| Basic Information | |
|---|---|
| Family ID | F014644 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 261 |
| Average Sequence Length | 40 residues |
| Representative Sequence | MDKKEINSPKMTLNFLIWVGGVFMLLLFALLAHFVWRIF |
| Number of Associated Samples | 167 |
| Number of Associated Scaffolds | 261 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 33.72 % |
| % of genes near scaffold ends (potentially truncated) | 13.03 % |
| % of genes from short scaffolds (< 2000 bps) | 59.77 % |
| Associated GOLD sequencing projects | 147 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.53 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (77.395 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil (14.176 % of family members) |
| Environment Ontology (ENVO) | Unclassified (30.651 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (67.050 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 50.75% β-sheet: 0.00% Coil/Unstructured: 49.25% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.53 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 261 Family Scaffolds |
|---|---|---|
| PF06386 | GvpL_GvpF | 19.16 |
| PF04389 | Peptidase_M28 | 12.26 |
| PF12704 | MacB_PCD | 1.92 |
| PF13517 | FG-GAP_3 | 1.92 |
| PF13640 | 2OG-FeII_Oxy_3 | 1.53 |
| PF13470 | PIN_3 | 1.15 |
| PF01258 | zf-dskA_traR | 1.15 |
| PF12836 | HHH_3 | 0.77 |
| PF13442 | Cytochrome_CBB3 | 0.77 |
| PF08501 | Shikimate_dh_N | 0.77 |
| PF14312 | FG-GAP_2 | 0.77 |
| PF13174 | TPR_6 | 0.77 |
| PF00892 | EamA | 0.77 |
| PF13183 | Fer4_8 | 0.77 |
| PF13548 | DUF4126 | 0.77 |
| PF14559 | TPR_19 | 0.38 |
| PF00005 | ABC_tran | 0.38 |
| PF02620 | YceD | 0.38 |
| PF00248 | Aldo_ket_red | 0.38 |
| PF02225 | PA | 0.38 |
| PF08392 | FAE1_CUT1_RppA | 0.38 |
| PF01967 | MoaC | 0.38 |
| PF07676 | PD40 | 0.38 |
| PF13533 | Biotin_lipoyl_2 | 0.38 |
| PF01799 | Fer2_2 | 0.38 |
| PF10935 | DUF2637 | 0.38 |
| PF10431 | ClpB_D2-small | 0.38 |
| PF02790 | COX2_TM | 0.38 |
| PF02894 | GFO_IDH_MocA_C | 0.38 |
| PF13365 | Trypsin_2 | 0.38 |
| PF13360 | PQQ_2 | 0.38 |
| PF15780 | ASH | 0.38 |
| PF02504 | FA_synthesis | 0.38 |
| PF00535 | Glycos_transf_2 | 0.38 |
| PF09976 | TPR_21 | 0.38 |
| PF13545 | HTH_Crp_2 | 0.38 |
| PF01522 | Polysacc_deac_1 | 0.38 |
| PF03626 | COX4_pro | 0.38 |
| PF04542 | Sigma70_r2 | 0.38 |
| PF05977 | MFS_3 | 0.38 |
| PF03308 | MeaB | 0.38 |
| PF01979 | Amidohydro_1 | 0.38 |
| PF06210 | DUF1003 | 0.38 |
| PF00873 | ACR_tran | 0.38 |
| PF04041 | Glyco_hydro_130 | 0.38 |
| COG ID | Name | Functional Category | % Frequency in 261 Family Scaffolds |
|---|---|---|---|
| COG1734 | RNA polymerase-binding transcription factor DksA | Transcription [K] | 1.15 |
| COG0169 | Shikimate 5-dehydrogenase | Amino acid transport and metabolism [E] | 0.77 |
| COG0315 | Molybdenum cofactor biosynthesis enzyme MoaC | Coenzyme transport and metabolism [H] | 0.38 |
| COG0416 | Acyl-ACP:phosphate acyltransferase (fatty acid/phospholipid biosynthesis) | Lipid transport and metabolism [I] | 0.38 |
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 0.38 |
| COG0673 | Predicted dehydrogenase | General function prediction only [R] | 0.38 |
| COG0726 | Peptidoglycan/xylan/chitin deacetylase, PgdA/NodB/CDA1 family | Cell wall/membrane/envelope biogenesis [M] | 0.38 |
| COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 0.38 |
| COG1399 | 23S rRNA accumulation protein YceD (essential in plants, uncharacterized in bacteria) | Translation, ribosomal structure and biogenesis [J] | 0.38 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.38 |
| COG1622 | Heme/copper-type cytochrome/quinol oxidase, subunit 2 | Energy production and conversion [C] | 0.38 |
| COG2152 | Predicted glycosyl hydrolase, GH43/DUF377 family | Carbohydrate transport and metabolism [G] | 0.38 |
| COG2814 | Predicted arabinose efflux permease AraJ, MFS family | Carbohydrate transport and metabolism [G] | 0.38 |
| COG3125 | Heme/copper-type cytochrome/quinol oxidase, subunit 4 | Energy production and conversion [C] | 0.38 |
| COG4420 | Uncharacterized membrane protein | Function unknown [S] | 0.38 |
| COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 0.38 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 77.39 % |
| Unclassified | root | N/A | 22.61 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001087|JGI12677J13195_1013220 | Not Available | 569 | Open in IMG/M |
| 3300001151|JGI12713J13577_1024371 | Not Available | 513 | Open in IMG/M |
| 3300001166|JGI12694J13545_1006082 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1472 | Open in IMG/M |
| 3300001471|JGI12712J15308_10011253 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2415 | Open in IMG/M |
| 3300001471|JGI12712J15308_10100879 | Not Available | 732 | Open in IMG/M |
| 3300001593|JGI12635J15846_10051482 | All Organisms → cellular organisms → Bacteria | 3137 | Open in IMG/M |
| 3300001593|JGI12635J15846_10304750 | Not Available | 995 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100214778 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1817 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100744528 | Not Available | 859 | Open in IMG/M |
| 3300002907|JGI25613J43889_10085228 | Not Available | 841 | Open in IMG/M |
| 3300003219|JGI26341J46601_10000322 | All Organisms → cellular organisms → Bacteria | 14658 | Open in IMG/M |
| 3300003368|JGI26340J50214_10014141 | All Organisms → cellular organisms → Bacteria | 2503 | Open in IMG/M |
| 3300003505|JGIcombinedJ51221_10134783 | All Organisms → cellular organisms → Bacteria | 994 | Open in IMG/M |
| 3300004080|Ga0062385_10395739 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 824 | Open in IMG/M |
| 3300004080|Ga0062385_10936577 | Not Available | 577 | Open in IMG/M |
| 3300004082|Ga0062384_100022342 | All Organisms → cellular organisms → Bacteria | 2711 | Open in IMG/M |
| 3300004082|Ga0062384_100425002 | Not Available | 862 | Open in IMG/M |
| 3300004091|Ga0062387_100089219 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1623 | Open in IMG/M |
| 3300004092|Ga0062389_100745902 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1155 | Open in IMG/M |
| 3300004092|Ga0062389_103067472 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium | 625 | Open in IMG/M |
| 3300004121|Ga0058882_1341499 | Not Available | 643 | Open in IMG/M |
| 3300004152|Ga0062386_101630512 | Not Available | 538 | Open in IMG/M |
| 3300005534|Ga0070735_10050944 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2742 | Open in IMG/M |
| 3300005538|Ga0070731_10005805 | All Organisms → cellular organisms → Bacteria | 10073 | Open in IMG/M |
| 3300005538|Ga0070731_10020426 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 4592 | Open in IMG/M |
| 3300005538|Ga0070731_10351660 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 979 | Open in IMG/M |
| 3300005538|Ga0070731_10700333 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 673 | Open in IMG/M |
| 3300005556|Ga0066707_10128373 | All Organisms → cellular organisms → Bacteria | 1587 | Open in IMG/M |
| 3300005591|Ga0070761_10000107 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 56255 | Open in IMG/M |
| 3300005591|Ga0070761_10220731 | All Organisms → cellular organisms → Bacteria | 1127 | Open in IMG/M |
| 3300005591|Ga0070761_10705468 | Not Available | 632 | Open in IMG/M |
| 3300005602|Ga0070762_10008245 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5157 | Open in IMG/M |
| 3300005602|Ga0070762_10028497 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2967 | Open in IMG/M |
| 3300005602|Ga0070762_10599260 | Not Available | 731 | Open in IMG/M |
| 3300005602|Ga0070762_11171830 | Not Available | 531 | Open in IMG/M |
| 3300005610|Ga0070763_10184806 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1105 | Open in IMG/M |
| 3300005712|Ga0070764_10033530 | All Organisms → cellular organisms → Bacteria | 2594 | Open in IMG/M |
| 3300005712|Ga0070764_11050702 | Not Available | 515 | Open in IMG/M |
| 3300005921|Ga0070766_10110809 | All Organisms → cellular organisms → Bacteria | 1638 | Open in IMG/M |
| 3300005921|Ga0070766_10183425 | All Organisms → cellular organisms → Bacteria | 1300 | Open in IMG/M |
