3300031740|Ga0307468_102099570 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 544 | Open in IMG/M |
| 3300031965|Ga0326597_10013177 | All Organisms → cellular organisms → Bacteria | 10875 | Open in IMG/M |
| 3300031965|Ga0326597_10522953 | All Organisms → cellular organisms → Bacteria | 1287 | Open in IMG/M |
| 3300031965|Ga0326597_11008945 | All Organisms → cellular organisms → Bacteria | 840 | Open in IMG/M |
| 3300031965|Ga0326597_11834683 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 567 | Open in IMG/M |
| 3300032180|Ga0307471_103326753 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 570 | Open in IMG/M |
| 3300032180|Ga0307471_103663467 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
| 3300032180|Ga0307471_104317447 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 502 | Open in IMG/M |
| 3300032205|Ga0307472_100231582 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1433 | Open in IMG/M |
| 3300032421|Ga0310812_10304112 | All Organisms → cellular organisms → Bacteria | 709 | Open in IMG/M |
| 3300033233|Ga0334722_10078305 | All Organisms → cellular organisms → Bacteria | 2541 | Open in IMG/M |
| 3300033407|Ga0214472_10949903 | All Organisms → cellular organisms → Bacteria | 764 | Open in IMG/M |
| 3300033412|Ga0310810_10441009 | All Organisms → cellular organisms → Bacteria | 1324 | Open in IMG/M |
| 3300033513|Ga0316628_100118342 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 3022 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 18.46% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 8.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 7.31% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 6.54% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 6.15% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 4.23% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 3.85% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.85% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 3.46% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.08% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.69% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 2.31% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.31% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 2.31% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.31% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.92% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.92% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.54% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.54% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.54% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.15% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.15% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.15% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.77% |
| Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 0.77% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.77% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.77% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.38% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.38% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.38% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater | 0.38% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.38% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.38% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.38% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.38% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.38% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.38% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.38% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.38% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.38% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.38% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.38% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.38% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.38% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.38% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.38% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000033 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
| 3300003319 | Sugarcane bulk soil Sample L2 | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
| 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
| 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Environmental | Open in IMG/M |
| 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
| 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
| 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006876 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 | Environmental | Open in IMG/M |
