NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F014655

Metagenome / Metatranscriptome Family F014655

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F014655
Family Type Metagenome / Metatranscriptome
Number of Sequences 261
Average Sequence Length 48 residues
Representative Sequence MESPNVETHRAGHEAFNQRDFAAMTKQYADSITWTDHSQGRTFRTP
Number of Associated Samples 218
Number of Associated Scaffolds 261

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 98.47 %
% of genes near scaffold ends (potentially truncated) 99.62 %
% of genes from short scaffolds (< 2000 bps) 92.34 %
Associated GOLD sequencing projects 208
AlphaFold2 3D model prediction Yes
3D model pTM-score0.38

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (83.525 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(16.475 % of family members)
Environment Ontology (ENVO) Unclassified
(27.203 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(37.548 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 32.43%    β-sheet: 10.81%    Coil/Unstructured: 56.76%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.38
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 261 Family Scaffolds
PF00486Trans_reg_C 39.46
PF03704BTAD 23.37
PF01799Fer2_2 2.68
PF00196GerE 2.30
PF06348DUF1059 2.30
PF00296Bac_luciferase 1.15
PF13474SnoaL_3 0.77
PF01872RibD_C 0.77
PF02738MoCoBD_1 0.77
PF16925TetR_C_13 0.77
PF00005ABC_tran 0.38
PF05694SBP56 0.38
PF00144Beta-lactamase 0.38
PF07995GSDH 0.38
PF013675_3_exonuc 0.38
PF00753Lactamase_B 0.38
PF09347DUF1989 0.38
PF08570DUF1761 0.38
PF00857Isochorismatase 0.38
PF027395_3_exonuc_N 0.38
PF01791DeoC 0.38
PF00111Fer2 0.38
PF01048PNP_UDP_1 0.38
PF01558POR 0.38
PF08327AHSA1 0.38
PF01361Tautomerase 0.38
PF00027cNMP_binding 0.38
PF07836DmpG_comm 0.38
PF00440TetR_N 0.38
PF12680SnoaL_2 0.38
PF13561adh_short_C2 0.38
PF13191AAA_16 0.38

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 261 Family Scaffolds
COG3947Two-component response regulator, SAPR family, consists of REC, wHTH and BTAD domainsTranscription [K] 23.37
COG3629DNA-binding transcriptional regulator DnrI/AfsR/EmbR, SARP family, contains BTAD domainTranscription [K] 23.37
COG2141Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase)Coenzyme transport and metabolism [H] 1.15
COG02585'-3' exonuclease Xni/ExoIX (flap endonuclease)Replication, recombination and repair [L] 0.77
COG1985Pyrimidine reductase, riboflavin biosynthesisCoenzyme transport and metabolism [H] 0.77
COG0262Dihydrofolate reductaseCoenzyme transport and metabolism [H] 0.77
COG1014Pyruvate:ferredoxin oxidoreductase or related 2-oxoacid:ferredoxin oxidoreductase, gamma subunitEnergy production and conversion [C] 0.38
COG1335Nicotinamidase-related amidaseCoenzyme transport and metabolism [H] 0.38
COG1535Isochorismate hydrolaseSecondary metabolites biosynthesis, transport and catabolism [Q] 0.38
COG1680CubicO group peptidase, beta-lactamase class C familyDefense mechanisms [V] 0.38
COG1686D-alanyl-D-alanine carboxypeptidaseCell wall/membrane/envelope biogenesis [M] 0.38
COG1942Phenylpyruvate tautomerase PptA, 4-oxalocrotonate tautomerase familySecondary metabolites biosynthesis, transport and catabolism [Q] 0.38
COG0813Purine-nucleoside phosphorylaseNucleotide transport and metabolism [F] 0.38
COG2133Glucose/arabinose dehydrogenase, beta-propeller foldCarbohydrate transport and metabolism [G] 0.38
COG0775Nucleoside phosphorylase/nucleosidase, includes 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase MtnN and futalosine hydrolase MqnBNucleotide transport and metabolism [F] 0.38
COG2367Beta-lactamase class ADefense mechanisms [V] 0.38
COG2820Uridine phosphorylaseNucleotide transport and metabolism [F] 0.38
COG0119Isopropylmalate/homocitrate/citramalate synthasesAmino acid transport and metabolism [E] 0.38


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms83.52 %
UnclassifiedrootN/A16.48 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2140918007|ConsensusfromContig117079All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Kribbellaceae → Kribbella → unclassified Kribbella → Kribbella sp. VKM Ac-2527680Open in IMG/M
2170459024|GZTSFBX01CSPVQAll Organisms → cellular organisms → Bacteria520Open in IMG/M
3300000443|F12B_10031835All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Kribbellaceae → Kribbella → unclassified Kribbella → Kribbella sp. VKM Ac-2527773Open in IMG/M
3300000955|JGI1027J12803_108782358All Organisms → cellular organisms → Bacteria1008Open in IMG/M
3300000956|JGI10216J12902_101295893All Organisms → cellular organisms → Bacteria551Open in IMG/M
3300000956|JGI10216J12902_106695861All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Kribbellaceae → Kribbella → unclassified Kribbella → Kribbella sp. VKM Ac-2527514Open in IMG/M
3300001305|C688J14111_10270098Not Available536Open in IMG/M
3300001431|F14TB_100857066All Organisms → cellular organisms → Bacteria586Open in IMG/M
3300001527|A3513AW1_1050474All Organisms → cellular organisms → Bacteria542Open in IMG/M
3300002568|C688J35102_119137231All Organisms → cellular organisms → Bacteria643Open in IMG/M
3300003373|JGI25407J50210_10022531All Organisms → cellular organisms → Bacteria1637Open in IMG/M
3300003659|JGI25404J52841_10095611All Organisms → cellular organisms → Bacteria622Open in IMG/M
3300004016|Ga0058689_10026900All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Kribbellaceae → Kribbella → unclassified Kribbella → Kribbella sp. VKM Ac-2527970Open in IMG/M
3300004081|Ga0063454_101046078All Organisms → cellular organisms → Bacteria661Open in IMG/M
3300004081|Ga0063454_101259733All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia616Open in IMG/M
3300004153|Ga0063455_101563969Not Available517Open in IMG/M
3300004157|Ga0062590_103056489All Organisms → cellular organisms → Bacteria501Open in IMG/M
3300004479|Ga0062595_101483368All Organisms → cellular organisms → Bacteria624Open in IMG/M
3300004479|Ga0062595_101532754Not Available617Open in IMG/M
3300005180|Ga0066685_10568912All Organisms → cellular organisms → Bacteria781Open in IMG/M
3300005332|Ga0066388_102697759All Organisms → cellular organisms → Bacteria906Open in IMG/M
3300005335|Ga0070666_10308788All Organisms → cellular organisms → Bacteria1127Open in IMG/M
3300005356|Ga0070674_101207505Not Available671Open in IMG/M
3300005363|Ga0008090_15363383Not Available696Open in IMG/M
3300005434|Ga0070709_10207665All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1390Open in IMG/M
3300005435|Ga0070714_100468387All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1198Open in IMG/M
3300005451|Ga0066681_10206746All Organisms → cellular organisms → Bacteria1177Open in IMG/M
3300005467|Ga0070706_100673279All Organisms → cellular organisms → Bacteria960Open in IMG/M
3300005468|Ga0070707_101025851All Organisms → cellular organisms → Bacteria790Open in IMG/M
3300005530|Ga0070679_101035898All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales765Open in IMG/M
3300005536|Ga0070697_100595176All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Kribbellaceae → Kribbella → unclassified Kribbella → Kribbella sp. VKM Ac-2527972Open in IMG/M
3300005561|Ga0066699_11273278Not Available504Open in IMG/M
3300005563|Ga0068855_101491788All Organisms → cellular organisms → Bacteria694Open in IMG/M
3300005568|Ga0066703_10678911All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Kribbellaceae → Kribbella → unclassified Kribbella → Kribbella sp. VKM Ac-2527594Open in IMG/M
3300005578|Ga0068854_100014409All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces5212Open in IMG/M
3300005618|Ga0068864_100458596Not Available1220Open in IMG/M
3300005844|Ga0068862_101303356All Organisms → cellular organisms → Bacteria728Open in IMG/M
3300006034|Ga0066656_10806657Not Available601Open in IMG/M
3300006173|Ga0070716_100007688All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia5319Open in IMG/M
3300006175|Ga0070712_101154534Not Available673Open in IMG/M
3300006358|Ga0068871_101564757Not Available624Open in IMG/M
3300006755|Ga0079222_10663348All Organisms → cellular organisms → Bacteria815Open in IMG/M
3300006800|Ga0066660_10364345All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Kribbellaceae → Kribbella → unclassified Kribbella → Kribbella sp. VKM Ac-25271179Open in IMG/M
3300006871|Ga0075434_102249286All Organisms → cellular organisms → Bacteria549Open in IMG/M
3300006904|Ga0075424_100413122All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1439Open in IMG/M
3300006914|Ga0075436_100205200All Organisms → cellular organisms → Bacteria1396Open in IMG/M
3300006953|Ga0074063_13103480All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria609Open in IMG/M
3300006953|Ga0074063_14102058All Organisms → cellular organisms → Bacteria849Open in IMG/M
3300006954|Ga0079219_10220297All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae1097Open in IMG/M
3300007790|Ga0105679_10341939All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia3059Open in IMG/M
3300009100|Ga0075418_11207700All Organisms → cellular organisms → Bacteria820Open in IMG/M