| 3300006176|Ga0070765_100000019 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 128042 | Open in IMG/M |
| 3300006176|Ga0070765_100440034 | All Organisms → cellular organisms → Bacteria | 1220 | Open in IMG/M |
| 3300006176|Ga0070765_101272869 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 694 | Open in IMG/M |
| 3300006176|Ga0070765_101538464 | Not Available | 626 | Open in IMG/M |
| 3300006893|Ga0073928_10000477 | All Organisms → cellular organisms → Bacteria | 94636 | Open in IMG/M |
| 3300006893|Ga0073928_10027431 | All Organisms → cellular organisms → Bacteria | 5583 | Open in IMG/M |
| 3300006893|Ga0073928_10304118 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1196 | Open in IMG/M |
| 3300007982|Ga0102924_1006144 | All Organisms → cellular organisms → Bacteria | 11376 | Open in IMG/M |
| 3300007982|Ga0102924_1275504 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 681 | Open in IMG/M |
| 3300009143|Ga0099792_10311468 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 938 | Open in IMG/M |
| 3300009518|Ga0116128_1002736 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 7192 | Open in IMG/M |
| 3300009518|Ga0116128_1170226 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 618 | Open in IMG/M |
| 3300009623|Ga0116133_1000149 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 20658 | Open in IMG/M |
| 3300009624|Ga0116105_1000607 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 8947 | Open in IMG/M |
| 3300009624|Ga0116105_1005638 | All Organisms → cellular organisms → Bacteria | 2570 | Open in IMG/M |
| 3300009624|Ga0116105_1095861 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 737 | Open in IMG/M |
| 3300009628|Ga0116125_1011004 | All Organisms → cellular organisms → Bacteria | 2309 | Open in IMG/M |
| 3300009628|Ga0116125_1142761 | All Organisms → cellular organisms → Bacteria | 660 | Open in IMG/M |
| 3300009633|Ga0116129_1001294 | All Organisms → cellular organisms → Bacteria | 13999 | Open in IMG/M |
| 3300009633|Ga0116129_1005620 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5488 | Open in IMG/M |
| 3300009644|Ga0116121_1188535 | Not Available | 655 | Open in IMG/M |
| 3300009645|Ga0116106_1263374 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300009759|Ga0116101_1054842 | Not Available | 864 | Open in IMG/M |
| 3300010343|Ga0074044_10046934 | All Organisms → cellular organisms → Bacteria | 2979 | Open in IMG/M |
| 3300010876|Ga0126361_10263068 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 791 | Open in IMG/M |
| 3300010876|Ga0126361_11208283 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2846 | Open in IMG/M |
| 3300010880|Ga0126350_10269823 | All Organisms → cellular organisms → Bacteria | 1437 | Open in IMG/M |
| 3300011120|Ga0150983_10011886 | Not Available | 533 | Open in IMG/M |
| 3300012199|Ga0137383_10002147 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 11930 | Open in IMG/M |
| 3300012203|Ga0137399_10951688 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 723 | Open in IMG/M |
| 3300012208|Ga0137376_11049216 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 697 | Open in IMG/M |
| 3300012361|Ga0137360_11246354 | Not Available | 643 | Open in IMG/M |
| 3300012918|Ga0137396_10664586 | Not Available | 769 | Open in IMG/M |
| 3300012924|Ga0137413_10671723 | Not Available | 783 | Open in IMG/M |
| 3300012927|Ga0137416_11901797 | Not Available | 545 | Open in IMG/M |
| 3300014168|Ga0181534_10005990 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 6829 | Open in IMG/M |
| 3300014169|Ga0181531_10006060 | All Organisms → cellular organisms → Bacteria | 7146 | Open in IMG/M |
| 3300014169|Ga0181531_10299237 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 984 | Open in IMG/M |
| 3300014169|Ga0181531_10342746 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 916 | Open in IMG/M |
| 3300014169|Ga0181531_10957545 | Not Available | 537 | Open in IMG/M |
| 3300014489|Ga0182018_10002377 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 19025 | Open in IMG/M |
| 3300014489|Ga0182018_10006742 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 8914 | Open in IMG/M |
| 3300014489|Ga0182018_10021991 | All Organisms → cellular organisms → Bacteria | 4185 | Open in IMG/M |
| 3300014489|Ga0182018_10099628 | All Organisms → cellular organisms → Bacteria | 1704 | Open in IMG/M |
| 3300014489|Ga0182018_10750570 | Not Available | 507 | Open in IMG/M |
| 3300014495|Ga0182015_10000197 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 86544 | Open in IMG/M |
| 3300014495|Ga0182015_10000510 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 55421 | Open in IMG/M |
| 3300014495|Ga0182015_10041877 | All Organisms → cellular organisms → Bacteria | 3418 | Open in IMG/M |
| 3300014495|Ga0182015_10414521 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 868 | Open in IMG/M |
| 3300014495|Ga0182015_10460807 | Not Available | 815 | Open in IMG/M |
| 3300014501|Ga0182024_10070840 | All Organisms → cellular organisms → Bacteria | 5281 | Open in IMG/M |
| 3300014501|Ga0182024_10146582 | All Organisms → cellular organisms → Bacteria | 3327 | Open in IMG/M |
| 3300014501|Ga0182024_10165795 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3076 | Open in IMG/M |
| 3300014501|Ga0182024_10210089 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2650 | Open in IMG/M |
| 3300014654|Ga0181525_10007273 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 7901 | Open in IMG/M |
| 3300014654|Ga0181525_10018133 | All Organisms → cellular organisms → Bacteria | 4429 | Open in IMG/M |
| 3300014654|Ga0181525_10038208 | All Organisms → cellular organisms → Bacteria | 2808 | Open in IMG/M |
| 3300014657|Ga0181522_10001613 | All Organisms → cellular organisms → Bacteria | 13595 | Open in IMG/M |
| 3300014657|Ga0181522_10032624 | All Organisms → cellular organisms → Bacteria | 2883 | Open in IMG/M |
| 3300014838|Ga0182030_10023535 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 11381 | Open in IMG/M |
| 3300015054|Ga0137420_1333635 | All Organisms → cellular organisms → Bacteria | 2627 | Open in IMG/M |
| 3300015242|Ga0137412_10202333 | Not Available | 1586 | Open in IMG/M |
| 3300017924|Ga0187820_1143047 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 715 | Open in IMG/M |
| 3300017935|Ga0187848_10010304 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5463 | Open in IMG/M |
| 3300017942|Ga0187808_10394237 | Not Available | 632 | Open in IMG/M |
| 3300017946|Ga0187879_10343090 | All Organisms → cellular organisms → Bacteria | 828 | Open in IMG/M |
| 3300017948|Ga0187847_10021165 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4016 | Open in IMG/M |
| 3300018008|Ga0187888_1211264 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 767 | Open in IMG/M |
| 3300018033|Ga0187867_10000227 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 51028 | Open in IMG/M |
| 3300018034|Ga0187863_10076128 | All Organisms → cellular organisms → Bacteria | 1893 | Open in IMG/M |
| 3300018034|Ga0187863_10100688 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1619 | Open in IMG/M |
| 3300018042|Ga0187871_10018958 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Gloeobacteria → Gloeobacterales → Gloeobacteraceae → Gloeobacter → Gloeobacter kilaueensis | 4488 | Open in IMG/M |
| 3300018042|Ga0187871_10104672 | All Organisms → cellular organisms → Bacteria | 1628 | Open in IMG/M |
| 3300018047|Ga0187859_10002309 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 12001 | Open in IMG/M |
| 3300018047|Ga0187859_10313282 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 851 | Open in IMG/M |
| 3300018047|Ga0187859_10910793 | Not Available | 506 | Open in IMG/M |
| 3300018468|Ga0066662_10300307 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1348 | Open in IMG/M |
| 3300019786|Ga0182025_1061778 | Not Available | 734 | Open in IMG/M |
| 3300019786|Ga0182025_1280494 | All Organisms → cellular organisms → Bacteria | 2469 | Open in IMG/M |
| 3300019786|Ga0182025_1328134 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1605 | Open in IMG/M |
| 3300019888|Ga0193751_1004846 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 7622 | Open in IMG/M |
