| Basic Information | |
|---|---|
| Family ID | F014460 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 263 |
| Average Sequence Length | 43 residues |
| Representative Sequence | AAAERVAANVAEAEAQKGVRGTARRVRKALTGKQAPPKKGKK |
| Number of Associated Samples | 224 |
| Number of Associated Scaffolds | 263 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.76 % |
| % of genes near scaffold ends (potentially truncated) | 98.86 % |
| % of genes from short scaffolds (< 2000 bps) | 90.49 % |
| Associated GOLD sequencing projects | 213 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.42 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (65.399 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (18.251 % of family members) |
| Environment Ontology (ENVO) | Unclassified (28.137 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (51.711 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 42.86% β-sheet: 0.00% Coil/Unstructured: 57.14% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.42 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 263 Family Scaffolds |
|---|---|---|
| PF07650 | KH_2 | 77.95 |
| PF00252 | Ribosomal_L16 | 11.41 |
| PF00831 | Ribosomal_L29 | 3.04 |
| PF00366 | Ribosomal_S17 | 2.28 |
| PF00253 | Ribosomal_S14 | 1.14 |
| PF00238 | Ribosomal_L14 | 1.14 |
| PF07993 | NAD_binding_4 | 0.38 |
| PF00467 | KOW | 0.38 |
| PF00861 | Ribosomal_L18p | 0.38 |
| PF00673 | Ribosomal_L5_C | 0.38 |
| PF03719 | Ribosomal_S5_C | 0.38 |
| PF17136 | ribosomal_L24 | 0.38 |
| PF00344 | SecY | 0.38 |
| PF00237 | Ribosomal_L22 | 0.38 |
| COG ID | Name | Functional Category | % Frequency in 263 Family Scaffolds |
|---|---|---|---|
| COG0197 | Ribosomal protein L16/L10AE | Translation, ribosomal structure and biogenesis [J] | 11.41 |
| COG0255 | Ribosomal protein L29 | Translation, ribosomal structure and biogenesis [J] | 3.04 |
| COG0186 | Ribosomal protein S17 | Translation, ribosomal structure and biogenesis [J] | 2.28 |
| COG0093 | Ribosomal protein L14 | Translation, ribosomal structure and biogenesis [J] | 1.14 |
| COG0199 | Ribosomal protein S14 | Translation, ribosomal structure and biogenesis [J] | 1.14 |
| COG0091 | Ribosomal protein L22 | Translation, ribosomal structure and biogenesis [J] | 0.38 |
| COG0094 | Ribosomal protein L5 | Translation, ribosomal structure and biogenesis [J] | 0.38 |
| COG0098 | Ribosomal protein S5 | Translation, ribosomal structure and biogenesis [J] | 0.38 |
| COG0201 | Preprotein translocase subunit SecY | Intracellular trafficking, secretion, and vesicular transport [U] | 0.38 |
| COG0256 | Ribosomal protein L18 | Translation, ribosomal structure and biogenesis [J] | 0.38 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 65.40 % |
| All Organisms | root | All Organisms | 34.60 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000719|JGI12378J11916_103634 | Not Available | 606 | Open in IMG/M |
| 3300000891|JGI10214J12806_10217963 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1187 | Open in IMG/M |
| 3300000912|JGI12032J12867_1006652 | Not Available | 685 | Open in IMG/M |
| 3300000956|JGI10216J12902_104008376 | Not Available | 903 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100320275 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1434 | Open in IMG/M |
| 3300002557|JGI25381J37097_1013362 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1448 | Open in IMG/M |
| 3300002886|JGI25612J43240_1073654 | Not Available | 534 | Open in IMG/M |
| 3300002908|JGI25382J43887_10003702 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 7015 | Open in IMG/M |
| 3300002910|JGI25615J43890_1054097 | Not Available | 666 | Open in IMG/M |
| 3300002910|JGI25615J43890_1086158 | Not Available | 552 | Open in IMG/M |
| 3300002914|JGI25617J43924_10233783 | Not Available | 617 | Open in IMG/M |
| 3300002917|JGI25616J43925_10110764 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1125 | Open in IMG/M |
| 3300004080|Ga0062385_10506214 | Not Available | 746 | Open in IMG/M |
| 3300004100|Ga0058904_1416964 | Not Available | 531 | Open in IMG/M |
| 3300004631|Ga0058899_12236183 | Not Available | 765 | Open in IMG/M |
| 3300005356|Ga0070674_101092176 | Not Available | 704 | Open in IMG/M |
| 3300005434|Ga0070709_11326673 | Not Available | 581 | Open in IMG/M |
| 3300005518|Ga0070699_101104307 | Not Available | 727 | Open in IMG/M |
| 3300005526|Ga0073909_10392371 | Not Available | 652 | Open in IMG/M |
| 3300005538|Ga0070731_11091053 | Not Available | 527 | Open in IMG/M |
| 3300005542|Ga0070732_10118002 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1570 | Open in IMG/M |
| 3300005542|Ga0070732_10600090 | Not Available | 669 | Open in IMG/M |
| 3300005555|Ga0066692_10022362 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3232 | Open in IMG/M |
| 3300005560|Ga0066670_10143789 | Not Available | 1386 | Open in IMG/M |
| 3300005561|Ga0066699_10869586 | Not Available | 631 | Open in IMG/M |
| 3300005568|Ga0066703_10350853 | Not Available | 887 | Open in IMG/M |
| 3300005575|Ga0066702_10584535 | Not Available | 672 | Open in IMG/M |
| 3300005576|Ga0066708_10208087 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1230 | Open in IMG/M |
| 3300005602|Ga0070762_11091566 | Not Available | 550 | Open in IMG/M |