3300009148|Ga0105243_11476944All Organisms → cellular organisms → Bacteria703Open in IMG/M
3300009174|Ga0105241_12435916Not Available523Open in IMG/M
3300009177|Ga0105248_10611557All Organisms → cellular organisms → Bacteria1229Open in IMG/M
3300009553|Ga0105249_13220751Not Available525Open in IMG/M
3300009792|Ga0126374_10364669Not Available996Open in IMG/M
3300009805|Ga0105079_1002890All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1085Open in IMG/M
3300009840|Ga0126313_10208816All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Kribbellaceae → Kribbella → unclassified Kribbella → Kribbella sp. VKM Ac-25271501Open in IMG/M
3300009840|Ga0126313_11833250All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria508Open in IMG/M
3300010029|Ga0105074_1075159All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Kribbellaceae → Kribbella → unclassified Kribbella → Kribbella sp. VKM Ac-2527618Open in IMG/M
3300010036|Ga0126305_10851500All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia621Open in IMG/M
3300010037|Ga0126304_10476165All Organisms → cellular organisms → Bacteria837Open in IMG/M
3300010043|Ga0126380_10766499All Organisms → cellular organisms → Bacteria785Open in IMG/M
3300010043|Ga0126380_10849006All Organisms → cellular organisms → Bacteria753Open in IMG/M
3300010043|Ga0126380_10870619All Organisms → cellular organisms → Bacteria745Open in IMG/M
3300010044|Ga0126310_11521688All Organisms → cellular organisms → Bacteria550Open in IMG/M
3300010046|Ga0126384_10233156All Organisms → cellular organisms → Bacteria1478Open in IMG/M
3300010048|Ga0126373_12682729Not Available556Open in IMG/M
3300010303|Ga0134082_10247222All Organisms → cellular organisms → Bacteria738Open in IMG/M
3300010359|Ga0126376_12587630All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi556Open in IMG/M
3300010360|Ga0126372_12840511Not Available536Open in IMG/M
3300010361|Ga0126378_12348416Not Available609Open in IMG/M
3300010373|Ga0134128_12895886All Organisms → cellular organisms → Bacteria528Open in IMG/M
3300010398|Ga0126383_13268438All Organisms → cellular organisms → Bacteria529Open in IMG/M
3300010401|Ga0134121_11847131Not Available632Open in IMG/M
3300010401|Ga0134121_13146877All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria509Open in IMG/M
3300012198|Ga0137364_11295451All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Kribbellaceae → Kribbella → unclassified Kribbella → Kribbella sp. VKM Ac-2527543Open in IMG/M
3300012200|Ga0137382_10194118All Organisms → cellular organisms → Bacteria1393Open in IMG/M
3300012200|Ga0137382_11167454All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria548Open in IMG/M
3300012201|Ga0137365_10104322All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2133Open in IMG/M
3300012208|Ga0137376_11018386All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia709Open in IMG/M
3300012353|Ga0137367_10005657All Organisms → cellular organisms → Bacteria10129Open in IMG/M
3300012354|Ga0137366_11034926Not Available569Open in IMG/M
3300012355|Ga0137369_10436599All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria937Open in IMG/M
3300012356|Ga0137371_10061691All Organisms → cellular organisms → Bacteria2904Open in IMG/M
3300012360|Ga0137375_10058788All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria4137Open in IMG/M
3300012360|Ga0137375_10624638All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia893Open in IMG/M
3300012360|Ga0137375_11135949All Organisms → cellular organisms → Bacteria603Open in IMG/M
3300012469|Ga0150984_102163865Not Available521Open in IMG/M
3300012494|Ga0157341_1006340All Organisms → cellular organisms → Bacteria914Open in IMG/M
3300012515|Ga0157338_1010672All Organisms → cellular organisms → Bacteria932Open in IMG/M
3300012532|Ga0137373_10199591All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1648Open in IMG/M
3300012924|Ga0137413_11149581All Organisms → cellular organisms → Bacteria616Open in IMG/M
3300012925|Ga0137419_11982544All Organisms → cellular organisms → Bacteria500Open in IMG/M
3300012937|Ga0162653_100078168All Organisms → cellular organisms → Bacteria540Open in IMG/M
3300012939|Ga0162650_100039871All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae745Open in IMG/M
3300012948|Ga0126375_10463224All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia935Open in IMG/M
3300012955|Ga0164298_11473800All Organisms → cellular organisms → Bacteria530Open in IMG/M
3300012960|Ga0164301_11211756All Organisms → cellular organisms → Bacteria607Open in IMG/M
3300012977|Ga0134087_10496078Not Available614Open in IMG/M
3300013102|Ga0157371_10132939All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1770Open in IMG/M
3300013105|Ga0157369_10982777All Organisms → cellular organisms → Bacteria864Open in IMG/M
3300014326|Ga0157380_11299502All Organisms → cellular organisms → Bacteria775Open in IMG/M
3300014969|Ga0157376_10350377All Organisms → cellular organisms → Bacteria1413Open in IMG/M
3300015357|Ga0134072_10302026Not Available597Open in IMG/M
3300015374|Ga0132255_103004678All Organisms → cellular organisms → Bacteria720Open in IMG/M
3300015374|Ga0132255_103886265All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Kribbellaceae → Kribbella → unclassified Kribbella → Kribbella sp. VKM Ac-2527635Open in IMG/M
3300015374|Ga0132255_105860131All Organisms → cellular organisms → Bacteria520Open in IMG/M
3300016319|Ga0182033_10768851All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia847Open in IMG/M
3300017997|Ga0184610_1038241All Organisms → cellular organisms → Bacteria1376Open in IMG/M
3300018060|Ga0187765_11228600All Organisms → cellular organisms → Bacteria527Open in IMG/M
3300018066|Ga0184617_1221247All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria565Open in IMG/M
3300018081|Ga0184625_10190070All Organisms → cellular organisms → Bacteria1076Open in IMG/M
3300018429|Ga0190272_12804338Not Available537Open in IMG/M
3300018433|Ga0066667_11453798All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria604Open in IMG/M
3300020002|Ga0193730_1109554All Organisms → cellular organisms → Bacteria764Open in IMG/M
3300020070|Ga0206356_10689349All Organisms → cellular organisms → Bacteria1290Open in IMG/M
3300021078|Ga0210381_10031355All Organisms → cellular organisms → Bacteria1497Open in IMG/M
3300021082|Ga0210380_10224398All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi851Open in IMG/M
3300021445|Ga0182009_10079102All Organisms → cellular organisms → Bacteria1460Open in IMG/M
3300021445|Ga0182009_10098431All Organisms → cellular organisms → Bacteria1330Open in IMG/M
3300021479|Ga0210410_11723796All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria520Open in IMG/M
3300021510|Ga0222621_1095470All Organisms → cellular organisms → Bacteria630Open in IMG/M
3300022756|Ga0222622_11142482All Organisms → cellular organisms → Bacteria573Open in IMG/M
3300022756|Ga0222622_11299065Not Available535Open in IMG/M
3300024179|Ga0247695_1003500All Organisms → cellular organisms → Bacteria2277Open in IMG/M
3300024187|Ga0247672_1043468All Organisms → cellular organisms → Bacteria740Open in IMG/M
3300024317|Ga0247660_1044112All Organisms → cellular organisms → Bacteria730Open in IMG/M
3300025885|Ga0207653_10060837All Organisms → cellular organisms → Bacteria1273Open in IMG/M
3300025885|Ga0207653_10384737All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium549Open in IMG/M
3300025898|Ga0207692_10054431All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium2043Open in IMG/M
3300025898|Ga0207692_10972303All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi560Open in IMG/M
3300025899|Ga0207642_10605881All Organisms → cellular organisms → Bacteria682Open in IMG/M
3300025905|Ga0207685_10579870All Organisms → cellular organisms → Bacteria600Open in IMG/M
3300025916|Ga0207663_10749353All Organisms → cellular organisms → Bacteria776Open in IMG/M
3300025918|Ga0207662_10868836All Organisms → cellular organisms → Bacteria638Open in IMG/M
3300025922|Ga0207646_11272366All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Kribbellaceae → Kribbella → unclassified Kribbella → Kribbella sp. VKM Ac-2527643Open in IMG/M
3300025924|Ga0207694_10453411All Organisms → cellular organisms → Bacteria1071Open in IMG/M
3300025925|Ga0207650_10403568All Organisms → cellular organisms → Bacteria1132Open in IMG/M
3300025928|Ga0207700_10017774All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria4758Open in IMG/M
3300025928|Ga0207700_11670841All Organisms → cellular organisms → Bacteria562Open in IMG/M
3300025929|Ga0207664_11253940All Organisms → cellular organisms → Bacteria660Open in IMG/M
3300025929|Ga0207664_11929970Not Available513Open in IMG/M
3300025937|Ga0207669_11228288Not Available635Open in IMG/M
3300025945|Ga0207679_11091310All Organisms → cellular organisms → Bacteria732Open in IMG/M
3300025961|Ga0207712_11757038All Organisms → cellular organisms → Bacteria556Open in IMG/M
3300025981|Ga0207640_10012059All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria4913Open in IMG/M