| 3300019890|Ga0193728_1022011 | All Organisms → cellular organisms → Bacteria | 3191 | Open in IMG/M |
| 3300020006|Ga0193735_1007400 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3495 | Open in IMG/M |
| 3300020579|Ga0210407_10034932 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3739 | Open in IMG/M |
| 3300020580|Ga0210403_10648618 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 849 | Open in IMG/M |
| 3300020581|Ga0210399_10838612 | Not Available | 749 | Open in IMG/M |
| 3300020582|Ga0210395_10265283 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1291 | Open in IMG/M |
| 3300020583|Ga0210401_10041884 | All Organisms → cellular organisms → Bacteria | 4335 | Open in IMG/M |
| 3300020583|Ga0210401_10447751 | All Organisms → cellular organisms → Bacteria | 1154 | Open in IMG/M |
| 3300021171|Ga0210405_10000285 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 70893 | Open in IMG/M |
| 3300021171|Ga0210405_10001233 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 30320 | Open in IMG/M |
| 3300021171|Ga0210405_10212541 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1533 | Open in IMG/M |
| 3300021181|Ga0210388_10006496 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 9178 | Open in IMG/M |
| 3300021181|Ga0210388_10635302 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 932 | Open in IMG/M |
| 3300021181|Ga0210388_10985133 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 723 | Open in IMG/M |
| 3300021181|Ga0210388_11618140 | Not Available | 538 | Open in IMG/M |
| 3300021401|Ga0210393_11688116 | Not Available | 501 | Open in IMG/M |
| 3300021402|Ga0210385_10234002 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1345 | Open in IMG/M |
| 3300021405|Ga0210387_10701095 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 897 | Open in IMG/M |
| 3300021405|Ga0210387_11435313 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 593 | Open in IMG/M |
| 3300021407|Ga0210383_10040500 | All Organisms → cellular organisms → Bacteria | 3885 | Open in IMG/M |
| 3300021407|Ga0210383_10108101 | All Organisms → cellular organisms → Bacteria | 2344 | Open in IMG/M |
| 3300021432|Ga0210384_10461964 | All Organisms → cellular organisms → Bacteria | 1143 | Open in IMG/M |
| 3300021432|Ga0210384_10896598 | Not Available | 787 | Open in IMG/M |
| 3300021433|Ga0210391_10000180 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 75188 | Open in IMG/M |
| 3300021433|Ga0210391_10051243 | All Organisms → cellular organisms → Bacteria | 3285 | Open in IMG/M |
| 3300021433|Ga0210391_10080713 | All Organisms → cellular organisms → Bacteria | 2569 | Open in IMG/M |
| 3300021433|Ga0210391_10115918 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2109 | Open in IMG/M |
| 3300021474|Ga0210390_10000003 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 868610 | Open in IMG/M |
| 3300021474|Ga0210390_11061061 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 660 | Open in IMG/M |
| 3300021479|Ga0210410_10202703 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1777 | Open in IMG/M |
| 3300021559|Ga0210409_10021716 | All Organisms → cellular organisms → Bacteria | 6228 | Open in IMG/M |
| 3300022521|Ga0224541_1012314 | Not Available | 922 | Open in IMG/M |
| 3300022557|Ga0212123_10000599 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 114300 | Open in IMG/M |
| 3300022557|Ga0212123_10606843 | Not Available | 689 | Open in IMG/M |
| 3300022728|Ga0224566_100013 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 10931 | Open in IMG/M |
| 3300022732|Ga0224569_100254 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 4430 | Open in IMG/M |
| 3300022734|Ga0224571_111215 | Not Available | 624 | Open in IMG/M |
| 3300022873|Ga0224550_1004256 | All Organisms → cellular organisms → Bacteria | 2029 | Open in IMG/M |
| 3300022873|Ga0224550_1004349 | All Organisms → cellular organisms → Bacteria | 2007 | Open in IMG/M |
| 3300022881|Ga0224545_1001899 | All Organisms → cellular organisms → Bacteria | 4000 | Open in IMG/M |
| 3300023250|Ga0224544_1004010 | All Organisms → cellular organisms → Bacteria | 1977 | Open in IMG/M |
| 3300024049|Ga0233359_1010661 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 979 | Open in IMG/M |
| 3300024049|Ga0233359_1030303 | Not Available | 621 | Open in IMG/M |
| 3300024227|Ga0228598_1004864 | All Organisms → cellular organisms → Bacteria | 2831 | Open in IMG/M |
| 3300025404|Ga0208936_1025258 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 776 | Open in IMG/M |
| 3300025412|Ga0208194_1020522 | All Organisms → cellular organisms → Bacteria | 1058 | Open in IMG/M |
| 3300025434|Ga0208690_1054137 | All Organisms → cellular organisms → Bacteria | 627 | Open in IMG/M |
| 3300025463|Ga0208193_1011182 | All Organisms → cellular organisms → Bacteria | 2741 | Open in IMG/M |
| 3300026294|Ga0209839_10121121 | All Organisms → cellular organisms → Bacteria | 881 | Open in IMG/M |
| 3300026320|Ga0209131_1013611 | All Organisms → cellular organisms → Bacteria | 5003 | Open in IMG/M |
| 3300027334|Ga0209529_1041464 | Not Available | 784 | Open in IMG/M |
| 3300027439|Ga0209332_1011146 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1796 | Open in IMG/M |
| 3300027439|Ga0209332_1057792 | Not Available | 710 | Open in IMG/M |
| 3300027480|Ga0208993_1024124 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1073 | Open in IMG/M |
| 3300027545|Ga0209008_1014119 | All Organisms → cellular organisms → Bacteria | 1881 | Open in IMG/M |
| 3300027545|Ga0209008_1060572 | All Organisms → cellular organisms → Bacteria | 857 | Open in IMG/M |
| 3300027562|Ga0209735_1005449 | All Organisms → cellular organisms → Bacteria | 2349 | Open in IMG/M |
| 3300027567|Ga0209115_1000256 | All Organisms → cellular organisms → Bacteria | 7058 | Open in IMG/M |
| 3300027567|Ga0209115_1059777 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 869 | Open in IMG/M |
| 3300027575|Ga0209525_1001649 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4892 | Open in IMG/M |
| 3300027619|Ga0209330_1123739 | Not Available | 586 | Open in IMG/M |
| 3300027629|Ga0209422_1004721 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3328 | Open in IMG/M |
| 3300027648|Ga0209420_1003953 | All Organisms → cellular organisms → Bacteria | 6245 | Open in IMG/M |
| 3300027648|Ga0209420_1031179 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1663 | Open in IMG/M |
| 3300027648|Ga0209420_1198188 | Not Available | 534 | Open in IMG/M |
| 3300027652|Ga0209007_1000037 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 97268 | Open in IMG/M |
| 3300027667|Ga0209009_1158378 | Not Available | 576 | Open in IMG/M |
| 3300027667|Ga0209009_1167743 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 558 | Open in IMG/M |
| 3300027676|Ga0209333_1001261 | All Organisms → cellular organisms → Bacteria | 12556 | Open in IMG/M |
| 3300027684|Ga0209626_1136552 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 645 | Open in IMG/M |
| 3300027701|Ga0209447_10120921 | Not Available | 719 | Open in IMG/M |
| 3300027727|Ga0209328_10020461 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2020 | Open in IMG/M |
| 3300027737|Ga0209038_10085162 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 951 | Open in IMG/M |
| 3300027738|Ga0208989_10027372 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1969 | Open in IMG/M |
| 3300027745|Ga0209908_10129715 | Not Available | 649 | Open in IMG/M |
| 3300027745|Ga0209908_10202732 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
| 3300027767|Ga0209655_10048655 | All Organisms → cellular organisms → Bacteria | 1416 | Open in IMG/M |
| 3300027767|Ga0209655_10066676 | All Organisms → cellular organisms → Bacteria | 1198 | Open in IMG/M |
| 3300027812|Ga0209656_10023340 | All Organisms → cellular organisms → Bacteria | 3755 | Open in IMG/M |
| 3300027824|Ga0209040_10161620 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1199 | Open in IMG/M |
| 3300027853|Ga0209274_10000006 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 275297 | Open in IMG/M |
| 3300027853|Ga0209274_10754193 | Not Available | 501 | Open in IMG/M |