| 3300005616|Ga0068852_102586216 | Not Available | 527 | Open in IMG/M |
| 3300005718|Ga0068866_10533390 | Not Available | 782 | Open in IMG/M |
| 3300005764|Ga0066903_103269786 | Not Available | 876 | Open in IMG/M |
| 3300005843|Ga0068860_102513257 | Not Available | 535 | Open in IMG/M |
| 3300005952|Ga0080026_10127867 | Not Available | 724 | Open in IMG/M |
| 3300005993|Ga0080027_10323361 | Not Available | 615 | Open in IMG/M |
| 3300006086|Ga0075019_10092378 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1732 | Open in IMG/M |
| 3300006163|Ga0070715_10070689 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1559 | Open in IMG/M |
| 3300006173|Ga0070716_101091977 | Not Available | 636 | Open in IMG/M |
| 3300006175|Ga0070712_100776720 | Not Available | 821 | Open in IMG/M |
| 3300006176|Ga0070765_100121483 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2291 | Open in IMG/M |
| 3300006176|Ga0070765_100442986 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1216 | Open in IMG/M |
| 3300006806|Ga0079220_10752405 | Not Available | 727 | Open in IMG/M |
| 3300006904|Ga0075424_100666463 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1111 | Open in IMG/M |
| 3300007076|Ga0075435_101231816 | Not Available | 655 | Open in IMG/M |
| 3300007258|Ga0099793_10060475 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1692 | Open in IMG/M |
| 3300007258|Ga0099793_10149467 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium | 1105 | Open in IMG/M |
| 3300009038|Ga0099829_10395802 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium | 1141 | Open in IMG/M |
| 3300009038|Ga0099829_11801963 | Not Available | 500 | Open in IMG/M |
| 3300009088|Ga0099830_10316613 | Not Available | 1248 | Open in IMG/M |
| 3300009088|Ga0099830_11175365 | Not Available | 637 | Open in IMG/M |
| 3300009088|Ga0099830_11307656 | Not Available | 603 | Open in IMG/M |
| 3300009090|Ga0099827_10073997 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium | 2639 | Open in IMG/M |
| 3300009090|Ga0099827_11858654 | Not Available | 525 | Open in IMG/M |
| 3300009137|Ga0066709_103697928 | Not Available | 555 | Open in IMG/M |
| 3300009143|Ga0099792_10546854 | Not Available | 731 | Open in IMG/M |
| 3300009148|Ga0105243_10714283 | Not Available | 978 | Open in IMG/M |
| 3300009521|Ga0116222_1397740 | Not Available | 599 | Open in IMG/M |
| 3300009792|Ga0126374_10728589 | Not Available | 749 | Open in IMG/M |
| 3300010046|Ga0126384_11412117 | Not Available | 649 | Open in IMG/M |
| 3300010046|Ga0126384_12390181 | Not Available | 511 | Open in IMG/M |
| 3300010127|Ga0127489_1105903 | Not Available | 816 | Open in IMG/M |
| 3300010321|Ga0134067_10287088 | Not Available | 631 | Open in IMG/M |
| 3300010336|Ga0134071_10195562 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 996 | Open in IMG/M |
| 3300010343|Ga0074044_10116860 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium | 1791 | Open in IMG/M |
| 3300010359|Ga0126376_10003181 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 9460 | Open in IMG/M |
| 3300010359|Ga0126376_12157745 | Not Available | 601 | Open in IMG/M |
| 3300010359|Ga0126376_12559305 | Not Available | 558 | Open in IMG/M |
| 3300010362|Ga0126377_10706699 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1061 | Open in IMG/M |
| 3300010366|Ga0126379_12236466 | Not Available | 648 | Open in IMG/M |
| 3300010376|Ga0126381_103388677 | Not Available | 628 | Open in IMG/M |
| 3300010859|Ga0126352_1180193 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium | 1026 | Open in IMG/M |
| 3300010865|Ga0126346_1321214 | Not Available | 505 | Open in IMG/M |
| 3300011120|Ga0150983_13550015 | Not Available | 523 | Open in IMG/M |
| 3300012096|Ga0137389_10620810 | Not Available | 929 | Open in IMG/M |
| 3300012189|Ga0137388_11208380 | Not Available | 694 | Open in IMG/M |
| 3300012198|Ga0137364_10870851 | Not Available | 681 | Open in IMG/M |
| 3300012203|Ga0137399_11076139 | Not Available | 677 | Open in IMG/M |
| 3300012209|Ga0137379_11818250 | Not Available | 503 | Open in IMG/M |
| 3300012210|Ga0137378_11614785 | Not Available | 557 | Open in IMG/M |
| 3300012349|Ga0137387_10366145 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1044 | Open in IMG/M |
| 3300012356|Ga0137371_11184997 | Not Available | 571 | Open in IMG/M |
| 3300012359|Ga0137385_10950938 | Not Available | 709 | Open in IMG/M |
| 3300012361|Ga0137360_11557899 | Not Available | 566 | Open in IMG/M |
| 3300012363|Ga0137390_10642597 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1026 | Open in IMG/M |
| 3300012375|Ga0134034_1035644 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1039 | Open in IMG/M |
| 3300012387|Ga0134030_1228043 | Not Available | 727 | Open in IMG/M |
| 3300012402|Ga0134059_1006597 | Not Available | 871 | Open in IMG/M |
| 3300012582|Ga0137358_10017830 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 4532 | Open in IMG/M |
| 3300012683|Ga0137398_11091753 | Not Available | 550 | Open in IMG/M |
| 3300012917|Ga0137395_11243531 | Not Available | 518 | Open in IMG/M |
| 3300012918|Ga0137396_10129446 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium | 1825 | Open in IMG/M |
| 3300012922|Ga0137394_10051366 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium | 3406 | Open in IMG/M |