3300026088|Ga0207641_10913783All Organisms → cellular organisms → Bacteria872Open in IMG/M
3300026095|Ga0207676_10082930All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2609Open in IMG/M
3300026121|Ga0207683_10750934All Organisms → cellular organisms → Bacteria905Open in IMG/M
3300026309|Ga0209055_1140313All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Kribbellaceae → Kribbella → unclassified Kribbella → Kribbella sp. VKM Ac-2527863Open in IMG/M
3300026322|Ga0209687_1211258All Organisms → cellular organisms → Bacteria598Open in IMG/M
3300026995|Ga0208761_1003164All Organisms → cellular organisms → Bacteria1140Open in IMG/M
3300027718|Ga0209795_10055950All Organisms → cellular organisms → Bacteria1185Open in IMG/M
3300027725|Ga0209178_1305008All Organisms → cellular organisms → Bacteria587Open in IMG/M
3300027775|Ga0209177_10327797All Organisms → cellular organisms → Bacteria592Open in IMG/M
3300027909|Ga0209382_10262900All Organisms → cellular organisms → Bacteria1956Open in IMG/M
3300027954|Ga0209859_1031301All Organisms → cellular organisms → Bacteria896Open in IMG/M
3300028380|Ga0268265_12158414All Organisms → cellular organisms → Bacteria564Open in IMG/M
3300028587|Ga0247828_10241682All Organisms → cellular organisms → Bacteria965Open in IMG/M
3300028592|Ga0247822_11466065Not Available576Open in IMG/M
3300028597|Ga0247820_10226026All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1201Open in IMG/M
3300028718|Ga0307307_10062513All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1102Open in IMG/M
3300028719|Ga0307301_10063143All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1149Open in IMG/M
3300028754|Ga0307297_10334287Not Available552Open in IMG/M
3300028755|Ga0307316_10027762All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1835Open in IMG/M
3300028778|Ga0307288_10048270All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1459Open in IMG/M
3300028782|Ga0307306_10043600All Organisms → cellular organisms → Bacteria1100Open in IMG/M
3300028784|Ga0307282_10092626All Organisms → cellular organisms → Bacteria1395Open in IMG/M
3300028784|Ga0307282_10278521Not Available805Open in IMG/M
3300028787|Ga0307323_10029272All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1909Open in IMG/M
3300028787|Ga0307323_10218328All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Kribbellaceae → Kribbella → unclassified Kribbella → Kribbella sp. VKM Ac-2527688Open in IMG/M
3300028796|Ga0307287_10004637All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria4472Open in IMG/M
3300028810|Ga0307294_10066394Not Available1081Open in IMG/M
3300028819|Ga0307296_10283038Not Available903Open in IMG/M
3300028819|Ga0307296_10746154Not Available534Open in IMG/M
3300028824|Ga0307310_10652114Not Available538Open in IMG/M
3300028824|Ga0307310_10687903Not Available524Open in IMG/M
3300028872|Ga0307314_10029056All Organisms → cellular organisms → Bacteria1302Open in IMG/M
3300028872|Ga0307314_10180223All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria626Open in IMG/M
3300028875|Ga0307289_10061262All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1513Open in IMG/M
3300028875|Ga0307289_10225349Not Available771Open in IMG/M
3300028876|Ga0307286_10222689Not Available687Open in IMG/M
3300028876|Ga0307286_10398607All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria516Open in IMG/M
3300028880|Ga0307300_10097764All Organisms → cellular organisms → Bacteria883Open in IMG/M
3300028880|Ga0307300_10265807Not Available573Open in IMG/M
3300028881|Ga0307277_10572379All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria507Open in IMG/M
3300028884|Ga0307308_10075572All Organisms → cellular organisms → Bacteria1594Open in IMG/M
3300028885|Ga0307304_10495451All Organisms → cellular organisms → Bacteria559Open in IMG/M
3300029636|Ga0222749_10453170All Organisms → cellular organisms → Bacteria687Open in IMG/M
3300030336|Ga0247826_10212049All Organisms → cellular organisms → Bacteria1333Open in IMG/M
3300030336|Ga0247826_10223107All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → Solirubrobacter soli1305Open in IMG/M
3300030511|Ga0268241_10110274All Organisms → cellular organisms → Bacteria645Open in IMG/M
3300030511|Ga0268241_10160961Not Available554Open in IMG/M
3300031184|Ga0307499_10210321All Organisms → cellular organisms → Bacteria603Open in IMG/M
3300031548|Ga0307408_101045820All Organisms → cellular organisms → Bacteria755Open in IMG/M
3300031548|Ga0307408_101904701Not Available570Open in IMG/M
3300031564|Ga0318573_10004134All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria5615Open in IMG/M
3300031572|Ga0318515_10339526All Organisms → cellular organisms → Bacteria806Open in IMG/M
3300031668|Ga0318542_10190296All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae1032Open in IMG/M
3300031679|Ga0318561_10168513All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Kribbellaceae → Kribbella → unclassified Kribbella → Kribbella sp. VKM Ac-25271181Open in IMG/M
3300031681|Ga0318572_10419811All Organisms → cellular organisms → Bacteria795Open in IMG/M
3300031681|Ga0318572_10466239All Organisms → cellular organisms → Bacteria752Open in IMG/M
3300031682|Ga0318560_10630094All Organisms → cellular organisms → Bacteria580Open in IMG/M
3300031713|Ga0318496_10295715All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae894Open in IMG/M
3300031719|Ga0306917_10368972All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae1118Open in IMG/M
3300031731|Ga0307405_10941967All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Kribbellaceae → Kribbella → unclassified Kribbella → Kribbella sp. VKM Ac-2527733Open in IMG/M
3300031747|Ga0318502_10043257All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Kribbellaceae → Kribbella → unclassified Kribbella → Kribbella sp. VKM Ac-25272342Open in IMG/M
3300031748|Ga0318492_10825434All Organisms → cellular organisms → Bacteria500Open in IMG/M
3300031751|Ga0318494_10731388All Organisms → cellular organisms → Bacteria579Open in IMG/M
3300031764|Ga0318535_10254367All Organisms → cellular organisms → Bacteria786Open in IMG/M
3300031764|Ga0318535_10368978All Organisms → cellular organisms → Bacteria641Open in IMG/M
3300031765|Ga0318554_10128584All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales1433Open in IMG/M
3300031765|Ga0318554_10811875Not Available523Open in IMG/M
3300031768|Ga0318509_10035222All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2473Open in IMG/M
3300031768|Ga0318509_10456623All Organisms → cellular organisms → Bacteria714Open in IMG/M
3300031769|Ga0318526_10316599All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria638Open in IMG/M
3300031779|Ga0318566_10363385All Organisms → cellular organisms → Bacteria714Open in IMG/M
3300031792|Ga0318529_10202245Not Available921Open in IMG/M
3300031795|Ga0318557_10409087All Organisms → cellular organisms → Bacteria624Open in IMG/M
3300031796|Ga0318576_10041890All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1952Open in IMG/M
3300031805|Ga0318497_10420896All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Kribbellaceae → Kribbella → unclassified Kribbella → Kribbella sp. VKM Ac-2527747Open in IMG/M
3300031831|Ga0318564_10031979All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2242Open in IMG/M
3300031846|Ga0318512_10730225All Organisms → cellular organisms → Bacteria509Open in IMG/M
3300031852|Ga0307410_10658682All Organisms → cellular organisms → Bacteria879Open in IMG/M
3300031859|Ga0318527_10050532All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1618Open in IMG/M
3300031896|Ga0318551_10103944All Organisms → cellular organisms → Bacteria1514Open in IMG/M
3300031901|Ga0307406_10715324All Organisms → cellular organisms → Bacteria837Open in IMG/M
3300031901|Ga0307406_11872242All Organisms → cellular organisms → Bacteria534Open in IMG/M
3300031911|Ga0307412_10934829All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Kribbellaceae → Kribbella → unclassified Kribbella → Kribbella sp. VKM Ac-2527762Open in IMG/M
3300031912|Ga0306921_11688645All Organisms → cellular organisms → Bacteria685Open in IMG/M
3300031938|Ga0308175_100989468All Organisms → cellular organisms → Bacteria929Open in IMG/M
3300031959|Ga0318530_10217662All Organisms → cellular organisms → Bacteria785Open in IMG/M
3300031995|Ga0307409_101977603Not Available612Open in IMG/M
3300032001|Ga0306922_11512320All Organisms → cellular organisms → Bacteria671Open in IMG/M
3300032002|Ga0307416_102603375All Organisms → cellular organisms → Bacteria603Open in IMG/M
3300032002|Ga0307416_103222781Not Available546Open in IMG/M
3300032004|Ga0307414_10350873All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales1266Open in IMG/M
3300032004|Ga0307414_11392509All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Kribbellaceae → Kribbella → unclassified Kribbella → Kribbella sp. VKM Ac-2527652Open in IMG/M
3300032010|Ga0318569_10311312All Organisms → cellular organisms → Bacteria733Open in IMG/M
3300032051|Ga0318532_10239435All Organisms → cellular organisms → Bacteria644Open in IMG/M