| 3300027889|Ga0209380_10000239 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 37715 | Open in IMG/M |
| 3300027895|Ga0209624_10110503 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1800 | Open in IMG/M |
| 3300027903|Ga0209488_10081935 | All Organisms → cellular organisms → Bacteria | 2402 | Open in IMG/M |
| 3300027908|Ga0209006_10439042 | All Organisms → cellular organisms → Bacteria | 1095 | Open in IMG/M |
| 3300027908|Ga0209006_11345809 | Not Available | 549 | Open in IMG/M |
| 3300027986|Ga0209168_10143314 | All Organisms → cellular organisms → Bacteria | 1214 | Open in IMG/M |
| 3300028016|Ga0265354_1011436 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 844 | Open in IMG/M |
| 3300028552|Ga0302149_1072502 | Not Available | 886 | Open in IMG/M |
| 3300028572|Ga0302152_10055472 | All Organisms → cellular organisms → Bacteria | 1234 | Open in IMG/M |
| 3300028731|Ga0302301_1000064 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 116391 | Open in IMG/M |
| 3300028780|Ga0302225_10026635 | Not Available | 2911 | Open in IMG/M |
| 3300028808|Ga0302228_10215300 | Not Available | 872 | Open in IMG/M |
| 3300028873|Ga0302197_10453506 | Not Available | 563 | Open in IMG/M |
| 3300028879|Ga0302229_10024183 | All Organisms → cellular organisms → Bacteria | 3303 | Open in IMG/M |
| 3300028882|Ga0302154_10616588 | Not Available | 510 | Open in IMG/M |
| 3300028906|Ga0308309_10000006 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 259167 | Open in IMG/M |
| 3300028906|Ga0308309_10019647 | All Organisms → cellular organisms → Bacteria | 4435 | Open in IMG/M |
| 3300029883|Ga0311327_10397261 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 868 | Open in IMG/M |
| 3300029913|Ga0311362_10017823 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 12561 | Open in IMG/M |
| 3300029939|Ga0311328_10478803 | All Organisms → cellular organisms → Bacteria | 878 | Open in IMG/M |
| 3300029943|Ga0311340_10703072 | All Organisms → cellular organisms → Bacteria | 866 | Open in IMG/M |
| 3300029944|Ga0311352_10326558 | All Organisms → cellular organisms → Bacteria | 1272 | Open in IMG/M |
| 3300029999|Ga0311339_10488214 | All Organisms → cellular organisms → Bacteria | 1257 | Open in IMG/M |
| 3300030057|Ga0302176_10238676 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 727 | Open in IMG/M |
| 3300030399|Ga0311353_11288621 | Not Available | 599 | Open in IMG/M |
| 3300030399|Ga0311353_11687000 | Not Available | 509 | Open in IMG/M |
| 3300030509|Ga0302183_10038174 | Not Available | 1931 | Open in IMG/M |
| 3300030617|Ga0311356_10372111 | All Organisms → cellular organisms → Bacteria | 1416 | Open in IMG/M |
| 3300030617|Ga0311356_10851784 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 862 | Open in IMG/M |
| 3300030813|Ga0265750_1074928 | Not Available | 554 | Open in IMG/M |
| 3300031234|Ga0302325_10004709 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 31375 | Open in IMG/M |
| 3300031708|Ga0310686_101580730 | All Organisms → cellular organisms → Bacteria | 3313 | Open in IMG/M |
| 3300031708|Ga0310686_103151324 | All Organisms → cellular organisms → Bacteria | 1548 | Open in IMG/M |
| 3300031708|Ga0310686_105141583 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium | 641 | Open in IMG/M |
| 3300031708|Ga0310686_105594592 | All Organisms → cellular organisms → Bacteria | 3362 | Open in IMG/M |
| 3300031708|Ga0310686_107558485 | All Organisms → cellular organisms → Bacteria | 9214 | Open in IMG/M |
| 3300031708|Ga0310686_109337363 | Not Available | 705 | Open in IMG/M |
| 3300031708|Ga0310686_111885068 | Not Available | 699 | Open in IMG/M |
| 3300031708|Ga0310686_114224488 | All Organisms → cellular organisms → Bacteria | 2314 | Open in IMG/M |
| 3300031708|Ga0310686_115350870 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1136 | Open in IMG/M |
| 3300031715|Ga0307476_10286163 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1207 | Open in IMG/M |
| 3300031715|Ga0307476_10445123 | All Organisms → cellular organisms → Bacteria | 958 | Open in IMG/M |
| 3300031718|Ga0307474_10017233 | All Organisms → cellular organisms → Bacteria | 5238 | Open in IMG/M |
| 3300031753|Ga0307477_10490133 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 836 | Open in IMG/M |
| 3300031823|Ga0307478_10002051 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 16498 | Open in IMG/M |
| 3300031823|Ga0307478_10400626 | All Organisms → cellular organisms → Bacteria | 1136 | Open in IMG/M |
| 3300031823|Ga0307478_10439885 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1083 | Open in IMG/M |
| 3300031962|Ga0307479_11030163 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 791 | Open in IMG/M |
| 3300032895|Ga0335074_10884277 | Not Available | 814 | Open in IMG/M |
| 3300032896|Ga0335075_10006293 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 18334 | Open in IMG/M |
| 3300033134|Ga0335073_10713798 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1093 | Open in IMG/M |
| 3300033402|Ga0326728_10000081 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 377046 | Open in IMG/M |
| 3300034124|Ga0370483_0001894 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5752 | Open in IMG/M |
| 3300034124|Ga0370483_0068358 | Not Available | 1141 | Open in IMG/M |
| 3300034124|Ga0370483_0068556 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1140 | Open in IMG/M |
| 3300034163|Ga0370515_0004018 | All Organisms → cellular organisms → Bacteria | 7271 | Open in IMG/M |
| 3300034163|Ga0370515_0137547 | All Organisms → cellular organisms → Bacteria | 1049 | Open in IMG/M |
| 3300034195|Ga0370501_0074436 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1115 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 14.18% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 11.88% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 8.05% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 6.51% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 6.13% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 5.36% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.98% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 4.60% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 4.21% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 3.83% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 3.83% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.07% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.30% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 2.30% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 2.68% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 2.68% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 2.68% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 1.92% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.15% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.15% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.15% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 1.15% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.77% |
| Thawing Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Thawing Permafrost | 0.77% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.38% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.38% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.38% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.38% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.38% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.38% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.38% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001087 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O3 | Environmental | Open in IMG/M |
| 3300001151 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O3 | Environmental | Open in IMG/M |
| 3300001166 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O2 | Environmental | Open in IMG/M |
| 3300001471 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300002907 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm | Environmental | Open in IMG/M |
| 3300003219 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 | Environmental | Open in IMG/M |