| 3300012923|Ga0137359_10626928 | Not Available | 941 | Open in IMG/M |
| 3300012923|Ga0137359_10831351 | Not Available | 799 | Open in IMG/M |
| 3300012924|Ga0137413_10041639 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2604 | Open in IMG/M |
| 3300012925|Ga0137419_11436704 | Not Available | 583 | Open in IMG/M |
| 3300012927|Ga0137416_10690583 | Not Available | 896 | Open in IMG/M |
| 3300012929|Ga0137404_10512387 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1071 | Open in IMG/M |
| 3300012929|Ga0137404_12152196 | Not Available | 521 | Open in IMG/M |
| 3300012951|Ga0164300_10986340 | Not Available | 541 | Open in IMG/M |
| 3300013297|Ga0157378_10538181 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1172 | Open in IMG/M |
| 3300014199|Ga0181535_10244945 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1084 | Open in IMG/M |
| 3300014829|Ga0120104_1051478 | Not Available | 776 | Open in IMG/M |
| 3300015052|Ga0137411_1182369 | Not Available | 602 | Open in IMG/M |
| 3300015075|Ga0167636_1036238 | Not Available | 594 | Open in IMG/M |
| 3300015090|Ga0167634_1049247 | Not Available | 583 | Open in IMG/M |
| 3300015167|Ga0167661_1057843 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 723 | Open in IMG/M |
| 3300015197|Ga0167638_1106319 | Not Available | 529 | Open in IMG/M |
| 3300015356|Ga0134073_10230157 | Not Available | 630 | Open in IMG/M |
| 3300015358|Ga0134089_10154036 | Not Available | 908 | Open in IMG/M |
| 3300015359|Ga0134085_10137419 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1032 | Open in IMG/M |
| 3300016270|Ga0182036_10108224 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1904 | Open in IMG/M |
| 3300016319|Ga0182033_10595642 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 960 | Open in IMG/M |
| 3300016750|Ga0181505_10615821 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2437 | Open in IMG/M |
| 3300017823|Ga0187818_10507174 | Not Available | 542 | Open in IMG/M |
| 3300017929|Ga0187849_1177631 | Not Available | 843 | Open in IMG/M |
| 3300017931|Ga0187877_1074427 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1471 | Open in IMG/M |
| 3300017939|Ga0187775_10221181 | Not Available | 713 | Open in IMG/M |
| 3300017947|Ga0187785_10040274 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1721 | Open in IMG/M |
| 3300017959|Ga0187779_10456255 | Not Available | 841 | Open in IMG/M |
| 3300017966|Ga0187776_11239096 | Not Available | 561 | Open in IMG/M |
| 3300017972|Ga0187781_10109553 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1921 | Open in IMG/M |
| 3300017974|Ga0187777_10886263 | Not Available | 641 | Open in IMG/M |
| 3300017993|Ga0187823_10398300 | Not Available | 501 | Open in IMG/M |
| 3300018004|Ga0187865_1120875 | Not Available | 942 | Open in IMG/M |
| 3300018006|Ga0187804_10295302 | Not Available | 705 | Open in IMG/M |
| 3300018007|Ga0187805_10145328 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1078 | Open in IMG/M |
| 3300018020|Ga0187861_10026662 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3329 | Open in IMG/M |
| 3300018057|Ga0187858_10347467 | Not Available | 931 | Open in IMG/M |
| 3300018482|Ga0066669_10042717 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2797 | Open in IMG/M |
| 3300019788|Ga0182028_1025619 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1282 | Open in IMG/M |
| 3300019788|Ga0182028_1046915 | Not Available | 732 | Open in IMG/M |
| 3300019890|Ga0193728_1040008 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2308 | Open in IMG/M |
| 3300020061|Ga0193716_1292580 | Not Available | 555 | Open in IMG/M |
| 3300020199|Ga0179592_10155335 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1045 | Open in IMG/M |
| 3300020199|Ga0179592_10288263 | Not Available | 731 | Open in IMG/M |
| 3300020579|Ga0210407_11079234 | Not Available | 609 | Open in IMG/M |
| 3300020583|Ga0210401_10319754 | Not Available | 1413 | Open in IMG/M |
| 3300021168|Ga0210406_10142236 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2016 | Open in IMG/M |
| 3300021170|Ga0210400_10106747 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2222 | Open in IMG/M |
| 3300021170|Ga0210400_10334158 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1246 | Open in IMG/M |
| 3300021180|Ga0210396_10190049 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1837 | Open in IMG/M |
| 3300021401|Ga0210393_10436417 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1068 | Open in IMG/M |
| 3300021404|Ga0210389_11414164 | Not Available | 530 | Open in IMG/M |
| 3300021405|Ga0210387_10402119 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1213 | Open in IMG/M |
| 3300021420|Ga0210394_10603790 | Not Available | 964 | Open in IMG/M |
| 3300021433|Ga0210391_10230081 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1456 | Open in IMG/M |
| 3300021477|Ga0210398_10528887 | Not Available | 959 | Open in IMG/M |
| 3300021478|Ga0210402_10830119 | Not Available | 850 | Open in IMG/M |
| 3300021478|Ga0210402_11117624 | Not Available | 715 | Open in IMG/M |
| 3300021479|Ga0210410_10757297 | Not Available | 855 | Open in IMG/M |
| 3300021560|Ga0126371_10081108 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3183 | Open in IMG/M |