| 3300006894 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control | Environmental | Open in IMG/M |
| 3300006918 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 | Environmental | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009171 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009799 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_0_30 | Environmental | Open in IMG/M |
| 3300010039 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56 | Environmental | Open in IMG/M |
| 3300010301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012003 | Permafrost microbial communities from Nunavut, Canada - A20_80cm_0.25M | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012358 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
| 3300014150 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300015076 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-6a, vegetation/snow interface) | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015248 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT530_16_10D | Environmental | Open in IMG/M |
| 3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015359 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015 | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300017997 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coex | Environmental | Open in IMG/M |
| 3300018000 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_coex | Environmental | Open in IMG/M |
| 3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
| 3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
| 3300018031 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1 | Environmental | Open in IMG/M |
| 3300018052 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2 | Environmental | Open in IMG/M |
| 3300018056 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1 | Environmental | Open in IMG/M |
| 3300018061 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1 | Environmental | Open in IMG/M |
| 3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
| 3300018074 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2 | Environmental | Open in IMG/M |
| 3300018075 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1 | Environmental | Open in IMG/M |
| 3300018076 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019255 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019878 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2m2 | Environmental | Open in IMG/M |
| 3300020003 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2a2 | Environmental | Open in IMG/M |
| 3300021073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redo | Environmental | Open in IMG/M |
| 3300021078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_coex redo | Environmental | Open in IMG/M |
| 3300021080 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redo | Environmental | Open in IMG/M |
| 3300021344 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2 | Environmental | Open in IMG/M |
| 3300022534 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_b1 | Environmental | Open in IMG/M |
| 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026307 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 (SPAdes) | Environmental | Open in IMG/M |
| 3300026320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026324 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes) | Environmental | Open in IMG/M |
| 3300026342 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 (SPAdes) | Environmental | Open in IMG/M |
| 3300027181 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027388 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027633 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027645 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027655 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027669 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027678 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027835 | Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW60B uncontaminated upgradient, 5.4 m (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027886 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes) | Environmental | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028705 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_115 | Environmental | Open in IMG/M |
| 3300028811 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149 | Environmental | Open in IMG/M |
| 3300028814 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183 | Environmental | Open in IMG/M |
| 3300028819 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153 | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