| 3300003368 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 | Environmental | Open in IMG/M |
| 3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
| 3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004121 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF109 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300007982 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPM 11 metaG | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009518 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_150 | Environmental | Open in IMG/M |
| 3300009623 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10 | Environmental | Open in IMG/M |
| 3300009624 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10 | Environmental | Open in IMG/M |
| 3300009628 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_10 | Environmental | Open in IMG/M |
| 3300009633 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_10 | Environmental | Open in IMG/M |
| 3300009644 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_10 | Environmental | Open in IMG/M |
| 3300009645 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40 | Environmental | Open in IMG/M |
| 3300009759 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_10 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010876 | Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010880 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014168 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaG | Environmental | Open in IMG/M |
| 3300014169 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaG | Environmental | Open in IMG/M |
| 3300014489 | Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaG | Environmental | Open in IMG/M |
| 3300014495 | Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014654 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaG | Environmental | Open in IMG/M |
| 3300014657 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaG | Environmental | Open in IMG/M |
| 3300014838 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300017924 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5 | Environmental | Open in IMG/M |
| 3300017935 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_40 | Environmental | Open in IMG/M |
| 3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
| 3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
| 3300017948 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10 | Environmental | Open in IMG/M |
| 3300018008 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_40 | Environmental | Open in IMG/M |
| 3300018033 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_10 | Environmental | Open in IMG/M |
| 3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
| 3300018042 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10 | Environmental | Open in IMG/M |
| 3300018047 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300019786 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300019888 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2 | Environmental | Open in IMG/M |
| 3300019890 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1 | Environmental | Open in IMG/M |
| 3300020006 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1m2 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300022521 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 E3 20-24 | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300022728 | Spruce litter microbial communities from Bohemian Forest, Czech Republic ? CLU2 | Environmental | Open in IMG/M |
| 3300022732 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZU1 | Host-Associated | Open in IMG/M |
| 3300022734 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZU3 | Host-Associated | Open in IMG/M |
| 3300022873 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P3 10-14 | Environmental | Open in IMG/M |
| 3300022881 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P1 20-24 | Environmental | Open in IMG/M |
| 3300023250 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P1 10-14 | Environmental | Open in IMG/M |
| 3300024049 | Soil microbial communities from Shasta-Trinity National Forest, California, United States - GEON-P30 | Environmental | Open in IMG/M |
| 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Host-Associated | Open in IMG/M |
| 3300025404 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025412 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025434 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025463 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300026294 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 (SPAdes) | Environmental | Open in IMG/M |
| 3300026320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300027334 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027439 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027480 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027545 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027562 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027567 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027575 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027619 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027629 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027648 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027652 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027667 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027676 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027684 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027701 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027727 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027737 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027738 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027745 | Thawing permafrost microbial communities from the Arctic, studying carbon transformations - Permafrost 812P2M | Environmental | Open in IMG/M |
| 3300027767 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027824 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027986 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028016 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 | Host-Associated | Open in IMG/M |
| 3300028552 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N1_1 | Environmental | Open in IMG/M |
| 3300028572 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N2_1 | Environmental | Open in IMG/M |
| 3300028731 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E1_2 | Environmental | Open in IMG/M |
| 3300028780 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_2 | Environmental | Open in IMG/M |
| 3300028808 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_2 | Environmental | Open in IMG/M |
| 3300028873 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N2_1 | Environmental | Open in IMG/M |
| 3300028879 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_3 | Environmental | Open in IMG/M |
| 3300028882 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N2_3 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029883 | I_Bog_E2 coassembly | Environmental | Open in IMG/M |
| 3300029913 | III_Bog_N3 coassembly | Environmental | Open in IMG/M |
| 3300029939 | I_Bog_E3 coassembly | Environmental | Open in IMG/M |
| 3300029943 | I_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300029944 | II_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030057 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_1 | Environmental | Open in IMG/M |
| 3300030399 | II_Palsa_E2 coassembly | Environmental | Open in IMG/M |
| 3300030509 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_2 | Environmental | Open in IMG/M |
| 3300030617 | II_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300030813 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSE1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
| 3300032896 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4 | Environmental | Open in IMG/M |
| 3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
| 3300033402 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MN | Environmental | Open in IMG/M |