| 3300022498|Ga0242644_1007262 | Not Available | 927 | Open in IMG/M |
| 3300022712|Ga0242653_1046743 | Not Available | 694 | Open in IMG/M |
| 3300022712|Ga0242653_1094013 | Not Available | 542 | Open in IMG/M |
| 3300022724|Ga0242665_10177361 | Not Available | 689 | Open in IMG/M |
| 3300024290|Ga0247667_1006009 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2568 | Open in IMG/M |
| 3300025899|Ga0207642_10505713 | Not Available | 740 | Open in IMG/M |
| 3300025906|Ga0207699_10896675 | Not Available | 654 | Open in IMG/M |
| 3300025916|Ga0207663_11205749 | Not Available | 609 | Open in IMG/M |
| 3300025942|Ga0207689_10485739 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1034 | Open in IMG/M |
| 3300026304|Ga0209240_1105643 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 998 | Open in IMG/M |
| 3300026304|Ga0209240_1157711 | Not Available | 701 | Open in IMG/M |
| 3300026304|Ga0209240_1226863 | Not Available | 567 | Open in IMG/M |
| 3300026328|Ga0209802_1112774 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1205 | Open in IMG/M |
| 3300026334|Ga0209377_1004970 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 8290 | Open in IMG/M |
| 3300026490|Ga0257153_1008858 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2000 | Open in IMG/M |
| 3300026497|Ga0257164_1090043 | Not Available | 525 | Open in IMG/M |
| 3300026498|Ga0257156_1034115 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1034 | Open in IMG/M |
| 3300026529|Ga0209806_1106020 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1185 | Open in IMG/M |
| 3300026530|Ga0209807_1061254 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1706 | Open in IMG/M |
| 3300026532|Ga0209160_1087039 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1626 | Open in IMG/M |
| 3300026551|Ga0209648_10829936 | Not Available | 505 | Open in IMG/M |
| 3300026557|Ga0179587_10630933 | Not Available | 705 | Open in IMG/M |
| 3300026854|Ga0207727_123357 | Not Available | 547 | Open in IMG/M |
| 3300026910|Ga0207840_1019717 | Not Available | 672 | Open in IMG/M |
| 3300027024|Ga0207819_1040558 | Not Available | 567 | Open in IMG/M |
| 3300027035|Ga0207776_1048586 | Not Available | 508 | Open in IMG/M |
| 3300027045|Ga0207726_1005493 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2299 | Open in IMG/M |
| 3300027047|Ga0208730_1011770 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 946 | Open in IMG/M |
| 3300027069|Ga0208859_1008919 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1091 | Open in IMG/M |
| 3300027070|Ga0208365_1039782 | Not Available | 626 | Open in IMG/M |
| 3300027181|Ga0208997_1025748 | Not Available | 844 | Open in IMG/M |
| 3300027326|Ga0209731_1052340 | Not Available | 619 | Open in IMG/M |
| 3300027330|Ga0207777_1036887 | Not Available | 886 | Open in IMG/M |
| 3300027439|Ga0209332_1074277 | Not Available | 616 | Open in IMG/M |
| 3300027546|Ga0208984_1139718 | Not Available | 520 | Open in IMG/M |
| 3300027633|Ga0208988_1164779 | Not Available | 528 | Open in IMG/M |
| 3300027645|Ga0209117_1082844 | Not Available | 896 | Open in IMG/M |
| 3300027671|Ga0209588_1134165 | Not Available | 789 | Open in IMG/M |
| 3300027826|Ga0209060_10191745 | Not Available | 943 | Open in IMG/M |
| 3300027842|Ga0209580_10329778 | Not Available | 760 | Open in IMG/M |
| 3300027862|Ga0209701_10205797 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1171 | Open in IMG/M |
| 3300027862|Ga0209701_10450067 | Not Available | 708 | Open in IMG/M |
| 3300027894|Ga0209068_10749188 | Not Available | 574 | Open in IMG/M |
| 3300027905|Ga0209415_10943276 | Not Available | 581 | Open in IMG/M |
| 3300027908|Ga0209006_10477686 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1041 | Open in IMG/M |
| 3300027915|Ga0209069_10636886 | Not Available | 619 | Open in IMG/M |
| 3300027986|Ga0209168_10201739 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 995 | Open in IMG/M |
| 3300028293|Ga0247662_1036561 | Not Available | 840 | Open in IMG/M |
| 3300028789|Ga0302232_10292960 | Not Available | 804 | Open in IMG/M |
| 3300028906|Ga0308309_11879442 | Not Available | 505 | Open in IMG/M |
| 3300029636|Ga0222749_10776473 | Not Available | 524 | Open in IMG/M |
| 3300030521|Ga0307511_10409719 | Not Available | 553 | Open in IMG/M |
| 3300030707|Ga0310038_10416710 | Not Available | 581 | Open in IMG/M |
| 3300031047|Ga0073995_12180789 | Not Available | 601 | Open in IMG/M |
| 3300031057|Ga0170834_110186560 | Not Available | 813 | Open in IMG/M |
| 3300031231|Ga0170824_125369235 | Not Available | 765 | Open in IMG/M |
| 3300031545|Ga0318541_10429946 | Not Available | 738 | Open in IMG/M |
| 3300031561|Ga0318528_10097232 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1542 | Open in IMG/M |
| 3300031679|Ga0318561_10076452 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1725 | Open in IMG/M |
| 3300031715|Ga0307476_10706524 | Not Available | 746 | Open in IMG/M |
| 3300031718|Ga0307474_10463563 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 991 | Open in IMG/M |
| 3300031719|Ga0306917_10005941 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 6626 | Open in IMG/M |
| 3300031719|Ga0306917_10852852 | Not Available | 713 | Open in IMG/M |