| 3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031965 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032421 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NN3 | Environmental | Open in IMG/M |
| 3300033233 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_bottom | Environmental | Open in IMG/M |
| 3300033407 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT140D175 | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| 3300033513 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_C | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| ICChiseqgaiiDRAFT_23112762 | 3300000033 | Soil | VTLLSVLAHGATGTWLDEILEFGLPLXILIVLYVWSSRKPKQKPKSK* |
| JGI10216J12902_1062724872 | 3300000956 | Soil | VTILSVMPHGATGTWLDEIVEFGLPLLILIVLYFWSARKPKEKSK* |
| JGI10216J12902_1076449372 | 3300000956 | Soil | MHFSVLPHGATGTWLDEILEFGLPLIILIVLYVWSSRKPKEKQKTK* |
| JGI10216J12902_1124548882 | 3300000956 | Soil | MVVAHGAGGWLDEIIELGIPLVVLVFLYLWSNRKAKKPDKK* |
| JGI12053J15887_100661423 | 3300001661 | Forest Soil | VTLLSVLAHGATGTWLDEILEFGLPLVILIVLYVWSSRKPKAKQKIK* |
| soilL2_100073233 | 3300003319 | Sugarcane Root And Bulk Soil | MSFLMVVAHGASGWLDEVIELGLPLLVLVGLYIWSNRKPKDKTK* |
| soilL2_102189482 | 3300003319 | Sugarcane Root And Bulk Soil | VTFFTVLAHGSSGWLDEVIELGIPLVVLAGLYIWSNRKQEKKPK* |
| Ga0062590_1010585121 | 3300004157 | Soil | MTFLMVVAHGATGWLDEFIELGLPLIILAGLYFWSNRKPAKKDEKGKPK* |
| Ga0062590_1011442451 | 3300004157 | Soil | RRRQRCVRPRSEQVTLLSVLAHGATGTWLDEIFEFGLPLIILIVLYVWSSRKPKEKQKSK |
| Ga0063356_1000591485 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MPHGATGTWLDEIIEFGLPLLILIVLYVWSARKPKEKRK* |
| Ga0063356_1004698672 | 3300004463 | Arabidopsis Thaliana Rhizosphere | VTLLSVLPHGATGTWLDEILEFGLPLVILIALYVWSSRKPKQKPKSK* |
| Ga0063356_1014909732 | 3300004463 | Arabidopsis Thaliana Rhizosphere | VTLLSVLAHGATGTWLDEIFEFGLPLIILIVLYLWSSRKPKEKQKHK* |
| Ga0063356_1020549653 | 3300004463 | Arabidopsis Thaliana Rhizosphere | HGATGTWLDEIIEFGLPLLILIVLYVWSARKPKEKEKSK* |
| Ga0063356_1044059271 | 3300004463 | Arabidopsis Thaliana Rhizosphere | VTLLSVLAHGATGTWLDEIFEFGLPLIILIVLYVWSSRKPKEKQKSK* |
| Ga0062592_1012283892 | 3300004480 | Soil | VTILTVMPHGATGTWLDEIIEFGLPLLILVGLYVWSARKPKEKSK* |
| Ga0062592_1016615122 | 3300004480 | Soil | VTLLSVLAHGATGTWLDEIFEFGLPLIILIVLYVWSSRKPKERPKSK* |
| Ga0066674_101574042 | 3300005166 | Soil | MVVAHGAGGWLDEIIELGIPLVVLVFLYLWSNRKAKKPEKK* |
| Ga0066683_101047862 | 3300005172 | Soil | VTLISVLPHGVTGTWLDEILEFGLPLVILIVLYVWSSRKPKPKEKSK* |
| Ga0066690_106326302 | 3300005177 | Soil | VTLLSVVAHGATGTWLDEILEFGLPLVILVILYIWSSRKPKEKQKSK* |
| Ga0066685_100236352 | 3300005180 | Soil | VTLLSVLPHGATGTWLDEILEFGLPLVILIVLYMWSSRKPKAKEKSK* |
| Ga0066678_101833893 | 3300005181 | Soil | ERRRQRHVRPRRHAVTLLSVLPHGVTGTWLDEILEFGLPLVILIVLYVWSSRKPKPKEKSK* |
| Ga0065705_104369992 | 3300005294 | Switchgrass Rhizosphere | VTLLSVLPHGATGTWLDEIFEFGLPLIILIVLYMWSSRKPKEKPKSK* |
| Ga0065707_102358173 | 3300005295 | Switchgrass Rhizosphere | HGATGTWLDEIFEFGLPLIILIVLYMWSSRKPKEKPKSK* |
| Ga0070680_1001259462 | 3300005336 | Corn Rhizosphere | VTLLSVLPHGATGTWLDEIFEFGLPLIILIVLYMWSSRKPKEKQKSK* |
| Ga0070680_1001864863 | 3300005336 | Corn Rhizosphere | VTLLSVLAHGATGTWLDEIFEFGLPLIILIVLYVWSSRKPKEKQRSK* |
| Ga0070680_1014068692 | 3300005336 | Corn Rhizosphere | MTFLMVVAHGATGLLDEFIELGLPLIILAGLYFWSNRKPAKKDEKGKPK* |
| Ga0070680_1014402702 | 3300005336 | Corn Rhizosphere | PHGATGTWLDEIIEFGLPLLILIALYVWSARKPKAKEKSK* |
| Ga0068868_1007645322 | 3300005338 | Miscanthus Rhizosphere | MTLLMVVAHGATGWLDEFIELGLPLIILAGLYFWSNRKPAKKDEKGKPK* |
| Ga0068868_1008658132 | 3300005338 | Miscanthus Rhizosphere | VTLLSVLAHGATGTWLDEIFEFGLPLIILIVLYMWSSRKPKEKQKSK* |
| Ga0070687_1001275522 | 3300005343 | Switchgrass Rhizosphere | MTFLMVVAHGATGWLDEFIELGLPLIILAGLYFWSNRKPAKKD |
| Ga0070687_1009427601 | 3300005343 | Switchgrass Rhizosphere | AHGATGTWLDEIFEFGLPLIILIVLYVWSSRKPKEKQKSK* |
| Ga0070669_1017166262 | 3300005353 | Switchgrass Rhizosphere | PHGATGTWLDEILEFGLPLIILIVLYVWSSRKPKVKQKDK* |
| Ga0070703_102103571 | 3300005406 | Corn, Switchgrass And Miscanthus Rhizosphere | LAHGATGTWLDEIFEFGLPLIILIVLYVWSSRKPKEKQKSK* |
| Ga0070705_1013436521 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | VGHYRRVHLSVLPHGATGTWLDEILEFGLPLIILIVLYVWSSRKPKVKQKDK* |
| Ga0070694_1002237432 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | VTLLSVTAHGATGTWLDEIFEFGLPLIILIVLYVWSSRKPKEKHKTK* |
| Ga0070708_1000444212 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MSFLAIVAHGATGTWLDEFIELGLPLIILVALYFWTGRKQKRKEKPGK* |
| Ga0066682_100353412 | 3300005450 | Soil | VTLLSVLPHGVTGTWLDEILEFGLPLVILIVLYVWSSRKPKPKEKSK* |
| Ga0070681_106063843 | 3300005458 | Corn Rhizosphere | CGRDRGVYARCGPMTFLMVVAHGATGLLDEFIELGLPLIILAGLYFWSNRKPAKKDEKGKPK* |