| 3300034124 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_06D_14 | Environmental | Open in IMG/M |
| 3300034163 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_04D_14 | Environmental | Open in IMG/M |
| 3300034195 | Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_fen_01D_17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12677J13195_10132202 | 3300001087 | Forest Soil | MLAWDMDKKQINDPKMTMNFLIWVGGVFMLALFLLLAHFVWRIL* |
| JGI12713J13577_10243712 | 3300001151 | Forest Soil | MDKKQINDPKMTVNFLIWVGGVFMLALFLLLAHFVWRVL* |
| JGI12694J13545_10060822 | 3300001166 | Forest Soil | MDKKQINSPKMTLNFLIWIGGVFMLLLFALLAHFVWRIF* |
| JGI12712J15308_100112532 | 3300001471 | Forest Soil | MDKKEINSPNLTANFLIWVGGVGGLLLLLFLAHFMWKIR* |
| JGI12712J15308_101008791 | 3300001471 | Forest Soil | MLAWDMDKKQINDPKMTVNFLIWVGGVFMLALFLLLAHFVWRIL* |
| JGI12635J15846_100514822 | 3300001593 | Forest Soil | VRFVLAWDMDKKEINSPKLTLNFLVWIGGVFMLLLFALLAHFVWRLF* |
| JGI12635J15846_103047502 | 3300001593 | Forest Soil | MDKKEINSPKMTLNFLIWVGGVFMLLLFALLAHFVWRLF* |
| JGIcombinedJ26739_1002147782 | 3300002245 | Forest Soil | MDKKQINSPKMTLNFLIWVGGVFMLLLFAFLAHFVWRIL* |
| JGIcombinedJ26739_1007445281 | 3300002245 | Forest Soil | MDKKQINSPKMTLNFLIWVGGVFMLLLFGFLAHFVWRVL* |
| JGI25613J43889_100852283 | 3300002907 | Grasslands Soil | MDKKEINNPKMTLNFLIWVGGVFMLLLFALLAHFVWRVI* |
| JGI26341J46601_1000032211 | 3300003219 | Bog Forest Soil | MDKKQISDPKMTLNFLIWVGGVFMLTLAALLAHFVWRVF* |
| JGI26340J50214_100141413 | 3300003368 | Bog Forest Soil | VPFFASGLASGMDKKQISDPKMTLNFLIWVGGVFMLTLAALLAHFVWRVF* |
| JGIcombinedJ51221_101347831 | 3300003505 | Forest Soil | MDKKQINDPKMTLNFLIWVGGVFMLALFTFLAHFVWRLF* |
| Ga0062385_103957391 | 3300004080 | Bog Forest Soil | MDKKEINSPKMTLNFLIWVGGVFMLLLFAILAHFVWRIF* |
| Ga0062385_109365771 | 3300004080 | Bog Forest Soil | MDKKEINSPKLTLNFMVWIGGVFMLLLFALLAHFAWRIF* |
| Ga0062384_1000223421 | 3300004082 | Bog Forest Soil | MDKKQINDPKMTLNFLIWVGGVFMLLLFVLLAHFVWRVF* |
| Ga0062384_1004250021 | 3300004082 | Bog Forest Soil | MDKKEINSTGLTLNFLFWIGGVFMVLLAAVLAHFVWRVF* |
| Ga0062387_1000892192 | 3300004091 | Bog Forest Soil | MDKKEINSPKMTLNFLIWVGGVFMLLLFMILAHFVWRIF* |
| Ga0062389_1007459022 | 3300004092 | Bog Forest Soil | MDKKQINSPKMTLNFLIWVGGVFMLLLFALLAHFVWRLF* |
| Ga0062389_1030674721 | 3300004092 | Bog Forest Soil | MDKKQINSTRMTANFLIWIGGVFMLLLAALLAHFVWRVF* |
| Ga0058882_13414991 | 3300004121 | Forest Soil | MDKKDINSTKLTLNFLIWVGGVFMLLLFALLAHFVWKVF* |
| Ga0062386_1016305121 | 3300004152 | Bog Forest Soil | MDKKEINSTKLTVNFLVWVGGVFMVLLFALLAHFVWRVF* |
| Ga0070735_100509444 | 3300005534 | Surface Soil | MDKKQINDPRMTLNFLIWVGGVFMLLLFGFLAHFVWKVI* |
| Ga0070731_100058055 | 3300005538 | Surface Soil | MEKKEIDSPKMTLNFLIWVGGVFMLLLFAFLAHFVWRVI* |
| Ga0070731_100204262 | 3300005538 | Surface Soil | MDKKEINSPWLTLNFLIWVGGVGGVLLFAFIGHFVWRLF* |
| Ga0070731_103516602 | 3300005538 | Surface Soil | MDKKQINDPKMTWNFLIWVGGVFMLSLFALLAHFVWRLF* |
| Ga0070731_107003331 | 3300005538 | Surface Soil | MTMDKKQINNPWMTLNFLIWVGGVFMLSLFALLAHFVWHIF* |
| Ga0066707_101283733 | 3300005556 | Soil | MDKREINSPRLTANFLIWIGGVFMLLLFAFLAHFVWKIL* |
| Ga0070761_1000010725 | 3300005591 | Soil | MDKKEINSTKMTVNFLVWIGGVFMLLLFAVLAHFVWRVI* |
| Ga0070761_102207311 | 3300005591 | Soil | MDKKHINDPKMTLNFLIWVGGVFMLALFTFLAHFVWRLF* |
| Ga0070761_107054682 | 3300005591 | Soil | MDKKEINSTKMTINFLVWIGGVFMLLLFALLAHFVWRLF* |
| Ga0070762_100082454 | 3300005602 | Soil | MDKKQINDPKMTLNFLIWVGGVFMLSLAALLAHFVWRIF* |
| Ga0070762_100284973 | 3300005602 | Soil | MLAWDMDKKQINDPKMTVNFLIWIGGVFMLALFLLLAHFVWRIL* |
| Ga0070762_105992601 | 3300005602 | Soil | MDKKQINSPKMTLNFLIWVGGVFMLLLFMFLAHFVWRIF* |
| Ga0070762_111718301 | 3300005602 | Soil | MDKKEINSTKLTVNFLVWIGGVFMLLLFALLTHFVWRLF* |
| Ga0070763_101848062 | 3300005610 | Soil | MDKKEINSTKLTVNFLVWIGGVFMLLLFALLAHFVWRLF* |
| Ga0070764_100335302 | 3300005712 | Soil | MDKKEINSTKLTMNFLVWIGVFMLLLFALLAHFVWRIF* |
| Ga0070764_110507021 | 3300005712 | Soil | MDKKEINSTKMTLNFLIWVGGVFMLLLFALLAHFVWRIF* |
| Ga0070766_101108091 | 3300005921 | Soil | MDKKEINSTKMTLNFLVWIGGVFMLLLFALLAHFVWRLF* |
| Ga0070766_101834251 | 3300005921 | Soil | MDKKEINSTKLTLNFLVWIGGVFMLLMFALLAHFVWR |
| Ga0070765_10000001947 | 3300006176 | Soil | MDKKEINSTKMTVNFLIWIGGVFMLLLFALLAHFVWKVF* |
| Ga0070765_1004400342 | 3300006176 | Soil | MLAWDMDKKQINDPKMTVNFLIWIGGVFMLALFLVLAHFVWRIL* |
| Ga0070765_1012728692 | 3300006176 | Soil | MDKKEINSTKLTLNFLIWVGGVFMLLLFALLAHFVWKVI* |
| Ga0070765_1015384641 | 3300006176 | Soil | MDKKEINSTKLTVNFLIWVGGVFMLLLFALLGHFVWRIF* |
| Ga0073928_1000047755 | 3300006893 | Iron-Sulfur Acid Spring | MDKKEINDPKMTLNFLIWVGGVFMLLLFAFLAHFVWRIF* |
| Ga0073928_100274312 | 3300006893 | Iron-Sulfur Acid Spring | MDKKQINDPKLTVNFLIWVGGVFMLALFVLLAHFVWRVL* |
| Ga0073928_103041182 | 3300006893 | Iron-Sulfur Acid Spring | MDKKEINSTKLTLNFLVWIGGVFMLLMFGLLAHFVWRVF* |
| Ga0102924_10061443 | 3300007982 | Iron-Sulfur Acid Spring | MDKKQIDDPKMTLNFLIWVGGVFMLSLAALLAHFVWRVF* |
| Ga0102924_12755041 | 3300007982 | Iron-Sulfur Acid Spring | MDKKQINDPKMTVNFLFWVGGVFMLALFLLLAHFVWRIL |
| Ga0099792_103114681 | 3300009143 | Vadose Zone Soil | MDKKEINSPKMMLNFLIWVGGVFMLLLFAFLAHFVWKVL* |
| Ga0116128_10027363 | 3300009518 | Peatland | MDKKQINDPKMTLNFLIWVGGVFMLSLFALLAHFVWRLF* |
| Ga0116128_11702261 | 3300009518 | Peatland | MDKKQINDPKMTLNFLIWVGGVFMLSLFGLLAHFVWRLF* |
| Ga0116133_10001494 | 3300009623 | Peatland | MDKKEINSTKLTLNFLVWIGGVFMLLLFAVLAHFVWRLF* |
| Ga0116105_10006078 | 3300009624 | Peatland | MEKKQINNPWMTLNFLIWVGGVFMLSLFGLLAHFVWHVF* |
| Ga0116105_10056383 | 3300009624 | Peatland | MDKKEINSPKMTLNFLIWVGGVFMLLLFMLLAHFVWRIF* |
| Ga0116105_10958611 | 3300009624 | Peatland | MDKKEINSPKMTLNFLIWVGGVFMLLIFALLAHFVWKIF* |
| Ga0116125_10110042 | 3300009628 | Peatland | MDKKEINSPKMTLNFLIWVGGVFMLLIFALLAHFVWRIF* |
| Ga0116125_11427611 | 3300009628 | Peatland | MDKKQINDPKMTLNFMIWVGGVFMLALFAFLAHFVWKIF* |
| Ga0116129_10012947 | 3300009633 | Peatland | MFNAIPCLFWAMDKKQINSPKMTLNFLIWVGGVFMLSIFALLGHFVWRIF* |
| Ga0116129_10056203 | 3300009633 | Peatland | MDKKQIKDPKMTLNFLIWVGGVFMLLLFALLAHFVWRLF* |
| Ga0116121_11885351 | 3300009644 | Peatland | MDKKQINDPKRTLNFLIWVGGVFMLSLFVLLAHFVWRLF* |
| Ga0116106_12633742 | 3300009645 | Peatland | MDKKEINSTKLTLNFLVWIDGVFMLLLFAVLAHFVWRLF* |
| Ga0116101_10548421 | 3300009759 | Peatland | MDKKQINDPKMTANFLIWVGGVFMLLLFAFLAHFVWKVL* |
| Ga0074044_100469343 | 3300010343 | Bog Forest Soil | MDKKEINSTKLTVNFLVWIGGVFMLLLFALLAHFAWRIF* |
| Ga0126361_102630682 | 3300010876 | Boreal Forest Soil | MDKKQINSPKMTLNFLIWIGGVFMLLIFALLAHFVWRLF* |
| Ga0126361_112082832 | 3300010876 | Boreal Forest Soil | MDKKEINSTKLTVNFLVWIGGVFMVLLFALLAHFVWRVI* |
| Ga0126350_102698232 | 3300010880 | Boreal Forest Soil | MDKKEINSTKLTLNFLIWVGGVFMLLLFALLAHFVWRVI* |
| Ga0150983_100118861 | 3300011120 | Forest Soil | KEINSTKLTANFLFWIGGVFMLLLFALLGHFVWRVF* |
| Ga0137383_100021477 | 3300012199 | Vadose Zone Soil | MDKREINSPRLTANFLIWIGGVFILLLFAFLAHFVWKIL* |
| Ga0137399_109516882 | 3300012203 | Vadose Zone Soil | MDKKEINSPRLTANFLIWIAGVFMLPLFAFLAHFVWKIL* |
| Ga0137376_110492162 | 3300012208 | Vadose Zone Soil | MDKKEINSPKLTTNFLVWICGVGALLLAAFLAHFVWRIL* |
| Ga0137360_112463541 | 3300012361 | Vadose Zone Soil | MDKKEINSPRMTANFLIWIGGVFMLLLFAFLAHFVWKILYGI* |
| Ga0137396_106645861 | 3300012918 | Vadose Zone Soil | MDKKEINNPKMTLNFLIWVGRVFMLLLFALLAHFVWGVT* |
| Ga0137413_106717231 | 3300012924 | Vadose Zone Soil | MDKKQINDPKMTMNFLIWVGGVFMLLLFALLAHFVWGVI* |
| Ga0137416_119017971 | 3300012927 | Vadose Zone Soil | KEINNPKMTLNFLIWVGGVFMLLLFALLAHFVWGAI* |
| Ga0181534_100059903 | 3300014168 | Bog | MDKKQINDPKMTLNFLIWVGGVFMLAMAALLAHFVWRVI* |
| Ga0181531_100060608 | 3300014169 | Bog | MDKKEINSTKMTVNFLVWIGGVFMLLLFALLAHFVWRVF* |
| Ga0181531_102992372 | 3300014169 | Bog | MDKKEINSTKLTVNFLVWIGGVFMLLLFALLAHFVWRVF* |
| Ga0181531_103427461 | 3300014169 | Bog | MDKKEINSTRMTLNFLIWVGGVFMLLLCALLAHFVWRIF* |
| Ga0181531_109575451 | 3300014169 | Bog | MDKKEINSPKMTLNFLIWVGGVFMLLIFALLAHFVWRVF* |
| Ga0182018_100023778 | 3300014489 | Palsa | MDKKEINSPKMTLNFLIWIGGVFMLLLFALLAHFVWRLF* |
| Ga0182018_100067428 | 3300014489 | Palsa | MDKKQINDPKMTLNFLIWVGGVFMLLLFALLAHFVWRLF* |