| 3300031720|Ga0307469_10545939 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1025 | Open in IMG/M |
| 3300031720|Ga0307469_11177197 | Not Available | 723 | Open in IMG/M |
| 3300031720|Ga0307469_11900910 | Not Available | 576 | Open in IMG/M |
| 3300031730|Ga0307516_10784325 | Not Available | 614 | Open in IMG/M |
| 3300031744|Ga0306918_10214053 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1457 | Open in IMG/M |
| 3300031744|Ga0306918_11091905 | Not Available | 618 | Open in IMG/M |
| 3300031748|Ga0318492_10276904 | Not Available | 870 | Open in IMG/M |
| 3300031753|Ga0307477_10638054 | Not Available | 716 | Open in IMG/M |
| 3300031754|Ga0307475_10140688 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1911 | Open in IMG/M |
| 3300031754|Ga0307475_10399990 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1104 | Open in IMG/M |
| 3300031754|Ga0307475_10718266 | Not Available | 796 | Open in IMG/M |
| 3300031754|Ga0307475_11038110 | Not Available | 643 | Open in IMG/M |
| 3300031754|Ga0307475_11297052 | Not Available | 564 | Open in IMG/M |
| 3300031768|Ga0318509_10569974 | Not Available | 631 | Open in IMG/M |
| 3300031781|Ga0318547_10159732 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1330 | Open in IMG/M |
| 3300031819|Ga0318568_10425331 | Not Available | 828 | Open in IMG/M |
| 3300031820|Ga0307473_10060326 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1849 | Open in IMG/M |
| 3300031823|Ga0307478_11015302 | Not Available | 693 | Open in IMG/M |
| 3300031890|Ga0306925_10292915 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1751 | Open in IMG/M |
| 3300031897|Ga0318520_10497542 | Not Available | 752 | Open in IMG/M |
| 3300031942|Ga0310916_10426429 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1129 | Open in IMG/M |
| 3300031942|Ga0310916_10652193 | Not Available | 892 | Open in IMG/M |
| 3300031942|Ga0310916_11471466 | Not Available | 556 | Open in IMG/M |
| 3300031945|Ga0310913_10470467 | Not Available | 892 | Open in IMG/M |
| 3300031945|Ga0310913_10844150 | Not Available | 645 | Open in IMG/M |
| 3300031954|Ga0306926_10763566 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1168 | Open in IMG/M |
| 3300031962|Ga0307479_10022228 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 6000 | Open in IMG/M |
| 3300031962|Ga0307479_10283067 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1639 | Open in IMG/M |
| 3300031981|Ga0318531_10134330 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1103 | Open in IMG/M |
| 3300032001|Ga0306922_10657374 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1106 | Open in IMG/M |
| 3300032008|Ga0318562_10699513 | Not Available | 583 | Open in IMG/M |
| 3300032035|Ga0310911_10330312 | Not Available | 879 | Open in IMG/M |
| 3300032052|Ga0318506_10367898 | Not Available | 638 | Open in IMG/M |
| 3300032055|Ga0318575_10274677 | Not Available | 852 | Open in IMG/M |
| 3300032066|Ga0318514_10581787 | Not Available | 596 | Open in IMG/M |
| 3300032068|Ga0318553_10538193 | Not Available | 612 | Open in IMG/M |
| 3300032076|Ga0306924_11434975 | Not Available | 735 | Open in IMG/M |
| 3300032180|Ga0307471_100013106 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 5695 | Open in IMG/M |
| 3300032180|Ga0307471_100041963 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3676 | Open in IMG/M |
| 3300032180|Ga0307471_100063626 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3134 | Open in IMG/M |
| 3300032180|Ga0307471_102110256 | Not Available | 708 | Open in IMG/M |
| 3300032180|Ga0307471_102136471 | Not Available | 704 | Open in IMG/M |
| 3300032180|Ga0307471_102507622 | Not Available | 652 | Open in IMG/M |
| 3300032205|Ga0307472_101445874 | Not Available | 669 | Open in IMG/M |
| 3300032515|Ga0348332_10035836 | Not Available | 504 | Open in IMG/M |
| 3300033289|Ga0310914_10047289 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3533 | Open in IMG/M |
| 3300033289|Ga0310914_10659753 | Not Available | 940 | Open in IMG/M |
| 3300034819|Ga0373958_0136324 | Not Available | 604 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 18.25% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 15.21% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 8.37% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 5.70% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.94% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 4.94% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.80% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.80% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 3.42% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.04% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.66% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.66% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 2.28% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.28% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.52% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.52% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.14% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.14% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 1.14% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.14% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.14% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.76% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 0.76% |