| Ga0068867_1005703241 | 3300005459 | Miscanthus Rhizosphere | VTLLSALPHGATGTWLDEIFEFGLPLIILIVLYMWSSRKPKEKQKSK* |
| Ga0070707_1010116852 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | VTLLSVLPHGATGTWIDEIFEFGLPLLILIVLYVWSSRKPKEKQKSK* |
| Ga0070698_1003215973 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MHFSVLPHGATGTWLDEILEFGLPLIILIVLYVWSSRKPKQKQKSK* |
| Ga0070741_100085516 | 3300005529 | Surface Soil | MRLSSVLAHGGTGPLDEFIELGLPLIILIALYVWSNRKPKAKP* |
| Ga0066697_100750382 | 3300005540 | Soil | VTLLSVLPHGVTGTWVDEILEFGLLLVILIVLYVWSSRKPKPKEKSK* |
| Ga0066697_100941072 | 3300005540 | Soil | VTFVMVVAHGAGGWLDEIIELGIPLVVLVFLYLWSNRKAKKPEKK* |
| Ga0070696_1002578781 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | MTLLSMQAHGATGTWLDEIIEFGLPLLILIGLYVWSARKPKAKEKSK* |
| Ga0070704_1002281732 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | VTILSVLPHGATGTWLDEIIEFGLPLLILIALYVWSARKPKAKEKSK* |
| Ga0066698_100657413 | 3300005558 | Soil | MAHGATGTWLDEILEFGLPLVILIILYIWSSRKPKAKEKSK* |
| Ga0066700_102863342 | 3300005559 | Soil | VTLLSVVAHGATGTWLDEILEFGLPLLILVILYIWSSRKPKEKQKSK* |
| Ga0066700_102913252 | 3300005559 | Soil | VTLLSVLPHGATGTWLDEILEFGLPLVILIVLYVWSSRKPKPKEKSK* |
| Ga0066699_101872833 | 3300005561 | Soil | MNFLAVVAHGATGTWLDEFIELGIPLIVLVGLYFWSNRKPAKPKDDKDTK* |
| Ga0068855_1021772002 | 3300005563 | Corn Rhizosphere | MTFLMVVAHGATGWLDEFIELGLPLIILAGLYFWSNRKPAKKDERGKPK* |
| Ga0070664_1010811942 | 3300005564 | Corn Rhizosphere | MTLFMVVAHGATGWLDEFIELGLPLIILAGLYFWSNRKPAKKDEKGKPK* |
| Ga0066703_107898502 | 3300005568 | Soil | HGATGTWLDEILEFGLPLVILIVLYVWSSRKPKPKEKSK* |
| Ga0066705_107756882 | 3300005569 | Soil | VRPRRHAVTPLSVLPHGVTGTWVDEILEFGLPLVILIVLYVWSSRKPKPKEKSK* |
| Ga0068854_1018828102 | 3300005578 | Corn Rhizosphere | MTFLMVVAHGATGTWLDEFIELGLPLIILAGLYFWSNR |
| Ga0068861_1012344372 | 3300005719 | Switchgrass Rhizosphere | VYARCGPMTFLMVVAHGATGLLDEFIELGLPLIILAGLYFWSNRKPAKKDEKGKPK* |
| Ga0068863_1005477482 | 3300005841 | Switchgrass Rhizosphere | VGHYRSVHLSVLPHGATGTWLDEILEFGLPLIILIVLYVWSSRKPKVKQKDK* |
| Ga0068862_1019426302 | 3300005844 | Switchgrass Rhizosphere | QRGVRPRREQVTLLSVLAHGATGTWLDEIFEFGLPLIILIVLYVWSSRKPKEKQKSK* |
| Ga0066651_100849271 | 3300006031 | Soil | QRHVRPRRHAVTLLSVLPHGVTGTWLDEILEFGLPLVILIVLYVWSSRKPKPKEKSK* |
| Ga0075417_100011126 | 3300006049 | Populus Rhizosphere | VTTLSILAHGATGWFDELISLGLPLVILIVLYVWSARKPKQKSK* |
| Ga0075417_102871252 | 3300006049 | Populus Rhizosphere | MRFSVLPHGATGTWLDEILEFGLPLIILIVLYLWSSRKPKEKQKTK* |
| Ga0066665_102857402 | 3300006796 | Soil | VTPLSVLPHGVTGTWVDEILEFGLPLVILIVLYVWSSRKPKPKEKSK* |
| Ga0075421_1008204032 | 3300006845 | Populus Rhizosphere | VIVLSTLPHGATGTWLDEIIEFGLPLVVLIVLYIWSSRKPKTKQK* |
| Ga0075433_100225513 | 3300006852 | Populus Rhizosphere | MTFVMVVAHGATGTWLDEIIELGIPLIVLVVLYVWSNRKAKPKEKPDK* |
| Ga0075433_100988524 | 3300006852 | Populus Rhizosphere | VTLLSVLPHGATGTWLDEILEFGIPLIVLIVLYVWSSRKPKTKQKSK* |
| Ga0075433_101825602 | 3300006852 | Populus Rhizosphere | MAVAHGATGTWLDEIIEFGLPLVVLVALYVWSNRKPKRKEKPK* |
| Ga0075433_110272342 | 3300006852 | Populus Rhizosphere | MTFLMVVAHGATGTWLDEIIEFGLPLVVLVGLYIWSNRKPKRKEKPK* |
| Ga0075425_1005249052 | 3300006854 | Populus Rhizosphere | MSFLAVVAHGATGTWLDEFVELGIPLIVLVGLYFWSNRKPKPKDEKGKPK* |
| Ga0075425_1028462321 | 3300006854 | Populus Rhizosphere | MSFVMVVAHGATGPLDEFVELGLPLLILIGLYFWSNRKPKPKEEKDK |
| Ga0079217_100703992 | 3300006876 | Agricultural Soil | MTILSVLAHGATGWLDELISLGLPLVVLVVLYVWSSRKPKEKRK* |
| Ga0079217_101920302 | 3300006876 | Agricultural Soil | VTILSVLAHGSTGWFDEVISLGLPLVILVVLYVWSSRKPKQKSK* |
| Ga0079215_101308002 | 3300006894 | Agricultural Soil | VTILSVLAHGSTGWFDELISLGLPLVILAVLYVWSSRKPKQKSK* |
| Ga0079215_106914352 | 3300006894 | Agricultural Soil | VSLSVLPHGATGTWLDEIIEFGLPLLILIVLYVWSSRKPKAKSK* |
| Ga0079216_113912332 | 3300006918 | Agricultural Soil | MTILSVLAHGATGWLDELISFGVPLVILIVLYVWSSRRPKEKSK* |
| Ga0079218_109670682 | 3300007004 | Agricultural Soil | VNVLSVLPHGATGTWLDEIIEFGLPLLILVGLYVWSARKPKAKSK* |
| Ga0079218_111263973 | 3300007004 | Agricultural Soil | RRGQRRVRARRDQVTILSVLAHGSTGWFDEVISLGLPLVILVVLYVWSSRKPKQKSK* |
| Ga0079218_136666332 | 3300007004 | Agricultural Soil | SVLAHGATGWLDELISLGLPLVILVVLYVWSSRKPKQKSK* |
| Ga0075435_1011726582 | 3300007076 | Populus Rhizosphere | MTFIMVVAHGSAGWLDEIIELGVPLVVLIALYIWSNRHPQEKKPK* |
| Ga0099791_100028237 | 3300007255 | Vadose Zone Soil | MPLSVLPHGATGTWLDEILEFGIPLIVLIVLYVWSSRKPKAKQKSK* |
| Ga0099791_103524572 | 3300007255 | Vadose Zone Soil | MSFLAVVAHGATGTWLDEFIELGIPLIVLVALYLWSNRKPKEKQK* |
| Ga0099794_101376702 | 3300007265 | Vadose Zone Soil | MSFLAVLAHGATGTWLDELIELGLPLIILVVLYFWSNRKEKQKEKPGK* |
| Ga0099794_105433532 | 3300007265 | Vadose Zone Soil | VTLLSVLPHGATGTWLDEILEFGLPLVILIVLYIWSSRKPKTKEKSK* |