| Ga0182018_100219913 | 3300014489 | Palsa | MDKKEINSTKLTLNFLVWIGGVFMLLLFALLAHFVWRLF* |
| Ga0182018_100996282 | 3300014489 | Palsa | MDKKDINSPKMTVNFLIWVGGVFMLLLFALLAHFVWRVF* |
| Ga0182018_107505701 | 3300014489 | Palsa | MDKKEINSTKMTVNFLVWIGGVFMLLLFALLAHFVWRLF* |
| Ga0182015_1000019724 | 3300014495 | Palsa | MDKKEINSPKLTLNFLIWIGGVFMLLLFAFLAHFVWRLF* |
| Ga0182015_1000051036 | 3300014495 | Palsa | MDKKQINDPKMTWNFLIWVGGVFMLSLFAFLAHFVWKIF* |
| Ga0182015_100418773 | 3300014495 | Palsa | MDKKEINSPKLTLNFLVWIGGVFMLLLFALLAHFVWRLF* |
| Ga0182015_104145211 | 3300014495 | Palsa | INSTKMTVNFLVWIGGVFMLLLFALLAHFVWRLF* |
| Ga0182015_104608071 | 3300014495 | Palsa | MDKKQINSPKMTANFLIWVGGVFMLLLFALLAHFVWRII* |
| Ga0182024_100708407 | 3300014501 | Permafrost | MDKKEINSPKMTLNFLIWVGGVFMLLLFALLAHFVWRIF* |
| Ga0182024_101465822 | 3300014501 | Permafrost | MDKKQINDPKMTWNFLIWVGGVFMLLLFALLAHFVWRVF* |
| Ga0182024_101657953 | 3300014501 | Permafrost | MDKKQINSPKMTLNFLIWVGGVFMLLLFAFLAHFVWKVL* |
| Ga0182024_102100892 | 3300014501 | Permafrost | MDKKDINSPKMTLNFLIWVGGVFMLLIFALLAHFVWRVF* |
| Ga0181525_100072732 | 3300014654 | Bog | MGEWWGVLALNMDKKQINSTKMTVNFLIWVGGVFMLLLFALLAHFVWKVF* |
| Ga0181525_100181331 | 3300014654 | Bog | MDKKEINSTKMTMNFLIWVGGVFMLLLFALLAHFVWRIF* |
| Ga0181525_100382083 | 3300014654 | Bog | MDKKEINSTRMTLNFLIWVGGVFMLLLFALLAHFVWRIF* |
| Ga0181522_100016135 | 3300014657 | Bog | MDKKQINDPKMTINFLIWVGGVFMLLLFALLAHFVWRIF* |
| Ga0181522_100326243 | 3300014657 | Bog | MDKKQINDPKMTGNFLIWVGGVFMLLLFVLLAHFVWRVI* |
| Ga0182030_100235352 | 3300014838 | Bog | MDKKEINSTKMTLNFLVWIGGVFMLLLFAVLAHFVWRLF* |
| Ga0137420_13336355 | 3300015054 | Vadose Zone Soil | MDKKRLTNPKMRLNFLIWVGGVFMLLFALLAHFVWRVI* |
| Ga0137412_102023334 | 3300015242 | Vadose Zone Soil | MDKKEINSPKMTLNFLIWVGGVFMLLLFAFLAHFVWKVL* |
| Ga0187820_11430472 | 3300017924 | Freshwater Sediment | MEKKEIDSPKMTLNFLIWVGGVFMLLLFAFLAHFVWRVI |
| Ga0187848_100103043 | 3300017935 | Peatland | MDKKEINSTKLTLNFLVWIGGVFMLLLFAVLAHFVWRLF |
| Ga0187808_103942371 | 3300017942 | Freshwater Sediment | MDKKQINDPKMTLNFLIWIGGVFMLLLFAFLAHFVWRLF |
| Ga0187879_103430902 | 3300017946 | Peatland | MDKKEINSPKMTLNFLIWVGGVFMLLLFMLLAHFVWRIF |
| Ga0187847_100211651 | 3300017948 | Peatland | MEKKQINNPWMTLNFLIWVGGVFMLSLFGLLAHFVWHVF |
| Ga0187888_12112642 | 3300018008 | Peatland | PSVLAWGMDKKEINSTKLTLNFLVWIGGVFMLLLFAVLAHFVWRLF |
| Ga0187867_1000022723 | 3300018033 | Peatland | MDKKQINDPKRTLNFLIWVGGVFMLSLFVLLAHFVWRLF |
| Ga0187863_100761282 | 3300018034 | Peatland | MDKKEINSTKMTLNFLVWIGGVFMLLLFAVLAHFVWRLF |
| Ga0187863_101006881 | 3300018034 | Peatland | MDKKQINDPKMTLNFLIWVGGVFMLLLFALLAHFVWRLF |
| Ga0187871_100189582 | 3300018042 | Peatland | MDKKQINDPKMTLNFMIWVGGVFMLALFAFLAHFVWKIF |
| Ga0187871_101046722 | 3300018042 | Peatland | MDKKQISDPKMTWNFLIWVGGVFMLSLFAVLAHFVWRVF |
| Ga0187859_100023094 | 3300018047 | Peatland | MFNAIPCLFWAMDKKQINSPKMTLNFLIWVGGVFMLSIFALLGHFVWRIF |
| Ga0187859_103132822 | 3300018047 | Peatland | MDKKEINSTKLTVNFLVWIGGVFMLLLFALLAHFVWRVF |
| Ga0187859_109107931 | 3300018047 | Peatland | MDKKEINSPKMTLNFLIWVGGVFMLLIFALLAHFVWKIF |
| Ga0066662_103003073 | 3300018468 | Grasslands Soil | GENFSVIASDMDKKEINNPKMTMNFLIWVGGVFMLLLFVFLAHFVWRVI |
| Ga0182025_10617781 | 3300019786 | Permafrost | MDKKQINDPKMTWNFLIWVGGVFMLLLFALLAHFVWRVF |
| Ga0182025_12804944 | 3300019786 | Permafrost | MLAWDMDKKQINDPKMTVNFLIWVGGVFMLALFLLLAHFVWRIL |
| Ga0182025_13281343 | 3300019786 | Permafrost | MDKKQINSPKMTLNFLIWVGGVFMLLLFAFLAHFVWKVL |
| Ga0193751_10048466 | 3300019888 | Soil | MDKKEINSPRLTANFLIWIGGVFMLLLFAFLAHFVWKIL |
| Ga0193728_10220112 | 3300019890 | Soil | MDKKEINSPKMTVNFLIWVGGVFMLLLFAFLAHFVWRIL |
| Ga0193735_10074003 | 3300020006 | Soil | MDKREINSPRLTANFLIWIGGVFMLLLFAFLAHFVWKIL |
| Ga0210407_100349324 | 3300020579 | Soil | MDKKQINDPKMTWNFLIWVGGVFMLLLFALLAHFVWRVFYSR |
| Ga0210403_106486181 | 3300020580 | Soil | KEINSPKMTVNFLIWVGGVFMLLLFMFLAHFVWRIL |
| Ga0210399_108386121 | 3300020581 | Soil | MDKKEINSTKLTVNFLVWIGGVFMLLMFALLAHFVWRIF |
| Ga0210395_102652832 | 3300020582 | Soil | MDKKEINSPGLTLNFLIWVGGVGGVLLFAFIGHFVWRLF |
| Ga0210401_100418843 | 3300020583 | Soil | MLAWDMDKKQINDPKMTVNFLIWVGGVFMLALFLLLAHFVWRVL |
| Ga0210401_104477511 | 3300020583 | Soil | MDKKQINSPKMTLNFMIWVGGVFMLLLFMLLGHFVWRIF |
| Ga0210405_1000028540 | 3300021171 | Soil | MDKKEMNSTKLTVNFLVWIGGVFMVLLFGLLAHFVWRVF |
| Ga0210405_1000123315 | 3300021171 | Soil | MDKKQINSPKMTLNFLIWVGGVFMLLLFMLLGHFVWRIF |
| Ga0210405_102125412 | 3300021171 | Soil | MDGKEINSPRLTANFLIWIGGVFMLRLFALLALLVWKIL |
| Ga0210388_1000649610 | 3300021181 | Soil | MLAWDMDKKQINDPKMTVNFLIWIGGVFMLALFLVLAHFVWRIL |
| Ga0210388_106353021 | 3300021181 | Soil | MDKKEINSTKLTVNFLIWVGGVFMLLLFALLGHFVWRIF |
| Ga0210388_109851332 | 3300021181 | Soil | MDKKQINDPKMTLNFLIWVGGVFMLSLAALLAHFVWRIF |
| Ga0210388_116181402 | 3300021181 | Soil | CGSVRLMDKKEINSPKLTLNFLIWIGGVFMLLLFALLAHFVWRVF |
| Ga0210393_116881162 | 3300021401 | Soil | MDKKQINSPKMTWNFLIWVGGVFMLSIFALLGHFVWGIF |
| Ga0210385_102340022 | 3300021402 | Soil | MDKKDINSTKMTLNFLIWVGGVFMLLLFALLAHFVWKVF |
| Ga0210387_107010951 | 3300021405 | Soil | MDKKEINSTKLTVNFLVWIGGVFMLLLFALLAHFVWRLF |
| Ga0210387_114353131 | 3300021405 | Soil | KEINSPGLTMNFLIWVGGVGGVLLFGFIGHFVWRLF |
| Ga0210383_100405003 | 3300021407 | Soil | MLAWDMDKKQINDPKMTVNFLIWIGGVFMLALFLLLAHFVWRIL |
| Ga0210383_101081012 | 3300021407 | Soil | MDKKEINSTKLTLNFLFWIGGVFMLLLFALLGHFVWRIF |
| Ga0210384_104619641 | 3300021432 | Soil | MDKKQINSPKMTLNFMIWVGGVFMLLLFMLLGHFVGRIF |
| Ga0210384_108965982 | 3300021432 | Soil | MDKKEINSPRLTANFLIWIGGVFMLLWVALLAHLVWKIL |
| Ga0210391_1000018055 | 3300021433 | Soil | MDKKEVNSPKITLNFLIWIGGVFMLLLFAFLAHFVWRFI |
| Ga0210391_100512433 | 3300021433 | Soil | MDKKQINDPKMTLNFLIWVGGVFMLALFTFLAHFVWRLF |
| Ga0210391_100807133 | 3300021433 | Soil | MDKKEINSTKLTLNFLIWIGGVFMLLLFALLAHFVWRIF |
| Ga0210391_101159182 | 3300021433 | Soil | MDKKEINSTKLTMNFLVWIGVFMLLLFALLAHFVWRIF |
| Ga0210390_10000003631 | 3300021474 | Soil | MDKKQINSPKMTLNFLIWVGGVFMLLFMFLAHFVWRIF |
| Ga0210390_110610611 | 3300021474 | Soil | MDKKQINDPKMTWNFLIWVGGVFMLLLFALRAHFVWRVFYSR |
| Ga0210410_102027033 | 3300021479 | Soil | MDKKQINDPKMTVNFLIWVGGVFMLALFLLLAHFVWRIL |
| Ga0210409_100217165 | 3300021559 | Soil | MDKKQINSPKMTLNFLIWVGGVFMLLLFMFLAHFVWRIF |
| Ga0224541_10123142 | 3300022521 | Soil | MDKKEINSPKMTLNFLIWVGGVFMLLIFALLAHFVWRIF |
| Ga0212123_1000059972 | 3300022557 | Iron-Sulfur Acid Spring | MDKKEINDPKMTLNFLIWVGGVFMLLLFAFLAHFVWRIF |
| Ga0212123_106068431 | 3300022557 | Iron-Sulfur Acid Spring | MDKKQIDDPKMTLNFLIWVGGVFMLSLAALLAHFVWRVF |
| Ga0224566_1000135 | 3300022728 | Plant Litter | MDKKQINSPKMTLNFLIWVGGVFMLSIFALLGHFVWRIF |
| Ga0224569_1002545 | 3300022732 | Rhizosphere | MDKKEINSPKLTLNFLIWIGGVFMLLLFAFLAHFVWRLF |
| Ga0224571_1112151 | 3300022734 | Rhizosphere | VLAWGMDKKEINSPKLTLNFLIWIGGVFMLLLFAFLAHFVWRLF |
| Ga0224550_10042561 | 3300022873 | Soil | MDKKEINSTKMTVNFLVWIGGVFMLLLFALLAHFVWRLF |
| Ga0224550_10043492 | 3300022873 | Soil | MDKKEINSPKLTLNFLVWIGGVFMLLLFALLAHFVWRLF |
| Ga0224545_10018992 | 3300022881 | Soil | MDKKQINDPKMTLNFLIWVGGVFMLSLFALLAHFVWRLF |
| Ga0224544_10040101 | 3300023250 | Soil | MDKKEINSTKMMVNFLVWIGGVFMLLLFALLAHFVWRLF |
| Ga0233359_10106612 | 3300024049 | Soil | MDKKEINNPKMTLNFLIWVGGVFMLLLFAFLAHFVWRVF |
| Ga0233359_10303031 | 3300024049 | Soil | MRSVERMDKKQINSPKMTLNFLIWVGGVFMLLLFAFLAHFVWRIL |
| Ga0228598_10048641 | 3300024227 | Rhizosphere | MDKKEINSTKLTVDFLVWVGGVFMLLLFALLAHFVWRIF |
| Ga0208936_10252581 | 3300025404 | Peatland | PMEKKQINNPWMTLNFLIWVGGVFMLSLFGLLAHFVWHVF |
| Ga0208194_10205221 | 3300025412 | Peatland | MDKKQINDPKMTLNFLIWVGGVFMLSLFGLLAHFVWRLF |
| Ga0208690_10541372 | 3300025434 | Peatland | MTRLESMDKKQINDPKMTLNFMIWVGGVFMLALFAFLAHFVWKIF |
| Ga0208193_10111822 | 3300025463 | Peatland | MDKKQIKDPKMTLNFLIWVGGVFMLLLFALLAHFVWRLF |
| Ga0209839_101211212 | 3300026294 | Soil | MDKKEINSPWLTLNFLIWVGGVGGVLLFAFIGHFVWRLF |
| Ga0209131_10136112 | 3300026320 | Grasslands Soil | MDKKEINNPKMTLNFLIWVGGVFMLLLFALLAHFVWRVI |
| Ga0209529_10414642 | 3300027334 | Forest Soil | MDKKQINDPKMTWNFLIWVGGVFMLSLFALLAHFVWRLF |
| Ga0209332_10111462 | 3300027439 | Forest Soil | MDKKEINSPKMTLNFLIWVGGVFMLLLFALLAHFVWRLF |