| Ectomycorrhiza | Host-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza | 0.76% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.76% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.76% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.38% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.38% |
| Glacier Forefield Soils | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soils | 0.38% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.38% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.38% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.38% |
| Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 0.38% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.38% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.38% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.38% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.38% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.38% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.38% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.38% |
| Rhizosphere Soil | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil | 0.38% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.38% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000719 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 44 | Environmental | Open in IMG/M |
| 3300000891 | Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soil | Environmental | Open in IMG/M |
| 3300000912 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M3 | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300002557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm | Environmental | Open in IMG/M |
| 3300002886 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm | Environmental | Open in IMG/M |
| 3300002908 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002910 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm | Environmental | Open in IMG/M |
| 3300002914 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm | Environmental | Open in IMG/M |
| 3300002917 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_100cm | Environmental | Open in IMG/M |
| 3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300004100 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF244 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004631 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF234 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300005952 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-045 | Environmental | Open in IMG/M |
| 3300005993 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 | Environmental | Open in IMG/M |
| 3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009521 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010127 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_8_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010321 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015 | Environmental | Open in IMG/M |
| 3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010859 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010865 | Boreal forest soil eukaryotic communities from Alaska, USA - C3-3 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012375 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_8_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012387 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_16_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012402 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_8_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014199 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_30_metaG | Environmental | Open in IMG/M |
| 3300014829 | Permafrost microbial communities from Nunavut, Canada - A10_35cm_6M | Environmental | Open in IMG/M |
| 3300015052 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015075 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G5C, Northern proglacial tributary margin, adjacent to top of river) | Environmental | Open in IMG/M |
| 3300015090 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G5A, Northern proglacial tributary margin, adjacent to top of river) | Environmental | Open in IMG/M |
| 3300015167 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-11b, vegetated hydrological feature) | Environmental | Open in IMG/M |
| 3300015197 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G6B, Proglacial plain, adjacent to northern proglacial tributary) | Environmental | Open in IMG/M |
| 3300015356 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015359 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015 | Environmental | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016750 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
| 3300017929 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_100 | Environmental | Open in IMG/M |
| 3300017931 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_100 | Environmental | Open in IMG/M |
| 3300017939 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_10_MG | Environmental | Open in IMG/M |
| 3300017947 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300017993 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_3 | Environmental | Open in IMG/M |