3300032052|Ga0318506_10243272All Organisms → cellular organisms → Bacteria796Open in IMG/M
3300032067|Ga0318524_10143046All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae1206Open in IMG/M
3300032067|Ga0318524_10747970All Organisms → cellular organisms → Bacteria516Open in IMG/M
3300032080|Ga0326721_10307864All Organisms → cellular organisms → Bacteria886Open in IMG/M
3300032090|Ga0318518_10033350All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2371Open in IMG/M
3300032090|Ga0318518_10334470All Organisms → cellular organisms → Bacteria777Open in IMG/M
3300032091|Ga0318577_10135432All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Kribbellaceae → Kribbella → unclassified Kribbella → Kribbella sp. VKM Ac-25271168Open in IMG/M
3300032091|Ga0318577_10257252All Organisms → cellular organisms → Bacteria836Open in IMG/M
3300032094|Ga0318540_10611534All Organisms → cellular organisms → Bacteria525Open in IMG/M
3300032126|Ga0307415_100063446All Organisms → cellular organisms → Bacteria → Acidobacteria2567Open in IMG/M
3300032126|Ga0307415_101106486All Organisms → cellular organisms → Bacteria742Open in IMG/M
3300032159|Ga0268251_10016790All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae2123Open in IMG/M
3300032205|Ga0307472_100414504All Organisms → cellular organisms → Bacteria1132Open in IMG/M
3300032205|Ga0307472_102414582All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria533Open in IMG/M
3300032770|Ga0335085_10285913All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1962Open in IMG/M
3300032782|Ga0335082_10416319All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae1208Open in IMG/M
3300032805|Ga0335078_11056244All Organisms → cellular organisms → Bacteria955Open in IMG/M
3300033004|Ga0335084_10264181All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1782Open in IMG/M
3300033550|Ga0247829_10958636All Organisms → cellular organisms → Bacteria711Open in IMG/M
3300033550|Ga0247829_11087323Not Available664Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil16.48%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil12.64%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil5.75%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere5.75%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere5.36%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil4.21%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil4.21%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil3.07%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.68%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil2.68%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil1.92%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.92%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere1.92%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.53%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.53%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.53%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.15%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.15%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.15%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.15%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.15%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil1.15%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand1.15%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.15%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.15%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.15%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.77%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.77%
SoilEnvironmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil0.77%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere0.77%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.77%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.77%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.77%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.77%
AgaveHost-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave0.77%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil0.38%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.38%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost0.38%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Soil0.38%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.38%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.38%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.38%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.38%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.38%
SoilEnvironmental → Terrestrial → Soil → Sand → Desert → Soil0.38%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere0.38%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.38%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere0.38%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Unclassified → Tabebuia Heterophylla Rhizosphere0.38%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.38%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.38%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.38%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.38%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.38%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere0.38%
AgaveHost-Associated → Plants → Phyllosphere → Phylloplane/Leaf Surface → Unclassified → Agave0.38%
Tropical Rainforest SoilEnvironmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil0.38%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2140918007Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Active_allEnvironmentalOpen in IMG/M
2170459024Grass soil microbial communities from Rothamsted Park, UK - FD1 (NaCl 300g/L 5ml)EnvironmentalOpen in IMG/M
3300000443Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.2B clc assemlyEnvironmentalOpen in IMG/M
3300000955Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300001305Grasslands soil microbial communities from Hopland, California, USAEnvironmentalOpen in IMG/M
3300001431Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemlyEnvironmentalOpen in IMG/M
3300001527Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A3-5cm-13A)- 1 week illuminaEnvironmentalOpen in IMG/M
3300002568Grasslands soil microbial communities from Hopland, California, USA - 2EnvironmentalOpen in IMG/M
3300003373Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1Host-AssociatedOpen in IMG/M
3300003659Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1Host-AssociatedOpen in IMG/M
3300004016Agave microbial communities from Guanajuato, Mexico - As.Ma.rzHost-AssociatedOpen in IMG/M
3300004081Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2)EnvironmentalOpen in IMG/M
3300004153Grasslands soil microbial communities from Hopland, California, USA (version 2)EnvironmentalOpen in IMG/M
3300004157Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2EnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300005180Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005335Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaGHost-AssociatedOpen in IMG/M
3300005356Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaGHost-AssociatedOpen in IMG/M
3300005363Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005451Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130EnvironmentalOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005468Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaGEnvironmentalOpen in IMG/M
3300005530Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaGEnvironmentalOpen in IMG/M
3300005536Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaGEnvironmentalOpen in IMG/M
3300005561Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148EnvironmentalOpen in IMG/M
3300005563Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2Host-AssociatedOpen in IMG/M
3300005568Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152EnvironmentalOpen in IMG/M
3300005578Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2Host-AssociatedOpen in IMG/M
3300005618Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2Host-AssociatedOpen in IMG/M
3300005844Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2Host-AssociatedOpen in IMG/M
3300006034Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105EnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006358Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2Host-AssociatedOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006800Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109EnvironmentalOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300006914Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5Host-AssociatedOpen in IMG/M
3300006953Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300007790Microbial communities of desert soil contaminated with blood from dead anthrax infected zebra in Etosha National Park, Namibia. Combined Assembly of 14 sequencing projectsEnvironmentalOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300009805Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_0_10EnvironmentalOpen in IMG/M