| Ga0066710_1000503535 | 3300009012 | Grasslands Soil | VTLLSVVAHGATGTWLDEILEFGLPLVILIVLYIWSSRKPKAKQKSK |
| Ga0066710_1004424194 | 3300009012 | Grasslands Soil | SVLPHGVTGTWLDEILEFGLPLVILIVLYVWSSRKPKPKEKSK |
| Ga0066710_1028625482 | 3300009012 | Grasslands Soil | VTLLSVLPHGVTGTWLDEILEFGLPLVILIVLYVWSSRKPKPKE |
| Ga0099829_112950832 | 3300009038 | Vadose Zone Soil | MSFLAVVAHGATGTWLDEFIELGIPLIVLVGLYLWSNRKPKEKQK* |
| Ga0099828_100110145 | 3300009089 | Vadose Zone Soil | MSFLAVVAHGATGTWLDEFIELGVPLIVLVGLYLWSNRKPKEKQK* |
| Ga0099827_100620863 | 3300009090 | Vadose Zone Soil | VTLLSVLPHGATGTWLDEILEFGLPLVILIVLYVWSSRKPKTKEKSK* |
| Ga0111539_111476091 | 3300009094 | Populus Rhizosphere | GVGHYRSVHLSVLPHGATGTWLDEILEFGLPLIILIVLYVWSSRKPKVKQKDK* |
| Ga0066709_1001960534 | 3300009137 | Grasslands Soil | SVLPHGVTGTWLDEILEFGLPLVILIVLYVWSSRKPKPKEKSK* |
| Ga0066709_1004981211 | 3300009137 | Grasslands Soil | VTLLSVVAHGATGTWLDEILEFGLPLVILIVLYIWSSRKPKAKQKSK* |
| Ga0114129_100038722 | 3300009147 | Populus Rhizosphere | VTLLSVLPHGATGTWLDEILEFGIPLIVLIVLYIWSSRKPKAKEKSK* |
| Ga0114129_109855302 | 3300009147 | Populus Rhizosphere | VTILSVLPHGATGTWLDEILEFGIPLVVLIVLYLWSARKPKAKQKSK* |
| Ga0105243_125403541 | 3300009148 | Miscanthus Rhizosphere | PRREQVTLLSVLAHGATGTWLDEIFEFGLPLIILIVLYVWSSRKPKEKQKSK* |
| Ga0105101_105779262 | 3300009171 | Freshwater Sediment | VTILSVLPHGATGTWLDEIIEFGIPLLILIVLYVWSARKPKEKTK* |
| Ga0105241_116572442 | 3300009174 | Corn Rhizosphere | VRPRSGQVTLLSVLAHGATGTWLDEIFEFGLPLIILIVLYVWSSRKPKEKQKSK* |
| Ga0105242_103979912 | 3300009176 | Miscanthus Rhizosphere | VTLLSVLAHGATGTWLDEIFEFGLPLIILIVLYVWSSRKPKDKQKSK* |
| Ga0105075_10232872 | 3300009799 | Groundwater Sand | VTLLSVLPHGATGTWLDEIIEFGIPLVVLIFLYIWSSRKPKVKG |
| Ga0126309_109203242 | 3300010039 | Serpentine Soil | VTLQVLPHGATGTWLDEVIQFGLPLIILIALYVWSMRGPKEKRK* |
| Ga0134070_102367521 | 3300010301 | Grasslands Soil | VTLLSVLPHGATGTWLDEILEFGLPLVILIVLYVWSSRKPKTKEKK* |
| Ga0134111_100320961 | 3300010329 | Grasslands Soil | QRDLRPRRHEVTLLSVLPHAATGTWIDEILEFGLPLVILIVLYVWSSRKPKTKEKK* |
| Ga0134080_103678802 | 3300010333 | Grasslands Soil | VAHGATGTWLDEILEFGLPLVILIVLYIWSSRKPKAKQKSK* |
| Ga0126377_112837212 | 3300010362 | Tropical Forest Soil | VSFLAVVAHGVTGTWLDEFVELGIPLLVLVILYLWSNRKPKAKDKGGETK* |
| Ga0134127_103790612 | 3300010399 | Terrestrial Soil | MTFLLVAAHGGAGWLDEVVEIGLPLLVLTALYIWSNRKPKDKEKPK* |
| Ga0134127_106575002 | 3300010399 | Terrestrial Soil | MTFLMVAAHGASGWLDEVVEIGLPLLVLTALYIWSNRKPKDKEKPK* |
| Ga0134123_102055603 | 3300010403 | Terrestrial Soil | TLLSALPHGATGTWLDEIFEFGLPLIILIVLYMWSSRKPKEKQKSK* |
| Ga0137391_102940692 | 3300011270 | Vadose Zone Soil | MSFLSVVAHGATGTWLDEFIEFGLPLIILIGLYFWSNRKPKAKQK* |
| Ga0120163_11331762 | 3300012003 | Permafrost | MTFLMIVAHGATGTWLDEFIELGLPLIILVGLYFWSNRKPKKKEKPK* |
| Ga0137389_100305782 | 3300012096 | Vadose Zone Soil | MLLSVLPHGATGTWLDEILEFGIPLIVLIVLYVWSSRKPKTKQKSK* |
| Ga0137383_100217525 | 3300012199 | Vadose Zone Soil | VTLISVLPHGVTGTWLDEILEFGLPLAILIVLYVWSSRKPKPKEKSK* |
| Ga0137382_100153842 | 3300012200 | Vadose Zone Soil | VTLLSVLPHGVTGTWLDEILEFGLPLVILIVVYVWSSRKPKPKEKSK* |
| Ga0137399_105140442 | 3300012203 | Vadose Zone Soil | MSFLAVVAHGATGTWLDEFIELGIPLIVLVALYFWSNRKPKEKQK* |
| Ga0137399_107780892 | 3300012203 | Vadose Zone Soil | VTILSMLAHGATGTWLDEILEFGLPLVILIVLYVWSSRKPKAKQKSK* |
| Ga0137374_1000042439 | 3300012204 | Vadose Zone Soil | MTLLAMLPHGATGTWLDELIEFGLPLIVLVVLYFWSSRHPPEKKQK* |
| Ga0137374_100720672 | 3300012204 | Vadose Zone Soil | MTVLSLLPHGATGTWLDEILEFGLPLIVLIVLYVWSSRKPKEKPKSK* |
| Ga0137374_108540202 | 3300012204 | Vadose Zone Soil | VTLLSVLPHGATGTWLDEIFEFGLPLLIRIGLYFWSSRKPKEKRK* |
| Ga0137380_104387962 | 3300012206 | Vadose Zone Soil | MSFLSVVAHGATGTWLDEFIELGLPLIILVVLYFWSTRKPKAKRK* |
| Ga0137380_115456242 | 3300012206 | Vadose Zone Soil | VTLLSVLPHGATGTWLDEILEFGLPLVILIVLYIWSSRKPKAKEKSK* |
| Ga0137376_115106262 | 3300012208 | Vadose Zone Soil | VTLLSVLAHGATGTWLDEILEFGLPLIILIVLYIWSSRKPKAKQKTK* |
| Ga0137378_105198422 | 3300012210 | Vadose Zone Soil | VTLLSVLPHGATGTWLDEILEFGLPLVILVVLYIWSSRKPKAKEKSK* |
| Ga0137378_106201781 | 3300012210 | Vadose Zone Soil | HAVTLLSVLPHGVTGTWLDEILEFGLPLVILIVLYVWSSRKPKPKEKSK* |
| Ga0137370_107216892 | 3300012285 | Vadose Zone Soil | VTLLSVLPHGVTGTWVDEILEFGLPLVILIVLYVWSSRKPKPKEKSK* |
| Ga0137367_103087583 | 3300012353 | Vadose Zone Soil | GATGTWLDEILEFGLPLLILVVLYVWSSRKPNAKRK* |
| Ga0137369_101698992 | 3300012355 | Vadose Zone Soil | VVLSVLPHGATGTWLDEILEFGLPLIILIVLYVWSSRKPKQKQKSK* |
| Ga0137371_110365382 | 3300012356 | Vadose Zone Soil | VTLISVLPHGVTGTWLDEILEFGLPLVILIVLYIWSSRKPKAKEKSK* |
| Ga0137368_106818192 | 3300012358 | Vadose Zone Soil | VTLLSALPHGATGTWLDEIFEFGLPLLILVALYVWSSRKPKAKRK* |