| 3300018004 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_100 | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
| 3300018020 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_100 | Environmental | Open in IMG/M |
| 3300018057 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019788 | Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300019890 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1 | Environmental | Open in IMG/M |
| 3300020061 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2c1 | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022498 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-32-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022712 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-32-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022724 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300024290 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK08 | Environmental | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026328 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes) | Environmental | Open in IMG/M |
| 3300026334 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes) | Environmental | Open in IMG/M |
| 3300026490 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-A | Environmental | Open in IMG/M |
| 3300026497 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-08-B | Environmental | Open in IMG/M |
| 3300026498 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-49-A | Environmental | Open in IMG/M |
| 3300026529 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes) | Environmental | Open in IMG/M |
| 3300026530 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 (SPAdes) | Environmental | Open in IMG/M |
| 3300026532 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 (SPAdes) | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300026854 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 48 (SPAdes) | Environmental | Open in IMG/M |
| 3300026910 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 65 (SPAdes) | Environmental | Open in IMG/M |
| 3300027024 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 42 (SPAdes) | Environmental | Open in IMG/M |
| 3300027035 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 30 (SPAdes) | Environmental | Open in IMG/M |
| 3300027045 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 40 (SPAdes) | Environmental | Open in IMG/M |
| 3300027047 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF042 (SPAdes) | Environmental | Open in IMG/M |
| 3300027069 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF002 (SPAdes) | Environmental | Open in IMG/M |
| 3300027070 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF004 (SPAdes) | Environmental | Open in IMG/M |
| 3300027181 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027326 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027330 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 35 (SPAdes) | Environmental | Open in IMG/M |
| 3300027439 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027546 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027633 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027645 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027826 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027915 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300027986 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028293 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK03 | Environmental | Open in IMG/M |
| 3300028789 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_3 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Host-Associated | Open in IMG/M |
| 3300030707 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG (v2) | Environmental | Open in IMG/M |
| 3300031047 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-1B (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Host-Associated | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300031981 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032008 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18 | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032052 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19 | Environmental | Open in IMG/M |
| 3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
| 3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
| 3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12378J11916_1036342 | 3300000719 | Tropical Forest Soil | VAANIAEAEAQKGVRGTARRVRKALTGKQTAPKKGKK* |
| JGI10214J12806_102179631 | 3300000891 | Soil | AAAERHATIVAEAEANKGVRGTARRVRKALTGKSQPPKKGKKG* |
| JGI12032J12867_10066521 | 3300000912 | Forest Soil | ERVAANVAEAEAQKGVRGTARRVRKALTGKQAPSKKGKK* |
| JGI10216J12902_1040083761 | 3300000956 | Soil | SEHHVAAAERHASNVAEAEANKGVRGTARRVRKALTGKQQAAKKGKKG* |
| JGIcombinedJ26739_1003202751 | 3300002245 | Forest Soil | AERVAAIEAETEAQKGVRGTARRVRKALTGKXGXQPKKGKKK* |
| JGI25381J37097_10133621 | 3300002557 | Grasslands Soil | AAAERVAANVAEAEAQKGVRGTARRVRKALTGKQAPSKKGKK* |
| JGI25612J43240_10736541 | 3300002886 | Grasslands Soil | AERHAANVAEQESNKGVRGTARRVRKALTGKQTSGKKGKK* |
| JGI25382J43887_100037021 | 3300002908 | Grasslands Soil | HHMAAAERHAANLAEAEAQKGVRGVGRRVKKALAGKKVPAKKGKKK* |