3300009840Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105AEnvironmentalOpen in IMG/M
3300010029Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_10_20EnvironmentalOpen in IMG/M
3300010036Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26EnvironmentalOpen in IMG/M
3300010037Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25EnvironmentalOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010044Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60EnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010303Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300012198Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012200Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012201Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012353Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012354Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012355Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaGEnvironmentalOpen in IMG/M
3300012356Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012360Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaGEnvironmentalOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012494Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610Host-AssociatedOpen in IMG/M
3300012515Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610Host-AssociatedOpen in IMG/M
3300012532Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012924Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012925Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012937Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t5i015EnvironmentalOpen in IMG/M
3300012939Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t1i015EnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300012955Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MGEnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300012977Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300013102Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaGHost-AssociatedOpen in IMG/M
3300013105Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaGHost-AssociatedOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300015357Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaGEnvironmentalOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300016319Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00HEnvironmentalOpen in IMG/M
3300017997Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coexEnvironmentalOpen in IMG/M
3300018060Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MGEnvironmentalOpen in IMG/M
3300018066Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_b1EnvironmentalOpen in IMG/M
3300018081Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1EnvironmentalOpen in IMG/M
3300018429Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 TEnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300020002Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a1EnvironmentalOpen in IMG/M
3300020070Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300021078Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_coex redoEnvironmentalOpen in IMG/M
3300021082Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_coex redoEnvironmentalOpen in IMG/M
3300021445Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaGEnvironmentalOpen in IMG/M
3300021479Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-MEnvironmentalOpen in IMG/M
3300021510Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_coexEnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300024179Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK36EnvironmentalOpen in IMG/M
3300024187Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK13EnvironmentalOpen in IMG/M
3300024317Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK01EnvironmentalOpen in IMG/M
3300025885Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025899Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025905Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025918Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025924Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025925Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025937Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025945Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025961Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025981Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026095Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026121Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026309Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes)EnvironmentalOpen in IMG/M
3300026322Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 (SPAdes)EnvironmentalOpen in IMG/M
3300026995Soil and rhizosphere microbial communities from Laval, Canada - mgLAB (SPAdes)EnvironmentalOpen in IMG/M
3300027718Agave microbial communities from Guanajuato, Mexico - Or.Ma.rz (SPAdes)Host-AssociatedOpen in IMG/M
3300027725Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes)EnvironmentalOpen in IMG/M
3300027775Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes)EnvironmentalOpen in IMG/M
3300027909Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)Host-AssociatedOpen in IMG/M
3300027954Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_50_60 (SPAdes)EnvironmentalOpen in IMG/M
3300028380Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028587Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3EnvironmentalOpen in IMG/M
3300028592Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30EnvironmentalOpen in IMG/M
3300028597Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day14EnvironmentalOpen in IMG/M
3300028718Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_194EnvironmentalOpen in IMG/M
3300028719Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_182EnvironmentalOpen in IMG/M
3300028754Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_157EnvironmentalOpen in IMG/M
3300028755Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_356EnvironmentalOpen in IMG/M
3300028778Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_142EnvironmentalOpen in IMG/M
3300028782Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_193EnvironmentalOpen in IMG/M
3300028784Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121EnvironmentalOpen in IMG/M
3300028787Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_381EnvironmentalOpen in IMG/M
3300028796Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_141EnvironmentalOpen in IMG/M
3300028810Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_151EnvironmentalOpen in IMG/M
3300028819Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153EnvironmentalOpen in IMG/M
3300028824Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197EnvironmentalOpen in IMG/M
3300028872Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_204EnvironmentalOpen in IMG/M
3300028875Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143EnvironmentalOpen in IMG/M
3300028876Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_140EnvironmentalOpen in IMG/M
3300028880Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_181EnvironmentalOpen in IMG/M
3300028881Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116EnvironmentalOpen in IMG/M
3300028884Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195EnvironmentalOpen in IMG/M
3300028885Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185EnvironmentalOpen in IMG/M
3300029636Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030336Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1EnvironmentalOpen in IMG/M
3300030511Bulk soil microbial communities from Mexico - Amatitan (Am) metaG (v2)EnvironmentalOpen in IMG/M
3300031184Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 13_SEnvironmentalOpen in IMG/M
3300031548Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3Host-AssociatedOpen in IMG/M
3300031564Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21EnvironmentalOpen in IMG/M
3300031572Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19EnvironmentalOpen in IMG/M
3300031668Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23EnvironmentalOpen in IMG/M
3300031679Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23EnvironmentalOpen in IMG/M
3300031681Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20EnvironmentalOpen in IMG/M
3300031682Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22EnvironmentalOpen in IMG/M
3300031713Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22EnvironmentalOpen in IMG/M
3300031719Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2)EnvironmentalOpen in IMG/M
3300031731Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1Host-AssociatedOpen in IMG/M
3300031747Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22EnvironmentalOpen in IMG/M
3300031748Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22EnvironmentalOpen in IMG/M
3300031751Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24EnvironmentalOpen in IMG/M
3300031764Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27EnvironmentalOpen in IMG/M