| Ga0137375_101056452 | 3300012360 | Vadose Zone Soil | VTLLSALPHGATGTWLDEILEFGLPLLILVVLYVWSSRKPNAKRK* |
| Ga0137375_101158825 | 3300012360 | Vadose Zone Soil | MSFLAVLAHGATGTWLDEFVELGLPLLILVGLYFWSNRKPRPKEEKGKPK* |
| Ga0137375_101430582 | 3300012360 | Vadose Zone Soil | VTLLSVLPHGATGTWLDEIFEFGLPLLILIGLYFWSSRKPKGKRK* |
| Ga0137390_109090722 | 3300012363 | Vadose Zone Soil | MLLSVLPHGATGTWLDEILEFGIPLIVLIVLYVWSSRKPKAKQKSK* |
| Ga0137390_119468152 | 3300012363 | Vadose Zone Soil | MSFLAVVAHGATGTWLDEFIELGIPLIVLVGLYLWSNRKPKE |
| Ga0137373_100712655 | 3300012532 | Vadose Zone Soil | MTVLSLLPHGATGTWLDEILEFGLPLIVLIVLYVWSS |
| Ga0137373_109824562 | 3300012532 | Vadose Zone Soil | VTLLSVLPHGATGTWLDEIFEFGLPLLILIGLYFWSSRKPKEKRK* |
| Ga0137397_100121827 | 3300012685 | Vadose Zone Soil | MSLLAVVAHGATGTWLDEIIELGIPLIVLVALYLWSNRKPREKQK* |
| Ga0137397_100433724 | 3300012685 | Vadose Zone Soil | VTILSVFPHGATGTWLDEILEFGLPLIILIALYFWSSRKPKPKQKSK* |
| Ga0137397_103741872 | 3300012685 | Vadose Zone Soil | MSFLAVVAHGATGTWLDEFIELGIPLIILIALYFWSNRKEKQKEKPGK* |
| Ga0137396_102099642 | 3300012918 | Vadose Zone Soil | VTLLSFLPHGATGTWLDEILEFGLPLVILIVLYVWSSRKPKTKEKGK* |
| Ga0137396_104720742 | 3300012918 | Vadose Zone Soil | MSVLAIVAHGATGTWLDEFIELGIPLIILVALYLWSNRKPKAKQK* |
| Ga0137396_106161252 | 3300012918 | Vadose Zone Soil | VTLLSVLPHGATGTWLDEILEFGLPLVILIVLYVWSSRK |
| Ga0137394_100783162 | 3300012922 | Vadose Zone Soil | MSFLAIVAHGATGTWLDEIIELGIPLIVLVGLYFWSNRKPKEKRK* |
| Ga0137394_108737952 | 3300012922 | Vadose Zone Soil | MSLLAVVAHGATGTWLDEIIELGIPLIVLVALYLWSNRKPKEKQK* |
| Ga0137394_114558682 | 3300012922 | Vadose Zone Soil | MIFASVSTHGATGTWLDEILEFGLPLVILIALYVWSSRKPKQKQRSK |
| Ga0153915_130554352 | 3300012931 | Freshwater Wetlands | MSLLTILAHGATGFLDEFIELGLPLIILIALYIWSNRKPKEKP* |
| Ga0134081_102315782 | 3300014150 | Grasslands Soil | VTFVMVVAHGAGGWVDEIIELGIPLVVLVFLYLWSNRKAKKPEKK* |
| Ga0134075_100812272 | 3300014154 | Grasslands Soil | VTFVMVVAHGAGGWLDEIIELGIPLVVLVFLYLWSNRKAKKPEK |
| Ga0157377_101234071 | 3300014745 | Miscanthus Rhizosphere | VGHYRRVHLSVLPHCATGTWLDEILEFGLPLIILIVLYVWSSRKPKVKQKDK* |
| Ga0167656_10051401 | 3300015076 | Glacier Forefield Soil | MSFLMIVAHGATGTWLDEFIELGLPLLILVGLYVWSSRKPKQKDKPK* |
| Ga0137418_106592602 | 3300015241 | Vadose Zone Soil | VTLLSVLPHGATGTWLDEILEFGLPLVILIVLYVWSSRKPKTKEKGK* |
| Ga0180079_10183992 | 3300015248 | Soil | VTVLSLLPHGATGTWLDEIIAFGLPLLVLVVLWVWSSRKPKEKSK* |
| Ga0134089_102760682 | 3300015358 | Grasslands Soil | VTLLSVLPHGATGTWLDEILEFGLPLVILIVLYIWSSRKPKAKQKSK* |
| Ga0134085_106091641 | 3300015359 | Grasslands Soil | MIFASVSAHGATGTWLDEILEFGLPLVILIVLYIWSSRKPKAKEKSK* |
| Ga0132258_100887813 | 3300015371 | Arabidopsis Rhizosphere | VTLLSVLPHGATGTWLDEIIEFGLPLIILIVLYVWSSRKPKEKQKSK* |
| Ga0132258_115872782 | 3300015371 | Arabidopsis Rhizosphere | LTFLMVVAHGATGTWLDEIIEFGLPLVVLVALYVWSNRKPKRKEKPK* |
| Ga0132258_130636312 | 3300015371 | Arabidopsis Rhizosphere | MSFLAVVAHGATGPLDEFIELGLPLVILIGLYLWSNRKPKPKEEKDKPE* |
| Ga0132256_1019024452 | 3300015372 | Arabidopsis Rhizosphere | MSFVMVVAHGATGPLDEFVELGLPLLILIGLYFWSNRKPKPKEEKDKPK* |
| Ga0132256_1037416232 | 3300015372 | Arabidopsis Rhizosphere | VTLLSALPHGATGTWLDEIIEFGLPLIILIVLYVWSSRKPKEKQKSK* |
| Ga0132257_1020567112 | 3300015373 | Arabidopsis Rhizosphere | MVVAHGATGTWLDEIIEFGLPLVVLVALYVWSNRKPKRKEKPK* |
| Ga0132255_1052839622 | 3300015374 | Arabidopsis Rhizosphere | MSFLAVVAHGATGLLDEFIELGLPLVILIGLYLWSNRKPKPKEEKDKPE* |
| Ga0184610_11835182 | 3300017997 | Groundwater Sediment | VTILSVLPHGASGWLDEVISLGLPLVVLIVLYVWSSRKPKEKRK |
| Ga0184604_100043992 | 3300018000 | Groundwater Sediment | VTLLSVLAHGATGTWLDEIFEFGLPLIILIVLYVWSSRKPKEKPKSK |
| Ga0184604_100779762 | 3300018000 | Groundwater Sediment | VTILSVLPHGATGTWLDEIIEFGLPLLILVGLYVWSARKPKEKSK |
| Ga0184605_100147102 | 3300018027 | Groundwater Sediment | VTLLSVLGHGATGTWLDEIFEFGLPLIILIVLYVWSSRKPKEKHKTK |
| Ga0184605_100330872 | 3300018027 | Groundwater Sediment | VTLLSVLPHGATGTWLDEILEFGLPLVILIVLYIWSSRKPKTKEKSK |
| Ga0184608_100002054 | 3300018028 | Groundwater Sediment | VTLLSVLAHGATGTWLDEIFEFGLPLIILIVLYVWSSRKPKEKHKTK |
| Ga0184608_100615344 | 3300018028 | Groundwater Sediment | VTILSVLPHGATGTWLDEIIEFGLPLLILVGLYLWSARKPKEKSK |
| Ga0184634_103009892 | 3300018031 | Groundwater Sediment | VTILSVLPHGATGTWLDEVIEFGLPLVVLIFLYIWSSHKPKEKGK |
| Ga0184638_11513642 | 3300018052 | Groundwater Sediment | VTLRSALPHGATGTWLDEIFEFGLPLIILIVLYMWSSRKPKEKHK |
| Ga0184623_100476102 | 3300018056 | Groundwater Sediment | VTILSVLAHGASGWLDELISLGLPLVVLIVLYIWSSRKPKEKSK |
| Ga0184623_102590782 | 3300018056 | Groundwater Sediment | VLAHGATGTWLDEIFEFGLPLIILIVLYLWSSRKPKQKQKNK |
| Ga0184619_105422551 | 3300018061 | Groundwater Sediment | VTLLSVVAHGATGTWLDEILEFGLPLIILIVLYVWSSRKPKQKQKSK |