| Ga0209332_10577921 | 3300027439 | Forest Soil | MDKKEINSPKMTLNFLIWVGGVFMLLLFAFLAHFVWRIL |
| Ga0208993_10241242 | 3300027480 | Forest Soil | MDKKEINSPRLTSPFLIWIGGVFLQLLFAFIAHFVWKIL |
| Ga0209008_10141191 | 3300027545 | Forest Soil | MDKKQINDPKMTVNFLIWVGGVFMLALFLLLAHFVWRVL |
| Ga0209008_10605721 | 3300027545 | Forest Soil | MDKKEINSTKLTVNFLVWIGVFVLLLFALLAHFVWRIF |
| Ga0209735_10054491 | 3300027562 | Forest Soil | MDKKEINSPKMTLNFLIWVGGVFMLLLFAFLAHFVWRIRDGF |
| Ga0209115_10002562 | 3300027567 | Forest Soil | MLAWDMDKKQINDPKMTMNFLIWVGGVFMLALFLLLAHFVWRIL |
| Ga0209115_10597773 | 3300027567 | Forest Soil | MDKKQINSPKMTLNFLIWVGGVFMLLLFALLAHFVWRIF |
| Ga0209525_10016493 | 3300027575 | Forest Soil | MLLWDMDKKQINDPKMTVNFLIWVGGVFMLALFLLLAHFVWRIL |
| Ga0209330_11237391 | 3300027619 | Forest Soil | MDKKQINDPKMTWNFLIWVGGVFMLLLFALLAHFVWRVI |
| Ga0209422_10047213 | 3300027629 | Forest Soil | MDKKQINDPKMTLNFLIWVGGVFMLLLFAFLAHFVWRIL |
| Ga0209420_10039534 | 3300027648 | Forest Soil | MDKKEINSPKMTLNFLIWVGGVFMLLLFALLAHFVWRIF |
| Ga0209420_10311792 | 3300027648 | Forest Soil | MDKKEINSPKLTTNFLIWVGGVGGLLLLLFLAHFVWKIR |
| Ga0209420_11981881 | 3300027648 | Forest Soil | MDKKNINSPKMTLNFLIWVGGVFMLLLFALLAHFVWRVF |
| Ga0209007_100003745 | 3300027652 | Forest Soil | MDKKQINSPKMTLNFLIWIGGVFMLLLFALLAHFVWRIF |
| Ga0209009_11583781 | 3300027667 | Forest Soil | MDKKEINSTKLTVNFLVWIGGVFMVLLFAVLAHFVWRIF |
| Ga0209009_11677431 | 3300027667 | Forest Soil | MDKKEINSPKITLNFLIWVGGVFMLLLFAFLAHFVWRIL |
| Ga0209333_10012612 | 3300027676 | Forest Soil | VLAWGMDKKEINSPKLTLNFLVWIGGVFMLLLFALLAHFVWRLF |
| Ga0209626_11365522 | 3300027684 | Forest Soil | MDKKQINSPKMTLNFLIWVGGVFMLLLFGFLAHFVWRVL |
| Ga0209447_101209211 | 3300027701 | Bog Forest Soil | MDKKEINSPKMTLNFLIWVGGVFMLLLFAILAHFVWRIF |
| Ga0209328_100204613 | 3300027727 | Forest Soil | LCMDKKEINSPRLTANFLIWIGGVFMLLLFAFLAHFVWRIL |
| Ga0209038_100851621 | 3300027737 | Bog Forest Soil | MDKKEINSPKMTLNFLIWVGGVFMLLLFAFLAHFVWKIF |
| Ga0208989_100273723 | 3300027738 | Forest Soil | MDKKEINSPQLTANFLIWIAGVFMLPLFAFLAHFVWKIL |
| Ga0209908_101297152 | 3300027745 | Thawing Permafrost | MDKKEINSTKLTLNFLVWIGGVFMLLLFALLAHFVWRLF |
| Ga0209908_102027321 | 3300027745 | Thawing Permafrost | KEINSTKMTLNFLVWIGGVFMLLLFALLAHFVWRLF |
| Ga0209655_100486552 | 3300027767 | Bog Forest Soil | MDKKQINDPKMTLNFLIWVGGVFMLLLFVLLAHFVWRVF |
| Ga0209655_100666762 | 3300027767 | Bog Forest Soil | MDKKEINSPKLTLNFMVWIGGVFMLLLFALLAHFAWRIF |
| Ga0209656_100233403 | 3300027812 | Bog Forest Soil | MDKKQISDPKMTLNFLIWVGGVFMLTLAALLAHFVWRVF |
| Ga0209040_101616202 | 3300027824 | Bog Forest Soil | MDKKEINSPKMTLNFLIWVGGVFMLLLFMLLAHFAWRIF |
| Ga0209274_10000006223 | 3300027853 | Soil | MDKKEINSTKMTVNFLVWIGGVFMLLLFAVLAHFVWRVI |
| Ga0209274_107541931 | 3300027853 | Soil | MDKKEINSPKMTLNFLIWVGGVFMLLLFAFLAHFVWRIF |
| Ga0209380_1000023913 | 3300027889 | Soil | MDKKEINSTKMTLNFLIWVGGVFMLLLFALLAHFVWRIF |
| Ga0209624_101105032 | 3300027895 | Forest Soil | MDKKEINSTKLTLNFLVWIGVFMLLLFALLAHFGWRLF |
| Ga0209488_100819353 | 3300027903 | Vadose Zone Soil | MDKKEINNPKMTLNFLIWVGGVFMLLLFALLAHFVWGAI |
| Ga0209006_104390421 | 3300027908 | Forest Soil | MDKKEINSSWLTLNFLIWVGGVGGVLLFAFLGHFVWRL |
| Ga0209006_113458092 | 3300027908 | Forest Soil | MDKKEINSTRMTLNFLVWIGGVFMLLLFALLAHFVWRLF |
| Ga0209168_101433142 | 3300027986 | Surface Soil | MDKKQINDPRMTLNFLIWVGGVFMLLLFGFLAHFVWKVI |
| Ga0265354_10114362 | 3300028016 | Rhizosphere | VRLMDKKEINSTKLTVNFLIWVGGVFMLLLFALLGHFVWRIF |
| Ga0302149_10725021 | 3300028552 | Bog | MEKKEINNPKMTLNFLIWVGGVFMLLMFAFLAHFVWRVI |
| Ga0302152_100554722 | 3300028572 | Bog | MDKKQINDPKMTINFLIWVGGVFMLLLFALLAHFVWRIF |
| Ga0302301_100006488 | 3300028731 | Palsa | MDKKQINDPKMTWNFLIWVGGVFMLSIFALLAHFVWRVF |
| Ga0302225_100266356 | 3300028780 | Palsa | MGEWWGVLALNMDKKQINSTKMTVNFLIWVGGVFMLLLFALLAHFVWKVF |
| Ga0302228_102153001 | 3300028808 | Palsa | DKKEINSPKLTLNFLVWIGGVFMLLLFALLAHFVWRLF |
| Ga0302197_104535061 | 3300028873 | Bog | DKKEINSTKMTLNFLVWIGGVFMLLLFAVLAHFVWRLF |
| Ga0302229_100241833 | 3300028879 | Palsa | APLLACAMDKKQINDPKMTWNFLIWVGGVFMLSIFALLAHFVWRVF |
| Ga0302154_106165881 | 3300028882 | Bog | DASLISMDKKQINDPKMTINFLIWVGGVFMLLLFALLAHFVWRIF |
| Ga0308309_1000000696 | 3300028906 | Soil | MDKKEINSTKMTVNFLIWIGGVFMLLLFALLAHFVWKVF |
| Ga0308309_100196472 | 3300028906 | Soil | MDKKEINSTKLTVNFLVWIGGVFMLLLFALLTHFVWRLF |
| Ga0311327_103972612 | 3300029883 | Bog | MDKKEINSTKMTWNFLIWVGGVFMLLLFALLAHFVWRVF |
| Ga0311362_100178239 | 3300029913 | Bog | MDKKEINSPKMTLNFLIWVGGIFMLLIFALLAHFVWKIF |
| Ga0311328_104788032 | 3300029939 | Bog | MDKKQINDPKMTINFLIWVGGVFMLLLFALLAHFVW |
| Ga0311340_107030721 | 3300029943 | Palsa | MDKKEINSPKLTLNFLIWVGGVFMLLLFAVLAHFVWRIF |
| Ga0311352_103265582 | 3300029944 | Palsa | MDKKEINSTKMTLNFLVWIGGVFMLLLFALLAHFVWRLF |
| Ga0311339_104882142 | 3300029999 | Palsa | MDKKQINSTKMTLNFLIWVGGVFMLLLFALLAHFVWRIF |
| Ga0302176_102386761 | 3300030057 | Palsa | MDKKEINSTKMTLNFLVWIGGVFMLLLFALLAHFVW |
| Ga0311353_112886211 | 3300030399 | Palsa | GVCASVWSMDKKEINSTKMTLNFLVWIGGVFMLLLFALLAHFVWRLF |
| Ga0311353_116870002 | 3300030399 | Palsa | MDKKEINSPKATVNFLVWIGGVFMLLLFALLAHFVWKVF |
| Ga0302183_100381741 | 3300030509 | Palsa | MGEWWGVLALNMDKKQINSTKMTVNFLIWVGGVFMLLLFALLAHFVW |
| Ga0311356_103721112 | 3300030617 | Palsa | VRFVLAWDMDKKEINSPKLTLNFLVWIGGVFMLLLFALLAHFVWRLF |
| Ga0311356_108517842 | 3300030617 | Palsa | FTNCWLTVMNKKEINSPGLTLNFLIWVGGVGGVLLFAFLGHFVWRLF |
| Ga0265750_10749282 | 3300030813 | Soil | MDKKQINDPKMTANFLIWVGGVFMLLLFAFLAHFVWRVL |
| Ga0302325_1000470912 | 3300031234 | Palsa | MVMDKKEINSPKATVNFLVWIGGVFMLLLFALLAHFVWKVF |
| Ga0310686_1015807304 | 3300031708 | Soil | VLACGMDKKEINSTKLTANFLFWIGGVFMLLLFALLGHFVWRVF |
| Ga0310686_1031513243 | 3300031708 | Soil | MDKKNLNDPRMTLNFLIWVGGVFMLSLFGFLAHFVWKIL |
| Ga0310686_1051415831 | 3300031708 | Soil | MDKKQINSPKLTVNFLIWVGGVGGLLLLLFLAHFA |
| Ga0310686_1055945921 | 3300031708 | Soil | VRCIQQWSVLAWGMDKKEINSPKLTLNFLIWIGGVFMLLLFAFLAHFVWRLF |
| Ga0310686_1075584857 | 3300031708 | Soil | MDKKEINSPELTLNFLIWIGGVFMLLFALLAHFVWRIF |
| Ga0310686_1093373632 | 3300031708 | Soil | MLAWGMDKKQINSPKMTLNFLIWVGGVFMLLLFALLAHFVWRLF |
| Ga0310686_1118850681 | 3300031708 | Soil | MDKKEINSTKLTVNFLVWIGGVFMVLLFALLAHFAWRIF |
| Ga0310686_1142244882 | 3300031708 | Soil | MDKKDINSTKMTLNFLIWVGGVFMLLLFALLAHFVWRIF |
| Ga0310686_1153508702 | 3300031708 | Soil | MDKKEINSTKLTLNFLIWIGGVFMLLLFALLAHFVWRLF |
| Ga0307476_102861631 | 3300031715 | Hardwood Forest Soil | MDKKQINDPKMTLNFLIWVGGVFMLLLFALLAHFVWRVF |
| Ga0307476_104451231 | 3300031715 | Hardwood Forest Soil | MDKKQINDPKMTLNFLIWVGGVFMLLLFALLAHFV |
| Ga0307474_100172336 | 3300031718 | Hardwood Forest Soil | MDKKQINDPKMTVNFLIWVGGVFMLAIFAFLAHFVWRVL |
| Ga0307477_104901331 | 3300031753 | Hardwood Forest Soil | MDKKQINDPEMTLNFLIWVGGVFMLLLFALLAHFVWRVF |
| Ga0307478_100020516 | 3300031823 | Hardwood Forest Soil | MDKKQINSPKMTWNFLIWVGGVFMLLLFMFLAHFVWRIF |
| Ga0307478_104006262 | 3300031823 | Hardwood Forest Soil | MDKKQINDPKMTVNFLIWIGGVFMLALFLLLAHFVWRIL |
| Ga0307478_104398852 | 3300031823 | Hardwood Forest Soil | MDKKQINDPKMTANFLIWVGGVFMLLLFAFLAHFVWKVL |
| Ga0307479_110301632 | 3300031962 | Hardwood Forest Soil | MDKKEINSTKLTVNFLVWIGGVFMVLLFALLAHFVWRVF |
| Ga0335074_108842772 | 3300032895 | Soil | MDKKDINSPKMTLNFLIWVGGVFMLLLFAFLAHFVWRVI |
| Ga0335075_1000629317 | 3300032896 | Soil | MDKKQINDPKMTWNFLIWVGGVFMLLLFAFLAHFVWRLF |
| Ga0335073_107137982 | 3300033134 | Soil | MDKKQINNPWMTLNFLIWVGGVFMLSLFALLAHFVWRIF |
| Ga0326728_1000008186 | 3300033402 | Peat Soil | MDKKQINDPKMTLNFLIWVGGVFMLSLAALLAHFVWRVF |
| Ga0370483_0001894_4864_4983 | 3300034124 | Untreated Peat Soil | MDKKQINDPRMTWNFLIWVGGVFMLSIFALLAHFVWRVF |
| Ga0370483_0068358_172_291 | 3300034124 | Untreated Peat Soil | MEKKEINNPKMTLNFLIWVGGVFMLLLFAFLAHFVWRVI |
| Ga0370483_0068556_27_146 | 3300034124 | Untreated Peat Soil | MDKKQINDPKMTLNFLIWVGGVFMLALFAFLAHFVWKLF |
| Ga0370515_0004018_325_444 | 3300034163 | Untreated Peat Soil | MDKKEINSTKMTVNFLVWIGGVFMLLLFALLAHFVWRVF |
| Ga0370515_0137547_871_990 | 3300034163 | Untreated Peat Soil | MDKKEINSPKMTLNFLIWVGGVFMLLIFALLAHFVWRVF |
| Ga0370501_0074436_515_634 | 3300034195 | Untreated Peat Soil | MDKKQINSTKLTLNFLIWVGGVFMLLLFALLAHFVWRIF |
| ⦗Top⦘ |