3300031765Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22EnvironmentalOpen in IMG/M
3300031768Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22EnvironmentalOpen in IMG/M
3300031769Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24EnvironmentalOpen in IMG/M
3300031779Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22EnvironmentalOpen in IMG/M
3300031792Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23EnvironmentalOpen in IMG/M
3300031795Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19EnvironmentalOpen in IMG/M
3300031796Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24EnvironmentalOpen in IMG/M
3300031805Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23EnvironmentalOpen in IMG/M
3300031831Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20EnvironmentalOpen in IMG/M
3300031846Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19EnvironmentalOpen in IMG/M
3300031852Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3Host-AssociatedOpen in IMG/M
3300031859Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25EnvironmentalOpen in IMG/M
3300031896Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19EnvironmentalOpen in IMG/M
3300031901Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2Host-AssociatedOpen in IMG/M
3300031911Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1Host-AssociatedOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031938Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1EnvironmentalOpen in IMG/M
3300031959Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24EnvironmentalOpen in IMG/M
3300031995Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2Host-AssociatedOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032002Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3Host-AssociatedOpen in IMG/M
3300032004Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3Host-AssociatedOpen in IMG/M
3300032010Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22EnvironmentalOpen in IMG/M
3300032051Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f26EnvironmentalOpen in IMG/M
3300032052Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19EnvironmentalOpen in IMG/M
3300032067Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22EnvironmentalOpen in IMG/M
3300032080Soil microbial communities from Southern Great Plains, Lamont, Oklahoma, United States - SGP_1_2016EnvironmentalOpen in IMG/M
3300032090Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22EnvironmentalOpen in IMG/M
3300032091Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25EnvironmentalOpen in IMG/M
3300032094Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25EnvironmentalOpen in IMG/M
3300032126Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2Host-AssociatedOpen in IMG/M
3300032159Agave microbial communities from Guanajuato, Mexico - As.Ma.e (v2)Host-AssociatedOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300032782Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1EnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M
3300033004Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4EnvironmentalOpen in IMG/M
3300033550Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
A_all_C_026770702140918007SoilMEPRNVETYRAGHEAFNQRDFEAMTKQYADSITWTDHPQGRTFRTPQEFKD
FD1_024508202170459024Grass SoilMESRNVETYRAGHEAFNQRDFVAMTKLYADSITWTDHSQGRTFRTPREFQDDFL
F12B_1003183523300000443SoilMASRNVETYRAGHEAFNQRDFEAMTRHYAHSIVWTDRAQGRTFRTPREFRDDFLAGWV
JGI1027J12803_10878235833300000955SoilAVMESPNVETHRAGHEAFNQRDFVAMTKQYATSITWTDHAQGRTFRTPQRFRD
JGI10216J12902_10129589313300000956SoilMESRNVQTYRAGHGAFNQRDFRGMTSQYAESIAWTDHAQGRTFRTPQEFKDDFL
JGI10216J12902_10669586113300000956SoilMPSRNVEAHRAGHQAFNQRDFEAMTRHYADSIAWT
C688J14111_1027009823300001305SoilMASGNVDTYRAGHEAFNRRDFAAMTSGYDDSITWTDHAQGRTFRTA
F14TB_10085706613300001431SoilMATTNVEAHRAGHEAFNRRDFQAMTEHYADSIAWTDHAQGRTFRTPQEFRDDFL
A3513AW1_105047423300001527PermafrostMESRNVQTYRAGHEAFNQRDFGAMTKQYADSISWTDHSQGRTFSTPQE
C688J35102_11913723113300002568SoilMTSENVETYRAGHEAFNRRDFEAMTRRYADSIAWTDHPQSRTFRTPREFMADFL
JGI25407J50210_1002253113300003373Tabebuia Heterophylla RhizosphereMASRNIEIYRAGHEAFNRRDFEAMTRHYADSITWTDHAQG
JGI25404J52841_1009561113300003659Tabebuia Heterophylla RhizosphereMASRNNDTHRAGHEAFNQRDFEAMTKNYEDSISWTDHSQGRTFTLREDF
Ga0058689_1002690013300004016AgaveMPSENVEAHRAGHEAFNRRDFQAMTSRYADTIEWTDHAQGRTFRTPQEFR
Ga0063454_10104607813300004081SoilMAARNVESHRAGHQAFNRRDFEAMTGRYAERITWTDHAQGRTFRTRREFTEDFL
Ga0063454_10125973313300004081SoilMTPANVEIHRTGHQAFNHRDFESMVEHYADTISWTDHSQGRTFRTPAEFRDDFLPGWVTA
Ga0063455_10156396913300004153SoilMASSNVDTYRAGHEAFNQRNFEAMTKRFADSIDWTDHSQGRTFRTRQEF
Ga0062590_10305648913300004157SoilMSSRNVQIHRDGHRAFNERDFESMTTHYADIIDWTDHSQGRTFTTP
Ga0062595_10148336823300004479SoilMESSNVETYRAGHQAFNQRDFMAMTRQYAESITWTDHSQGRTFSTPQQFRDDFLAGWVGASR
Ga0062595_10153275423300004479SoilMESRNAETYRAGHEAFNQRDFEAMTKQYADSITWTDHSQGRTFRTPQEFKDD
Ga0066685_1056891223300005180SoilMESPNVETHRAGHEAFNQRDFAAMTKQYADSITWTDHSQGRTFRTP
Ga0066388_10269775913300005332Tropical Forest SoilMASTNVETYRAGHEAFNQRNFEAMTKHYADSIAWTDHSQGRTF
Ga0070666_1030878813300005335Switchgrass RhizosphereMTANVENYRAGHEAFNRRDFTAMTQHYAPGISWTDHAQGRTF
Ga0070674_10120750513300005356Miscanthus RhizosphereMESRNVETYRAGHEAFNQRDFVAMTKLYADSITWTDHSQGRTFRTPREFR
Ga0008090_1536338313300005363Tropical Rainforest SoilMESRNVENYRAGHEAFNHRDFVAMTKHYADSITWTDHAQGRTFRTPQEFRDDFLA
Ga0070709_1020766513300005434Corn, Switchgrass And Miscanthus RhizosphereMESPNVETYRAGHEAFNQRDFVAMTKQYADSITWTDHSQGRTFRTPQEFRDDFLAGW
Ga0070714_10046838713300005435Agricultural SoilMESRNVHNYRAGHEAFNLRDFDAMTKHYADSITWTDHSQG
Ga0066681_1020674613300005451SoilMESPNVETYRAGHEAFNQRDFVTMTKLYADRITWTDHAQGRTFRTPREFRDDFLAGW
Ga0070706_10067327923300005467Corn, Switchgrass And Miscanthus RhizosphereMASRNIETHRAGHEAFNQRDFEAMTKHYADSISWTDHSQG
Ga0070707_10102585123300005468Corn, Switchgrass And Miscanthus RhizosphereMASRNIETHRAGHEAFNQRDFEAMTKHYEDSISWTDHSQGRTFATRQ
Ga0070679_10103589813300005530Corn RhizosphereRAGHEAFNQRDFEAMTKHYEDSISWTDHSQGRTFATRQEFRDDFLPGWVRTSSDI*
Ga0070697_10059517623300005536Corn, Switchgrass And Miscanthus RhizosphereMESPNVETHRAGHEAFNQRDFVAMTKQYADSITWTDHSQGRTFRTPQEFRDDFLAG
Ga0066699_1127327813300005561SoilMATRDVETYRAGHEAFNQRDFEAMTKQYADSITWTDRARGLTFRTPQEFKDEF
Ga0068855_10149178813300005563Corn RhizosphereMESPNVETHRAGHENFNQRDFVAMTKLYADSITWTDH
Ga0066703_1067891113300005568SoilMESPNVETHRAGHEAFNQRDFVAMTKQYADSITWTDHSQGRTFRT
Ga0068854_10001440983300005578Corn RhizosphereMTANVENYRAGHEAFNRRDFTAMTQHYAPGISWTDHAQGRTFGTPEE
Ga0068864_10045859613300005618Switchgrass RhizosphereMTSSNVETYRAGHEAFNQRDFETMTKQYADSIAWTDHPQGRTFRTPQEFKDDFMPR
Ga0068862_10130335623300005844Switchgrass RhizosphereMESPNVETHRAGHEAFNQRDFAAMTKLYSDRITWTDHAQGRSFRT
Ga0066656_1080665733300006034SoilMMSINVETYRAGHDAFNQRDFGAMVKQYADRISWTDRARGLTFSTPQEFKDVFLAGWVESSPNIRITNPCYIDAGQTVVCT
Ga0070716_10000768883300006173Corn, Switchgrass And Miscanthus RhizosphereMESPNVETHRAGHEAFNQRDFVAMTRQYADSITWTDHSQ
Ga0070712_10115453423300006175Corn, Switchgrass And Miscanthus RhizosphereMASSNVEAYRAGHEAFNQREFESMTRQYADSIAWTDHPQGRTFSTP
Ga0068871_10156475713300006358Miscanthus RhizosphereMESRNAETYRAGHEAFNQRDFEAMTKQYADSITWTDHSQGRTFRTPQEFKDDFLA
Ga0079222_1066334823300006755Agricultural SoilMASRNIETHRAGHEAFNQRDFEAMTKHYADSISWTDH
Ga0066660_1036434513300006800SoilMESPNVETHRAGHEAFNQRDFAAMTKQYADSITWTDHSQGRTFRTPQEFRDDFL
Ga0075434_10224928623300006871Populus RhizosphereMESPNVETHRAGHEAFNQRDFAAMTKLYSDSITWTDHAQGRTFRTPQRFRD
Ga0075424_10041312213300006904Populus RhizosphereMASRNIETHRAGHEAFNQRDFEAMTKHYADSISWT
Ga0075436_10020520043300006914Populus RhizosphereMASRNIETHRAGHEAFNQRDFEAMTKHYADSISWTD
Ga0074063_1310348023300006953SoilMTSENVETYRAGHEAFNRRDFVAMTKQYADTITWTD
Ga0074063_1410205813300006953SoilMESPNVETHRAGHEAFNQRDFVAMTKLYADSITWTDHAQGRTFRTPQRFREDFLA
Ga0079219_1022029723300006954Agricultural SoilMVSTNVKTHRAGHEAFNQRDFVAMTNQYAESITWTVHSQGRTFRTPEEFRADFLPGWVAA
Ga0105679_1034193973300007790SoilMAASYVERHRAGHQAFNRRDFEAMTRHYADSITWTD
Ga0075418_1120770023300009100Populus RhizosphereMASRNVEAHRAGHEAFNQRDFEAMTKEYADRIGWTDHAQGRTFTTPQEFRDD
Ga0105243_1147694423300009148Miscanthus RhizosphereMTSENVETYRAGHEAFNRRDFAAMTRRYADSITWTDHPQGR
Ga0105241_1243591613300009174Corn RhizosphereMASRNIETYRAGHMAFNRRDFEGMTERYADSITWTDHSQGRTFRTPQEFRVDFLPAWVAASSDIRITAP
Ga0105248_1061155733300009177Switchgrass RhizosphereMESPNVETHRAGHEAFNQRDFAAMTKLYSDSITWTDHAQGRTFRTPQRFRDDFLPGWVE
Ga0105249_1322075113300009553Switchgrass RhizosphereMAASNVAAHRAGHQAFNGRDFEAMTSRYADSISWTDHAQGS
Ga0126374_1036466923300009792Tropical Forest SoilMESSNVETHRAGHEAFNQRDFVAMTRQYADNITWTDHAQGRTFRTPQEFR
Ga0105079_100289023300009805Groundwater SandMASRNPETYRVGHEAFNQRDFEAMTKHYADSITWTDRARGLTFRTPQEFKDDFL
Ga0126313_1020881613300009840Serpentine SoilMAASNVDRHHAGHEAFNRRDFAAMTTHYADHIHWTDRARGLTFTTPAQFRDEF
Ga0126313_1183325023300009840Serpentine SoilMAPRNVETHRAGHEAFNRRDFAAMTSRYADSIAWTDHAQGRTFR
Ga0105074_107515923300010029Groundwater SandMAASNVETYRAGHEAFNRRDFEAMTEHYADGIAWTDRARGLTFRTPRE
Ga0126305_1085150013300010036Serpentine SoilMASRNVEAHRAGHEAFNQRDFGAMTKEYDDRIAWTDHAQGRTFTTPQEFRDDF