| Ga0184618_100512523 | 3300018071 | Groundwater Sediment | VTLLSVVAHGATGTWLDEIFEFGLPLIILIVLYVWSSRKPKEKHKTK |
| Ga0184640_100580402 | 3300018074 | Groundwater Sediment | VTLLSVLPHGATGTWLDEVIQFGLPLVVLIFLYVWSSRKPKEKGK |
| Ga0184632_100313012 | 3300018075 | Groundwater Sediment | VTLLSVLAHGATGTWLDEILEFGLPLIILIVLYVWSSRKPKEKHKTK |
| Ga0184609_103085332 | 3300018076 | Groundwater Sediment | VTLLSVLAHGATGTWLDEIFEFGLPLIILIVLYVWSSRKPKEKQKSK |
| Ga0066655_101044133 | 3300018431 | Grasslands Soil | MVVAHGAGGWLDEIIELGIPLVVLVFLYLWSNRKAKKPEKK |
| Ga0066655_114514632 | 3300018431 | Grasslands Soil | VTLLSVLPHGATGTWLDEILEFGLPLVILIVLYIWSSRKPKAKEKSK |
| Ga0066667_111790832 | 3300018433 | Grasslands Soil | VTFVMVVAHGAGGWLDEIIELGIPLVVLVFLYLWSNRKAKKPEKK |
| Ga0066662_102261403 | 3300018468 | Grasslands Soil | VTLLSVLPHGVTGTWLDEILEFGLPLVILIVLYVWSSRKPKPKEKSK |
| Ga0066669_100046165 | 3300018482 | Grasslands Soil | VTLISVLPHGVTGTWLDEILEFGLPLVILIVLYVWSSRKPKPKEKSK |
| Ga0184643_12836772 | 3300019255 | Groundwater Sediment | ATGTWLDEIFEFGLPLIILIVLYVWSSRKPKQKQKSK |
| Ga0193715_10903972 | 3300019878 | Soil | HRGVRPRSEQVTLLSVTAHGATGTWLDEIFEFGLPLIILIVLYVWSSRKPKEKHKTK |
| Ga0193739_10089962 | 3300020003 | Soil | VTILSVLPHGATGTWLDEIVEFGLPLLILIVLYVWSSRKPKEKSK |
| Ga0210378_101816722 | 3300021073 | Groundwater Sediment | VTLLSVLAHGATGTWLDEIFEFGLPLIILIVLYLWSSRKPKQKQKNK |
| Ga0210381_103078902 | 3300021078 | Groundwater Sediment | VTLLSVLAHGATGTWLDEIFEFGLPLIILIVLYVWSSRKPKEEQKSK |
| Ga0210382_100240652 | 3300021080 | Groundwater Sediment | VSVLDVSFLMIVAHGATGTWLDEIIELGLPLVVLIALYFWSNRKPKNREKPK |
| Ga0210382_100398203 | 3300021080 | Groundwater Sediment | VTVLSVLAHGATGTWLDEIFEFGLPLIILIVLYVWSSRKPKEKQKSK |
| Ga0210382_105249602 | 3300021080 | Groundwater Sediment | VTLLSVTAHGATGTWLDEIFEFGLPLIILIVLYVWSSRKPKQKQKSK |
| Ga0193719_101563512 | 3300021344 | Soil | VTLLSVVAHGATGTWLDEIFEFGLPLIILIVLYVWSSRKPKQKQKSK |
| Ga0224452_10109893 | 3300022534 | Groundwater Sediment | VTLLSVTAHGATGTWLDEIFEFGLPLIILIVLYVWSSRKPKEKHKTK |
| Ga0207688_106501822 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | MTFLMVVAHGATGWLDEFIELGLPLIILAGLYFWSNRKPAKKDEKGKPK |
| Ga0207647_106303762 | 3300025904 | Corn Rhizosphere | VTLLSVLAHGATGTWLDEIFEFGLPLIILIVLYMWSSRKPKEKQKSK |
| Ga0207643_100475982 | 3300025908 | Miscanthus Rhizosphere | VTLLSVLAHGATGTWLDEIFEFGLPLIILIVLYVWSSRKPKEKQRSK |
| Ga0207684_1000002418 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | VTLLSVLPHGATGTWLDEILEFGIPLIVLIVLYVWSSRKPKTKQKSK |
| Ga0207654_112294842 | 3300025911 | Corn Rhizosphere | MTFLMVVAHGATGLLDEFIELGLPLIILAGLYFWSNRKPAKKDEKGKPK |
| Ga0207707_105172062 | 3300025912 | Corn Rhizosphere | VTLLSVLPHGATGTWLDEIFEFGLPLIILIVLYMWSSRKPKEKQKSK |
| Ga0207660_107075421 | 3300025917 | Corn Rhizosphere | AEPGRRRQRCVRPRSGQVTLLSVLAHGATGTWLDEIFEFGLPLIILIVLYVWSSRKPKEKQRSK |
| Ga0207662_102059143 | 3300025918 | Switchgrass Rhizosphere | AHGATGTWLDEIFEFGLPLIILIVLYVWSSRKPKEKQKSK |
| Ga0207662_103005112 | 3300025918 | Switchgrass Rhizosphere | VGHYRRVHLSVLPHGATGTWLDEILEFGLPLIILIVLYVWSSRKPKVKQKDK |
| Ga0207652_104864812 | 3300025921 | Corn Rhizosphere | VTLLSALPHGATGTWLDEIFEFGLPLIILIVLYMWSSRKPKEKQKSK |
| Ga0207652_116793232 | 3300025921 | Corn Rhizosphere | MTFLMVVAHGATGTWLDEFIELGLPLIILAGLYFWSNRKPADKNGKPK |
| Ga0207681_113396641 | 3300025923 | Switchgrass Rhizosphere | PHGATGTWLDEILEFGLPLIILIVLYVWSSRKPKVKQKDK |
| Ga0207709_103720001 | 3300025935 | Miscanthus Rhizosphere | VTLLSVLPHGATGTWLDEIFEFGLPLIILIVLYMWS |
| Ga0207709_107472232 | 3300025935 | Miscanthus Rhizosphere | PRSEQVTLLSVLAHGATGTWLDEIFEFGLPLIILIVLYVWSSRKPKEKQKSK |
| Ga0207709_110519582 | 3300025935 | Miscanthus Rhizosphere | RQRCVRPRSEQVTLLSVLPHGATGTWLDEIFEFGLPLIILIVLYVWSSRKPKEKQRSK |
| Ga0207691_111040952 | 3300025940 | Miscanthus Rhizosphere | VLAHGATGTWLDEIFEFGLPLIILIVLYVWSSRKPKEKQKSK |
| Ga0207689_107588292 | 3300025942 | Miscanthus Rhizosphere | MTLLMVVAHGATGWLDEFIELGLPLIILAGLYFWSNRKPAKKDEKGKPK |
| Ga0207651_112870252 | 3300025960 | Switchgrass Rhizosphere | VKSAAPCSTGVGHYRRVHLSVLPHGATGTWLDEILEFGLPLIILIVLYVWSSRKPKVKQKDK |
| Ga0207712_107364312 | 3300025961 | Switchgrass Rhizosphere | VTLLSALPHGATGTWLDEIFEFGLPLIILIVLYVWSSRKPKEKQRSK |
| Ga0207640_114316062 | 3300025981 | Corn Rhizosphere | MTFLMVVAHGATGTWLDEFIELGLPLIILAGLYFWSNRKPAGKNGKPK |
| Ga0207677_102515061 | 3300026023 | Miscanthus Rhizosphere | ATGTWLDEILEFGLPLIILIVLYVWSSRKPKVKQRDK |
| Ga0207708_113590112 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | VTLLSVLAHGATGTWLDEILEFGLPLIILIVLYVWSSRKPKVKQKDK |
| Ga0209469_10959802 | 3300026307 | Soil | VTPLSVLPHGVTGTWVDEILEFGLPLVILIVLYVWSSRKPKPKEKSK |
| Ga0209131_10173313 | 3300026320 | Grasslands Soil | VGHYRAVQFSVLPHGATGTWLDEILEFGLPLIILIALYVWSSRKPKEKRKSK |
| Ga0209470_100358210 | 3300026324 | Soil | VTLLSVLPHGATGTWLDEILEFGLPLVILIVLYMWSSRKPKAKEKSK |
| Ga0209057_11963172 | 3300026342 | Soil | VTLLSVLPHGVTGTWVDEILEFGLPLVILIVLYVWSSRKPKPKEKSK |
| Ga0208997_10407612 | 3300027181 | Forest Soil | QRRRCGQRRLRPRREQVTLLSVLAHGATGTWLDEILEFGLPLVILIVLYVWSSRKPKAKQKIK |
| Ga0208995_10968152 | 3300027388 | Forest Soil | VTILSVLAHGATGTWLDEILEFGLPLVILIALYIWSSRRPRTKEKGK |
| Ga0210000_10810942 | 3300027462 | Arabidopsis Thaliana Rhizosphere | MAHGATGTWLDEIIEFGLPLLILVVLYVWSARKPKEKEKSK |
| Ga0208988_10178742 | 3300027633 | Forest Soil | VTILSVLAHGATGTWLDEILEFGLPLLILIVLYVWSSRKPKAKQKIK |
| Ga0209117_10053887 | 3300027645 | Forest Soil | VTLLSVLAHGATGTWLDEILEFGLPLVILIALYVWSSRKPKTKEKSK |
| Ga0209117_10456504 | 3300027645 | Forest Soil | MNFLMVVAHGATGTWLDEFIELGLPLIILVGLYFWSNRKPKQKDKPK |
| Ga0209388_10364492 | 3300027655 | Vadose Zone Soil | MPLSVLPHGATGTWLDEILEFGIPLIVLIVLYVWSSRKPKTKQKSK |
| Ga0208981_11137012 | 3300027669 | Forest Soil | VTILSVLAHGATGTWLDEILEFGLPLLILIVLYVWSSRKPKAKQKSK |
| Ga0209011_11868652 | 3300027678 | Forest Soil | VTILSVLAHGATGTWLDEILEFGLPLVILIALYIWSSRKPRTKEKGK |
| Ga0209515_102805172 | 3300027835 | Groundwater | MTLASVLAHGATGTWLDEIIELGLPLLILIGLYFWSNRKPRPKQEKPK |
| Ga0209701_104308392 | 3300027862 | Vadose Zone Soil | MSFLAVVAHGATGTWLDEFIELGIPLIVLVGLYLWSNRKPKEKQK |
| Ga0209814_100038085 | 3300027873 | Populus Rhizosphere | VTTLSILAHGATGWFDELISLGLPLVILIVLYVWSARKPKQKSK |
| Ga0209814_101105911 | 3300027873 | Populus Rhizosphere | VTLLSVLPHGATGTWLDEILEFGIPLIVLIVLYVWSSR |
| Ga0209814_101181152 | 3300027873 | Populus Rhizosphere | MRFSVLPHGATGTWLDEILEFGLPLIILIVLYLWSSRKPKEKQKTK |
| Ga0209283_100399402 | 3300027875 | Vadose Zone Soil | MSFLAVVAHGATGTWLDEFIELGVPLIVLVGLYLWSNRKPKEKQK |
| Ga0209283_100805083 | 3300027875 | Vadose Zone Soil | MLLSVLPHGATGTWLDEILEFGIPLIVLIVLYVWSSRKPKTKQKSK |
| Ga0209590_100664252 | 3300027882 | Vadose Zone Soil | VTLLSVLPHGATGTWLDEILEFGLPLVILIVLYVWSSRKPKTKEKSK |
| Ga0209486_100657212 | 3300027886 | Agricultural Soil | VTILSVLAHGSTGWFDEVISLGLPLVILVVLYVWSSRKPKQKSK |
| Ga0209486_105740892 | 3300027886 | Agricultural Soil | VNVLSVLPHGATGTWLDEIIEFGLPLLILVGLYVWSARKPKAKSK |
| Ga0209382_117227452 | 3300027909 | Populus Rhizosphere | VIVLSTLPHGATGTWLDEIIEFGLPLVVLIVLYIWSSRKPKTKQK |
| Ga0307276_100200662 | 3300028705 | Soil | MTFLMVVAHGATGTWLDEFIELGLPLIILAGLYFWSNRKPAKKEEKGKPK |
| Ga0307292_104588262 | 3300028811 | Soil | MTFLMVVAHGATGTWLDELIELGLPLIILVGLYFWSNRKPSKKEKGKPK |
| Ga0307302_100339231 | 3300028814 | Soil | VTLLSVLGHGATGTWLDEIFEFGLPLIILIVLYVWS |
| Ga0307296_100315324 | 3300028819 | Soil | VTLLSVVAHGATGTWLDEIFEFGLPLIILIVLYVWSSRRPKEKQKSK |
| Ga0307296_103748671 | 3300028819 | Soil | GHGATGTWLDEIFEFGLPLIILIVLYVWSSRKPKEKHKTK |
| Ga0307296_107171472 | 3300028819 | Soil | VTLLSVTGHGATGTWLDEIFEFGLPLIILIVLYVWSS |
| Ga0307296_107445832 | 3300028819 | Soil | VTLLSVLPHGATGTWLDEILEFGLPLVILIALYIWSSRKPKTKEKSK |
| Ga0307312_102842252 | 3300028828 | Soil | VGHYRRVQFSVLPHGATGTWLDEIFEFGLPLIILIVLYVWSS |
| Ga0307278_104303712 | 3300028878 | Soil | VTLLSVTAHGATGTWLDEILEFGLPLIILIVLYVWSSRKPKEKH |
| Ga0307308_100442304 | 3300028884 | Soil | LLSVAAHGATGTWLDEIFEFGLPLIILIVLYVWSSRKPKQKQKSK |
| Ga0307469_107326482 | 3300031720 | Hardwood Forest Soil | MVVAHGATGTWLDEIIEFGLPLVVLVGLYIWSNRKPKRKEKPK |
| Ga0307468_1020995702 | 3300031740 | Hardwood Forest Soil | VTLLSVLAHGATGTWLDEIFEFGLPLVILIVLYVWSSRKPKEKPKSK |
| Ga0326597_100131773 | 3300031965 | Soil | VTILEVLPHGATGTWLDEIIEFGIPLVVLIVLYVWSSRKPHEEKRK |
| Ga0326597_105229532 | 3300031965 | Soil | VTILSVLAHGATGTWLDEIVEFGIPLLILIGLYVWSARKPKAKEKIK |
| Ga0326597_110089453 | 3300031965 | Soil | QRGRRGQRRVRARREPLTILSVLPHGATGTWLDEIIEFGIPLLVLIVLYVWSARKPKEKT |
| Ga0326597_118346831 | 3300031965 | Soil | VTILEVLPHGATGTWLDEIIEFGIPLVVLIVLYVW |
| Ga0307471_1033267532 | 3300032180 | Hardwood Forest Soil | MSFLAVVAHGATGTWLDEFIELGVPLIILIILYFWSNRKDKQKEKPGK |
| Ga0307471_1036634672 | 3300032180 | Hardwood Forest Soil | HTMSFLAVVAHGATGTWLDEFIELGVPLIILIVLYFWSNRKDKQKEKPGK |
| Ga0307471_1043174472 | 3300032180 | Hardwood Forest Soil | MVVAHGATGTWLDEIIEFGLPLLVLVGLYIWSNRKPKRKEKPK |
| Ga0307472_1002315822 | 3300032205 | Hardwood Forest Soil | MVVAHGATGTWLDEIIEFGLPLVVLVALYIWSNRKPKRKEKPK |
| Ga0310812_103041121 | 3300032421 | Soil | GHYRRVHLSVLPHGATGTWLDEILEFGLPLIILIVLYVWSSRKPKVKQKDK |
| Ga0334722_100783054 | 3300033233 | Sediment | MSFHAVVAHGATGTWLDEFIELGLPLIILVGLYFWSNRKPKAKQ |
| Ga0214472_109499032 | 3300033407 | Soil | VTNLSVLPHGATGTWLDEIIEFGIPLLILIVLYVWSARKPKEKTK |
| Ga0310810_104410093 | 3300033412 | Soil | CSTGVGHYRSVHLSVLPHGATGTWLDEILEFGLPLIILIVLYVWSSRKPKVKQKDK |
| Ga0316628_1001183423 | 3300033513 | Soil | MVVAHGATGPLDEFIEIGLPLIVLIALYWWSNRKPKEGPKK |
| ⦗Top⦘ |