Ga0126304_1047616513300010037Serpentine SoilMAASNVEAYRAGHEAFNRREFEAMTNHYADSIAWTDHAQGWTFRTPREFKEDFLPGW
Ga0126380_1076649923300010043Tropical Forest SoilMASTNVETYRAGHEAFNQRNFEAMTKHYADSIAWTDHSQGR
Ga0126380_1084900623300010043Tropical Forest SoilMASSNVETHRAGHEAFNQRDFEAMTKNYADSIAWTDHSQGRTFGTPQEFK
Ga0126380_1087061923300010043Tropical Forest SoilMESRNVETHRAGHEAFNKRDFVAMTNQYAESITWTDHSQGRTFR
Ga0126310_1152168823300010044Serpentine SoilMSASNLEAYRAGHEAFNRRDFEAMTRQYADSIAWTDRAQGRTFTTPQEFRD
Ga0126384_1023315613300010046Tropical Forest SoilMESSNVQTYRTGHEAFNQRDFVAMTRQYADSITWTDHAQGRTF
Ga0126373_1268272923300010048Tropical Forest SoilMEPRNVETHRAGHRAFNQREFAVMTSQYAESISWTDHSQGRTFRTPQEFRADFLTGWVAASSDIKVTD
Ga0134082_1024722213300010303Grasslands SoilMESRNVATYQAGHEAFNQRDFVAMTKLYADSITWTDHSQGRTFRTPPEFRDDFLAGW
Ga0126376_1258763013300010359Tropical Forest SoilMSHSNLETYRAGHAAFNQRDFEAMVRAYADTITWTDRARGLTFTTPGEFKKVFLAGWVQASSDI
Ga0126372_1284051113300010360Tropical Forest SoilMASSNVETYRAGHEAFNDRDFEAMTKHYADSIAWTDHSQGRTFRTPQEFKEDF
Ga0126378_1234841613300010361Tropical Forest SoilMVSSNVETYRAGHEAFNRRDFEAMTKYYADSIAWTDHAQGR
Ga0134128_1289588623300010373Terrestrial SoilMESPNVETHRAGHEAFNQRDFVAMTRKYADSITWTDHSQGRTFRTPMEFRDDFLT
Ga0126383_1326843813300010398Tropical Forest SoilMESSNVETHRAGHEAFNRRDFVAMTSHYADSIAWTDHAQG
Ga0134121_1184713113300010401Terrestrial SoilMESRNAETYRAGHEAFNQRDFEAMTKQYADSITWTDHSQGRTFRTPQEFKDDFL
Ga0134121_1314687713300010401Terrestrial SoilMTSENVETYRAGHEAFNRRDFAAMTRRYADSITWTDRPQGRTFRT
Ga0137364_1129545123300012198Vadose Zone SoilMTSKTLANYRAGHEAFNKRDFEAMTKHYADSITWT
Ga0137382_1019411823300012200Vadose Zone SoilMESKNVRNYRAGHEAFNQRDFDAMTKHYADSITWTDHSQGRTFTTPQEFKDDF
Ga0137382_1116745423300012200Vadose Zone SoilMASGNIETHRAGHEAFNQRDFEAMTKHYEDTISWTDHSQG
Ga0137365_1010432253300012201Vadose Zone SoilMESRNVETYRAGHEAFNRRDFDAMTKHYADGITWTDHSQGRTFRTPQQFKDDF
Ga0137376_1101838633300012208Vadose Zone SoilMGSKNVDTYRAGHEAFNQRDFSAMISHYADSITWT
Ga0137367_10005657113300012353Vadose Zone SoilMASRNVETYRAGHEAFNQRDFGAMTKQYADSIAWTDHSQ
Ga0137366_1103492623300012354Vadose Zone SoilMKSPNAETYRAGHEAFNQRDFVAMTKHYADCITWTDHAQGRTFRTPQEFRDDFLAGWIGASPDIR
Ga0137369_1043659923300012355Vadose Zone SoilMASRNVETYRAGHEAFNQRDFEAMTKQYADSIAWTDHPQGRTFR
Ga0137371_1006169143300012356Vadose Zone SoilMASSNVETYRAGHEAFNQRDFEAMTKHYADSIAWTDHSQG
Ga0137375_1005878833300012360Vadose Zone SoilMASRNVETYRAGHEAFNQRDFEAMTKQYADSIAWTDHPQGRTFRTPQEF
Ga0137375_1062463813300012360Vadose Zone SoilMESRNVETYRVGHEAFNQRDFEAMTKHYADSIAWTDHSQGRTF
Ga0137375_1113594913300012360Vadose Zone SoilMESQNVETHRAGHEAFNQRDFVAMTKLYADSITWTDHSQGRTFRTPRE
Ga0150984_10216386523300012469Avena Fatua RhizosphereMTSVNVEIHRTGHKAFNARDFEAMTGHYADTIRWTDHSQGRTFRTPGEFRADFLPGWVTA
Ga0157341_100634013300012494Arabidopsis RhizosphereMESRNVETHRAGHEAFNQRDFAAMTSKYADGIRWTDHSQ
Ga0157338_101067223300012515Arabidopsis RhizosphereMESSNVKTHRAGHEAFNQRDFVAMTRQYADSITWTDH
Ga0137373_1019959113300012532Vadose Zone SoilMAASNVEAHRAGHEAFNQRDFEAMTKHYADSIAWTDH
Ga0137413_1114958113300012924Vadose Zone SoilMESKNVQNYRAGHEAFNQRDFDAMTKHYADSITWTDHSQGRT
Ga0137419_1198254413300012925Vadose Zone SoilMESRNVETYRAGHEAFNQRDFVAMTRQYADSISWTDHSQG
Ga0162653_10007816823300012937SoilMASSNVDAHRAGHEAFNRRDFETMTNHYADSIAWTDHAQGRTFRTPEEFKDEFL
Ga0162650_10003987123300012939SoilMAASNVEAHRAGHEAFNRRDFQAMTERYADSIAWTDHSQNRTFRTRQEFRDDFLPG
Ga0126375_1046322413300012948Tropical Forest SoilMESRNAQAYRAGHEAFNQRDFAGMTSQYAESITWTDHSQGRTFTTPQEFKDDFL
Ga0164298_1147380013300012955SoilMESRNVQTYRAGHQAFNQRDFVAMTKQYAESITWTDHS
Ga0164301_1121175623300012960SoilMESPNVATHRAGHEACNRRDFVAMTRRYADGISWTDHSQGRTFSTPQ
Ga0134087_1049607823300012977Grasslands SoilMASRNVETYRAGHEAFNQRDFEAMTRHYADSIAWTDHS
Ga0157371_1013293913300013102Corn RhizosphereMESPNVETHRAGHEAFNQRDFAAMTKLYSDSITWTDHAQGRTFRTPQRFRDDFL
Ga0157369_1098277723300013105Corn RhizosphereMESPNVATHRAGHEAFNRRDFVAMTRRYADGISWTDHSQGR
Ga0157380_1129950223300014326Switchgrass RhizosphereMTANVENYRAGHEAFNRRDFTAMTQHYAPGISWTDHAQGRTFGTPE
Ga0157376_1035037733300014969Miscanthus RhizosphereMTSENVETYRAGHEAFNRRDFAAMTRRYADSITWTDHSQGRTFRTPREFTADFLA
Ga0134072_1030202613300015357Grasslands SoilMASSNVETYRAGHEAFNQRDFEAMTKHYTDSIAWTDHPQGRTF
Ga0132255_10300467823300015374Arabidopsis RhizosphereMGMHSRNVETYRAGHEAFNERDFDAMVKHYADSIRW
Ga0132255_10388626513300015374Arabidopsis RhizosphereMESSNVKTHRAGHEAFNQRDFVAMTRQYADSITWTDHSQGRTFRTPQEFRDDFL
Ga0132255_10586013113300015374Arabidopsis RhizosphereMESPNVGTHRSGHEAFNQRDFVAMTRQYTDNISWT
Ga0182033_1076885113300016319SoilMESPNIEIYRAGHEAFNRRDFAAMTKQYADSITWTDHAQGRTFRTPQEFADDFLPG
Ga0184610_103824113300017997Groundwater SedimentMTASNVERHRAGHQAFNQRDFESMTKHYADSIAWTDHSQGRTFRTPQEF
Ga0187765_1122860013300018060Tropical PeatlandMESSNVETYRAGHQAFNQRDFVVMTRQYAESISWTDHSQGRTFSTPQEFRDD
Ga0184617_122124713300018066Groundwater SedimentMTSENVETYRAGHEAFNRRDFAAMTRRYADSITWTDHPQ
Ga0184625_1019007023300018081Groundwater SedimentMASSNVEAHRAGHEAFNRRDFQAMTEHYADHIAWTDHSQGRTFRTPQEFRTDFLPGWVE
Ga0190272_1280433823300018429SoilMASSNVEAHRAGHEAFNRRDFQAMTEHYADSITWTDHAQGRTFR
Ga0066667_1145379823300018433Grasslands SoilMTSENVETYRAGHEAFNRRDFAAMTRRYADSITWTDHPQGRTFRTPREF
Ga0193730_110955413300020002SoilMESTNVRNYRAGHEAFNQRDFDAMTKHYADSITWTDHSQGRTFTTPQEIK
Ga0206356_1068934913300020070Corn, Switchgrass And Miscanthus RhizosphereMTANVENYRAGHEAFNRRDFTAMTQHYAPGISWTDHAQGRTFGTPEEFRTEFLAGWL
Ga0210381_1003135543300021078Groundwater SedimentMASSNVEAHRAGHEAFNRRDFQAMTEHYADHIAWTDHSQGR
Ga0210380_1022439833300021082Groundwater SedimentMALINVETYRAGHDAFNQRDFDAMVQHYADTIRWTDRARGLTFSTPQEFKDDFLAG
Ga0182009_1007910213300021445SoilMTANVENYRAGHEAFNRRDFAAMTEHYAAGISWTDHAQGRTFGTPEEFRTDFLAGWLGVSSDIRISD
Ga0182009_1009843113300021445SoilMESKNIETHRACHEAFNQRDFVAMTRQYADSITWTDHAQGRTF
Ga0210410_1172379613300021479SoilMESRNVKTHRAGHEAFNQRDFVAMTRQYAASITWTDHSQGRTFRTPREFKDDFLPGW
Ga0222621_109547023300021510Groundwater SedimentMAASNVEAHRAGHEAFNRRDFQAMTEHYADRIDWTDHPQGRTFRT
Ga0222622_1114248213300022756Groundwater SedimentMEPRNVQIHRAGHEAFNRRDFEAMTEQYANSITWTDHAQGRTFRTPQEFKDDFLP
Ga0222622_1129906513300022756Groundwater SedimentMGSGNVQAHRAGHEAFNQRDFEAMTNQYAYTITWT
Ga0247695_100350013300024179SoilMESPNVETHRAGHEAFNQRDFVVMTKLYADSITWTDHAQGRTFP
Ga0247672_104346823300024187SoilMESPNVATHRAGHEAFNRRDFVAMTRQYADGISWTDHSQGRTFSTPQEFRDDFLP
Ga0247660_104411223300024317SoilMESPNVETHRAGHEAFNQRDFAAMTKLYSDSITWTDHAQGRTF
Ga0207653_1006083733300025885Corn, Switchgrass And Miscanthus RhizosphereMESPNVETHRAGHEAFNQRDFAAMTKLYSDSITWTDHAQGR
Ga0207653_1038473713300025885Corn, Switchgrass And Miscanthus RhizosphereMESSNVETYRAGHEAFNQRDFVAMTKLYADSITWTDHSQGRTFRT
Ga0207692_1005443113300025898Corn, Switchgrass And Miscanthus RhizosphereMESPNVKIHRAGHEAFNRRDFVAMTSQYAEGISWTDHSQGR
Ga0207692_1097230313300025898Corn, Switchgrass And Miscanthus RhizosphereMESSNVETYRAGHEAFNQRDFEAMTSCYADSIAWTDHSQGRTFSTPGEFKNDF
Ga0207642_1060588113300025899Miscanthus RhizosphereMESPNVETHRAGHENFNQRDFVAMTKLYADSITWTDHAQ
Ga0207685_1057987013300025905Corn, Switchgrass And Miscanthus RhizosphereMESPNVETHRAGHEAFNQRDFVAMTRQYADSITWTDHSQGRTFRTPK
Ga0207663_1074935323300025916Corn, Switchgrass And Miscanthus RhizosphereMESPNVKTHRAGHEAFNQRDFAAMTRQYADGIRWTDHSQGRTFTTPGEFRD
Ga0207662_1086883613300025918Switchgrass RhizosphereMTSENVETYRAGHEAFNRRDFAAMTRRYADSITWTDHPQGRTFRTPREFT
Ga0207646_1127236623300025922Corn, Switchgrass And Miscanthus RhizosphereMESPNVETYRAGHEAFNQRDFVAMTKHYADSITWTD
Ga0207694_1045341123300025924Corn RhizosphereMESPNVATHRAGHEAFNRRDFVAMTRQYADGISWTDHSQGRTFRTPQEF
Ga0207650_1040356833300025925Switchgrass RhizosphereMESPNVETHRAGHEAFNQRDFAAMTKLYSDSITWTDHAQGRTFRTPQRF
Ga0207700_1001777413300025928Corn, Switchgrass And Miscanthus RhizosphereMESSNVETYRAGHQAFNQRDFMAMTRQYAESITWTDHSQGRTFSTPQQFRDDFLAGWVGASCDIR
Ga0207700_1167084113300025928Corn, Switchgrass And Miscanthus RhizosphereMESPNVETHRAGHEAFNQRDFVAMTRKYADSITWTDHAQGRTFRTPEEFRDDFLTGW
Ga0207664_1125394023300025929Agricultural SoilMESPNVATHRAGHEAFNRRDFVAMTRQYADGISWTDH
Ga0207664_1192997013300025929Agricultural SoilMASRNIETHRAGHEAFNQRDFEAMTKHYADSISWTDHSQGR
Ga0207669_1122828823300025937Miscanthus RhizosphereMESRNVETYRAGHEAFNRRDFDAMVKEYAESISWIDQA
Ga0207679_1109131013300025945Corn RhizosphereMESPNVETHRAGHEAFNQRDFAAMTKLYSDRITWTDH
Ga0207712_1175703823300025961Switchgrass RhizosphereMTSENVETYRAGHEAFNRRDFAAMTRRYADSITWTDHPQGRTFRTPREFTTDFL
Ga0207640_1001205913300025981Corn RhizosphereMTANVENYRAGHEAFNRRDFTAMTQHYAPGISWTDHAQGRTFGTPEEFRTEFLAG
Ga0207641_1091378313300026088Switchgrass RhizosphereMGSPNVETHRAGHEAFNQRDFVAMTRQYADGISWT
Ga0207676_1008293013300026095Switchgrass RhizosphereMASRNIETHRAGHEAFNQRDFEAMTKHYEDSISWTDHSQGRTFATRQEFRDDFL
Ga0207683_1075093413300026121Miscanthus RhizosphereMESRNVQTYRAGHEAFNQRDFVAMTGQYADSIAWTDHSQGRTFRTPQE
Ga0209055_114031313300026309SoilMESPNVETHRAGHEAFNQRDFAAMTKQYADSITWTDHSQGRTFRTPQEF
Ga0209687_121125823300026322SoilMESRNVATYQAGHEAFNQRDFAAMTKHYADSIAWTDHSQGR
Ga0208761_100316413300026995SoilMESRNVETYRAGHEAFNQRDFVAMTRQYADSITWTDHAQG
Ga0209795_1005595013300027718AgaveMSASNLEAHRAGHEAFNQRDFEAMTRQYADSIAWTDRA
Ga0209178_130500823300027725Agricultural SoilMESPNVETHRAGHEAFNQRDFVAMTRKYADSITWT
Ga0209177_1032779723300027775Agricultural SoilMGSPNVETHRAGHEAFNRRDFVAMTRQYADGINWTDHSQGRTFTTPQE
Ga0209382_1026290013300027909Populus RhizosphereMAASNVEIHRAGHEAFNQRDFESMTKRYAESIAWTDHAQGRT
Ga0209859_103130113300027954Groundwater SandMESRNVETYRAGHEAFNQRDFEAMTKHYADSIAWTDHSQGRTFRSPQEF
Ga0268265_1215841413300028380Switchgrass RhizosphereMSSRNVQIHRDGHRAFNERDFESMTTHYADNIEWTDHSQGRTFTTPQQFKE
Ga0247828_1024168213300028587SoilMASRNMDAYRVGHESFNQRDFAAMTSRYADTITWTDHAQGRTFRTPQEFRDDFLAN
Ga0247822_1146606523300028592SoilMASRNVETYRAGHAAFNHRNFEAMTKQYAESITWTDHAHGQTFGTPQQF
Ga0247820_1022602623300028597SoilMASRNVEIYRTGHEAFNQRDFEAMTARYADSITWTDHAQGRTFTTPEEFRSDFLPPWVVASPDIRITD
Ga0307307_1006251323300028718SoilMASRNVETYRAGHEAFNQRDFEAMTRHYADSIAWTDHSQGR
Ga0307301_1006314333300028719SoilMASSNVDAHRAGHEAFNRRDFETMTNHYADSIAWTDHAQGRTFR
Ga0307297_1033428713300028754SoilMASRNVETYRAGHVAFNQRNFEAMTKQYAESITWTDHPH
Ga0307316_1002776213300028755SoilMASGNVETHRAGHEAFNQRDFEAMTKHYADSIGWTDHS
Ga0307288_1004827013300028778SoilMGSGNVQAHRAGHEAFNQRDFEAMTNQYAYTITWTDHAQGR
Ga0307306_1004360023300028782SoilMTSENVETYRAGHEAFNRRDFAAMTRRYADSITWT
Ga0307282_1009262613300028784SoilMASGNVETHRAGHEAFNQRDFEAMTKHYADSIGWTDHSQSRTFRTPQ
Ga0307282_1027852113300028784SoilMASRNVETYRAGHEAFNQRDFEAMTKHYADSIAWTDHSQGRTFRTPQEFKD
Ga0307323_1002927213300028787SoilMESSNVETYRAGHEAFNQRDFVAMTRRYAENITWTDHAQGWTFRTPQEF
Ga0307323_1021832823300028787SoilMVSRNVETYRAGHAAFNQRNFEAMTGQYADNIVWTDHAQGRTFITPQEFKDDFLPGWVQASHDIRITGPRYID
Ga0307287_1000463713300028796SoilMPSPNIESHRAGHQAFNRRDFEAMTSHYADTISWTDHAQG
Ga0307294_1006639413300028810SoilMGSGNVQAHRAGHEAFNQRDFEAMTNQYAYTITWTDHAQGRTFRTRQEFRD
Ga0307296_1028303813300028819SoilMGSGNVQAHRAGHEAFNQRDFEAMTNQYADTITWTDHAQGRT
Ga0307296_1074615413300028819SoilMTSKNLETYRAGHQAFNQRDFEAMTKHYADSIAWTDHPQGRTFKTPQEF
Ga0307310_1065211413300028824SoilMTSRNVETYRAGHEAFNRRDFEAMTEKYAPKINWTDHSR
Ga0307310_1068790313300028824SoilMASRNVEAHRAGHEAFNQRDFAAMTKRYADSIAWTDHAQGRTFRTPQEFRDDFLP
Ga0307314_1002905633300028872SoilMASSNVEAHRAGHEAFNRRDFQAMTEHYADHIAWT
Ga0307314_1018022323300028872SoilMTSENVETYRAGHEAFNRRDFAAMTRRYADSITWTDHPQGRTFRTPWE
Ga0307289_1006126213300028875SoilMAASNVEAHRAGHEAFNRRDFQAMTNHYADSITWTDHAQGRTFRTP
Ga0307289_1022534913300028875SoilMVSRNVETYRAGHAAFNQRNFEAMTKQYAGSIAWTDHPHARTFKTPQE
Ga0307286_1022268913300028876SoilMGSGNVQAHRAGHEAFNQRDFEAMTNQYAYTITWTDHAQGRTFRTRQEFTDDFL
Ga0307286_1039860723300028876SoilMTSENVETYRAGHEAFNRRDFAAMTRRYAESITWTDHPQGRTFRTP
Ga0307300_1009776413300028880SoilMTSENVETYRAGHEAFNRRDFAAMTRRYADSITWTDHSQGRTFRTPREFTADFL
Ga0307300_1026580713300028880SoilMASRNVETYRAGHAAFNQRNFEAMTKQYAESITWTDHPQGRTFRTPQQFKDDFL
Ga0307277_1057237913300028881SoilMASRNVENYRAGHEAFNRRDFAAMTEHYADSMSWTDHAQGRTFETPE
Ga0307308_1007557213300028884SoilMAASNVEAHRAGHEAFNRRDFAAMTKRYADSIAWTDHAQGRT
Ga0307304_1049545113300028885SoilMASSNVEAHRAGHEAFNRRDFQAMTEHYADHIACTD
Ga0222749_1045317013300029636SoilMESPNVETYRAGHEAFNHRDFVAMTKQYADSITWTDHSQGRTFRTPQEFKDDFLAGWAG
Ga0247826_1021204913300030336SoilMASRNMDAYRVGHESFNQRDFAAMTSRYADTITWTDHAQGRTFRTPQEFRDDFLANWLR
Ga0247826_1022310713300030336SoilMASRNAEIYRAGHEAFNQRDFEAMTARYADSITWTDHAQGR
Ga0268241_1011027423300030511SoilMESPNIETHRAGHEAFNQRDFVAMTKHYAENLTWTDRSQGRTFKTPQEFRND
Ga0268241_1016096113300030511SoilMAASNLDTYRAGHQAFNDRDFQAMTRRYADSIRWTDRATGWTFRTPQEFREDFLAGWVRA
Ga0307499_1021032113300031184SoilMESPNVETHRAGHEAFNQRDFAAMTKLYADSITWTDHAQGRT
Ga0307408_10104582023300031548RhizosphereMAAVNVERHRAGHEAFNRRDFAAMTTHYADRIRGTDRARG
Ga0307408_10190470113300031548RhizosphereMGSRNVETYRAGHAAFNQRNFEAMTKRYAESITWTDHPQGRTF
Ga0318573_1000413413300031564SoilMEATNVETYRAGHQAFNHRDFEAMTKQYADSIAWTDHSQGRTFR
Ga0318515_1033952623300031572SoilMESPNVQTHRAGHEAFNLRDFVAMTRQYAASITWTDHSQGRTFRTPREFKDDFL
Ga0318542_1019029633300031668SoilMASSNVETYRAGHEAFNQRNFAAMTKQYADRITWTDHAQGRTFSTPRDFQDDFLAGWIVSSSDLKI
Ga0318561_1016851333300031679SoilMEATNVETYRAGHQAFNHRDFEAMTKQYADSIAWTDHSQGRTFRTPQE
Ga0318572_1041981123300031681SoilMESPNVQTHRAGHEAFNLRDFVAMTRQYAASITWTDHSQGRTFRTPREFKDDF
Ga0318572_1046623913300031681SoilMESPNIEIYRAGHEAFNRRDFAAMTKQYADSITWTDHAQGRTFRTPQEFTDDFLP
Ga0318560_1063009413300031682SoilMESPNVQTHRAGHEAFNLRDFVAMTRQYAASITWTDHSQGRTFRTPR
Ga0318496_1029571533300031713SoilMASSNVETHRAGHEAFNQRNFAAMTKHYADRITWT
Ga0306917_1036897213300031719SoilMASSNVETYRAGHEAFNQRNFAAMTKQYADRITWTDHAQGRTFSTPRDFQ
Ga0307405_1094196713300031731RhizosphereMAAVNVERHRAGHEAFNRRDFAAMTTHYADRIRWTDRARGLTFTTPGQ
Ga0318502_1004325743300031747SoilMEATNVETYRAGHQAFNHRDFEAMTKQYADSIAWTDHSQGRTFRTPQEFRDDFLAGWAGASRDIRITGPCY
Ga0318492_1082543413300031748SoilMESPNIEIYRAGHEAFNRRDFAAMTKQYADSITWTDHAQGRTFRTPQEFTDDFLPGWIR
Ga0318494_1073138813300031751SoilMESPNIEIYRAGHEAFNRRDFAAMTKQYADSITWTDHAQGRTFRTPQEFADDFLPGWIRA
Ga0318535_1025436723300031764SoilMASSNVETYRAGHEAFNQRNFAAMTKQYADRITWTDHAQG
Ga0318535_1036897813300031764SoilMEATNVETYRAGHQAFNHRDFEAMTKQYADSIAWTDHSQGRTFRTPQEFRD
Ga0318554_1012858413300031765SoilMESPNVQTHRAGHEAFNLRDFVAMTRQYAASITWTDHSQGRTFRTPREF
Ga0318554_1081187513300031765SoilMASRNIETHRAGHEAFNQRDFEVMTKHYEDSISWTDHS
Ga0318509_1003522213300031768SoilMEATNVETYRAGHQAFNHRDFEAMTKQYADSIAWTDHSQGRTFRTPQEFRDDFLAGWAGASRDIRITGPCYFD
Ga0318509_1045662313300031768SoilMESPNVQTHRAGHEAFNLRDFVAMTRQYAASITWTDHSQ
Ga0318526_1031659923300031769SoilMEATNVETYRAGHQAFNHRDFEAMTKQYADSIAWTDHSQGRTFRTPQEFRDDFLAGWAGASRDIRIT
Ga0318566_1036338513300031779SoilMESPNVQTHRAGHEAFNLRDFVAMTRQYAASITWTDHSQGRTFRTPREFKDDFLPGWVR
Ga0318529_1020224523300031792SoilMESPNVQTHRAGHEAFNLRDFVAMTRQYAASITWTDHSQGRTFRTPREFKDDFLPGWV
Ga0318557_1040908723300031795SoilMEATNVETYRAGHQAFNHRDFEAMTKQYADSIAWTDHSQGRTFRTPQEFR
Ga0318576_1004189043300031796SoilMESRNVENYRAGHEAFNQRDFVAMTKHYADSITWTDHAQGRTFRTPKEFR
Ga0318497_1042089613300031805SoilMEATNVETYRAGHQAFNHRDFEAMTKQYADSIAWTDHSQ
Ga0318564_1003197913300031831SoilMEATNVETYRAGHQAFNHRDFEAMTKQYADSIAWTDHSQGRTFRTPQEFRDDFLAGWAGASRDIRITGPCYF
Ga0318512_1073022523300031846SoilMESRNVENYRAGHEAFNQRDFVAMTKHYADSITWTDHA
Ga0307410_1065868213300031852RhizosphereMVSSNVEAHRAGHEAFNRRDFQAMTEHYADHIAWTDHAQGRTF
Ga0318527_1005053243300031859SoilMESRNVENYRAGHEAFNQRDFVAMTKHYADSITWTDHAQGRTFRTPKEFRD
Ga0318551_1010394443300031896SoilMESPNVQTHRAGHEAFNLRDFVAMTRQYAASITWTDHSQGRTFRTPREFKDDFLPGWVRE
Ga0307406_1071532423300031901RhizosphereMASSNVEAHRAGHEAFNRRDFQAMTEHYADHIAWTDHPQGRTFR
Ga0307406_1187224213300031901RhizosphereVAATNVEAHRAGHEAFNRRDFEAMTRRYADRIRWTDQ
Ga0307412_1093482913300031911RhizosphereMAAVNVERHRAGHEAFNRRDFAAMTTHYADRIRWTDRARGLTFTTPGQF
Ga0306921_1168864513300031912SoilMESPNIEIYRAGHEAFNRRDFAAMTKQYADSITWTDHAQGRTFRTPQEFTD
Ga0308175_10098946823300031938SoilMESPNVQTHRAGHEAFNRRDFVAMTSQYADGIRWTDHSQGRTFRTPQEFRDEFLPG
Ga0318530_1021766223300031959SoilMEATNIETYRAGHQAFNHRDFQAMTKQYADSIAWTDHSQGRTFRTPHEFRDDFLAGWVGASRDI
Ga0307409_10197760313300031995RhizosphereMPSNNVEAHRAGHEAFNRRDFQAMTEHYADSIAWTDHS
Ga0306922_1151232023300032001SoilMESPNIEIYRAGHEAFNRRDFAAMTKQYADSITWTDHAQGRTFRT
Ga0307416_10260337513300032002RhizosphereMASRNMDAYRVGHESFNQRDFAAMTSRYADTITWTDHAQGRTFRTPQEFRDDFLANWLRASSDIR
Ga0307416_10322278123300032002RhizosphereMTASNVERHRAGHQAFNQRDFESMTKHYADSIAWTDHSQGRTFRTPQEFRDDFLAGWVAASTD
Ga0307414_1035087313300032004RhizosphereMASRNMDAYRVGHESFNQRDFAAMTSRYADTITWTDHAQGRTFRTPQEF
Ga0307414_1139250913300032004RhizosphereMPSNNVEAHRAGHEAFNRRDFQAMTEHYADSIAWT
Ga0318569_1031131213300032010SoilMESPNVGTHRKGHEAFNQRDFVAMTRQYAESISWTDHSQGRTFRTPQE
Ga0318532_1023943523300032051SoilMEATNVETYRAGHQAFNHRDFEAMTKQYADSIAWTDHSQGRTFRTPQEFRDDFLAGWAG
Ga0318506_1024327213300032052SoilMASSNVETYRAGHEAFNQRNFAAMTKQYADRITWTDHAQGRTFSTPRD
Ga0318524_1014304633300032067SoilMASSNVETYRAGHEAFNQRNFAAMTKQYADRITWTDHAQGRTFSTPRDFQDDFLAGWIVSSSDLK
Ga0318524_1074797013300032067SoilMEARNVETYRAGHQAFNHRDFEAMTKQYADSIAWTDHSQGRTFGTPHE
Ga0326721_1030786423300032080SoilMPARNVETYRAGHQAFNRRDFEAMTRNYAERITWTD
Ga0318518_1003335013300032090SoilMEATNIETYRAGHQAFNRRDFQAMTKQYADSIAWTDHSQGRTF
Ga0318518_1033447013300032090SoilMASSNVETHRAGHEAFNQRNFAAMTKHYADRITWTDHAQGR
Ga0318577_1013543223300032091SoilMEATNVETYRAGHQAFNHRDFEAMTKQYADSIAWTDHSQGRTFRTPQEFRDDFLAGWAGASRDIRI
Ga0318577_1025725213300032091SoilMAPSNVETYRTGHEAFNQRNFAAMTKHYADRITWTDHAQGRTFSTPREF
Ga0318540_1061153413300032094SoilMASSNVETYRAGHEAFNQRDFVAMTKQYADSITWTDHA
Ga0307415_10006344613300032126RhizosphereMGSRNVETYRAGHAAFNQRNFEAMTKRYAESITWTDHPQGRTFRTPQEFKDDFLNGWVRSSSDL
Ga0307415_10110648613300032126RhizosphereMASRNVDTYRAGHEAFNQRDFAAMTSRYADSISWIDHAQGRT
Ga0268251_1001679013300032159AgaveMSASNVEAHRAGHQAFNRRDFQAMTERYADSIAWTDH
Ga0307472_10041450433300032205Hardwood Forest SoilMAPRNVETYRSGHEAFNRRTFEAMTEHFADGIAWTDHSQGRTF
Ga0307472_10241458223300032205Hardwood Forest SoilMESPNVETHRAGHEAFNQRDFAAMTKLYSDRITWTDHAQGRSFR
Ga0335085_1028591343300032770SoilMESPNIEIYRAGHEAFNRRDFAAMTKQYADSITWTDHAQGRTFRTPREFTDDFLPGWI
Ga0335082_1041631913300032782SoilMESSNAETYRAGHEAFNQRDFVAMTSQYAESISWTDHSQGRAFTTPREFRADFLAGWVTASADIKI
Ga0335078_1105624413300032805SoilMESRNVQTYRAGHEAFNQRDFVGMTSQYAESITWTDHSQGRTFRTPQEFKDDFLAGWVGASLNIR
Ga0335084_1026418143300033004SoilMESPNVETHRAGHEAFNQRDFVAMTKQYADSITWTDHSQGRTFRTPQEFRD
Ga0247829_1095863623300033550SoilMASRNAEIYRAGHEAFNQRDFEAMTARYADSITWTDHA
Ga0247829_1108732313300033550SoilMTSRNVEIYRAGHEAFNERDFAAMTKEYADHITWTDHAQGRTFRTPQEFRDDFLPVWVEA


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.