| JGI25615J43890_10540972 | 3300002910 | Grasslands Soil | AVAEHHVAAAERVAAIEAEAEAQKGVRGTARRVRKALTGKQAPSKKGKK* |
| JGI25615J43890_10861581 | 3300002910 | Grasslands Soil | HHVAAAERVAAIQAEAQAQKGVRGTARRVRKALTGKQAPPKKGKK* |
| JGI25617J43924_102337832 | 3300002914 | Grasslands Soil | VAEHHIAAAERVAANVAEAESQKGVRGTARRVRKALTGKQAPAKKKGKK* |
| JGI25616J43925_101107641 | 3300002917 | Grasslands Soil | HHVAAAERVASNVAEQQANKGVRGTARRVRKALTGKQQAAKKGKKG* |
| Ga0062385_105062141 | 3300004080 | Bog Forest Soil | EHHVAAAERVAAIEAEAEAQKGVRGTARRVRKALTGKQAPPKKGKK* |
| Ga0058904_14169641 | 3300004100 | Forest Soil | AAAQRVAAIEAEAEAQKGVRGTARRVRKALAGKQGGPKKGKK* |
| Ga0058899_122361831 | 3300004631 | Forest Soil | AEHHVAAAERTAAIAAEAEAQKGVRGTARRVRKALTGKQAPAKKGKK* |
| Ga0070674_1010921762 | 3300005356 | Miscanthus Rhizosphere | VAAAERHATIVAEAEANKGVRGTARRVRKALTGKAQPPKKGKKG* |
| Ga0070709_113266731 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | AERVAAIEAETEAQKGVRGTARRVRKALTGKQGGQPKKGKKK* |
| Ga0070699_1011043071 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | AERHASNVAEAEANKGVRGTARRVRKALTGKQQAAKKGKKG* |
| Ga0073909_103923711 | 3300005526 | Surface Soil | AAAERHASIVAEAEANKGVRGTARRVRKALTGKSQAPKKGKKA* |
| Ga0070731_110910531 | 3300005538 | Surface Soil | EHHVAAAERHASIAAEAEANKGVRGTARRVRKALTGKQQAPKKGKKG* |
| Ga0070732_101180021 | 3300005542 | Surface Soil | GVAEHHVAAAERVAANLAEAESQKGARGTMRRVRKALTGKRTPSKKGKK* |
| Ga0070732_106000902 | 3300005542 | Surface Soil | AEHHVAAAQRVAAIEAEAEAQKGVRGTARRVRKALTGKQSGPKKGKK* |
| Ga0066692_100223621 | 3300005555 | Soil | RVAAIQAEAEAQKGVRGTARRVRKALTGKQAPPKKGKK* |
| Ga0066670_101437891 | 3300005560 | Soil | HVAARERVAANVAEAEAQKGVRGTARRVRKALTGKQAPPKKGKK* |
| Ga0066699_108695862 | 3300005561 | Soil | NVAEQESNKGVRGTARRVRKVLTGKQAPGKKGKK* |
| Ga0066703_103508531 | 3300005568 | Soil | RVAANVAEAEAQKGVRGTARRVRKALTGKQAPPKKGKK* |
| Ga0066702_105845351 | 3300005575 | Soil | IEAEAEAQKGVRGTARRVRKALTGKQQAPKKGKK* |
| Ga0066708_102080873 | 3300005576 | Soil | HASNIAEAEANKGVRGTARRVRKALTGKQQAAKKGKKG* |
| Ga0070762_110915662 | 3300005602 | Soil | VAEHHVAAAERVASNLAEAESQKGARGTIRRVRKALTGKRTAPKKGKK* |
| Ga0068852_1025862162 | 3300005616 | Corn Rhizosphere | VQVAEHHVAAAERHASNVAEAEANKGVRGTARRVRKALTGKAQPPKKGKKG* |
| Ga0068866_105333902 | 3300005718 | Miscanthus Rhizosphere | TAHLWVQVAEHHVAAAERHATIVAEAEANKGVRGTARRVRKALTGKSQPPKKGKKG* |
| Ga0066903_1032697861 | 3300005764 | Tropical Forest Soil | EHHVAAAERHATNVAEAEANKGVRGTARRVRKALTGKQQAPKKGKKG* |
| Ga0068860_1025132572 | 3300005843 | Switchgrass Rhizosphere | LWVQVAEHHMAAAERHASNVAEAEANKGVRGTARRVRKALTGKSQGPKKGKKA* |
| Ga0080026_101278671 | 3300005952 | Permafrost Soil | HHVAAAERVAAIEAETKAQKGVRGTARRVRKALTGKQGPQPKKGKK* |
| Ga0080027_103233612 | 3300005993 | Prmafrost Soil | AAIHAETEAQKGVRGTARRVRKALTGKQGPNPKKGKK* |
| Ga0075019_100923785 | 3300006086 | Watersheds | AAAERVAANIAEAEAQKGVRGTARRVRKALTGKQQAPSKKGKK* |
| Ga0070715_100706891 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | EAEAEAQKGVRGTARRVRKALTGKQAPPPKKGKK* |
| Ga0070716_1010919772 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | HTAAAERVAANLAEMEAQKGVRGTARRVRKALTGKQQAGKKGKK* |
| Ga0070712_1007767202 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | HHVAAAQRVAAIEAEAEAQKGVRGTARRVRKALAGKQSGPKKGKK* |
| Ga0070765_1001214836 | 3300006176 | Soil | VSEHHIAAAERVAANLAEAESHKGVRGTARRVRKALTGKQVAAKKKGKK* |
| Ga0070765_1004429861 | 3300006176 | Soil | AAAERVAAIEAEAEAQKGVRGTARRVRKALTGKQAPSKKGKK* |
| Ga0079220_107524051 | 3300006806 | Agricultural Soil | QVAEHHVAAAERHAANVAEAEANKGVRGTARRVRKALTGRQQAPRKGKKG* |
| Ga0075424_1006664631 | 3300006904 | Populus Rhizosphere | VAEHHVAAAERHAANVAEAEANKGVRGTARRVRKALTGRQQAPRKGKKG* |
| Ga0075435_1012318162 | 3300007076 | Populus Rhizosphere | AAAERVAANLAEMEAQKGVRGTARRVRKALTGKQQAGKKGKK* |
| Ga0099793_100604751 | 3300007258 | Vadose Zone Soil | HIAAAERVAANVAEAESQKGVRGTARRVRKALTGKQPPAKKKGKK* |
| Ga0099793_101494673 | 3300007258 | Vadose Zone Soil | VAANVAEAEAQKGVRGTARRVRKALTGKQGPSKKGKK* |
| Ga0099829_103958021 | 3300009038 | Vadose Zone Soil | AAAQRVAAIEAEAEAQKGVRGTARRVRKALSGRQSGPKKGKK* |
| Ga0099829_118019632 | 3300009038 | Vadose Zone Soil | AAAERVAANVAEAEAQKGVRGTARRVRKALTGKQQAPSKKGKK* |
| Ga0099830_103166131 | 3300009088 | Vadose Zone Soil | RVASNIAEAEANKGVRGTARRVRKALTGKQQAAKKGKKG* |
| Ga0099830_111753651 | 3300009088 | Vadose Zone Soil | HVAAAERVAANVAEAEAQKGVRGTARRVRKALTGKQQGPSKKGKK* |
| Ga0099830_113076562 | 3300009088 | Vadose Zone Soil | VAAAERVAANVAEAEAQKGVRGTARRVRKALTGKQQAPSKKGKK* |
| Ga0099827_100739978 | 3300009090 | Vadose Zone Soil | IEAEAEAQKGVRGTARRVRKALAGKQRAPKKGKK* |
| Ga0099827_118586541 | 3300009090 | Vadose Zone Soil | VAANVAEAEAQKGVRGTARRVRKALTGKQAPSKKGKK* |
| Ga0066709_1036979282 | 3300009137 | Grasslands Soil | IEAEAQAQKGVRGTARRVRKALTGKQQPPKKGKK* |
| Ga0099792_105468541 | 3300009143 | Vadose Zone Soil | NVAEAEAQKGVRGTARRVRKALTGKQQAPSKKGKK* |
| Ga0105243_107142833 | 3300009148 | Miscanthus Rhizosphere | VAEHHVAAAERHATIVAEAEANKGVRGTARRVRKALTGKAQPPKKGKKG* |
| Ga0116222_13977402 | 3300009521 | Peatlands Soil | AANIAEAEAQKGVRGTARRVRKALTGKQSPAKKGKK* |
| Ga0126374_107285892 | 3300009792 | Tropical Forest Soil | AAAERHAANVAEAEANKGVRGTARRVRKALTGKQQAPRKGKKG* |
| Ga0126384_114121172 | 3300010046 | Tropical Forest Soil | RHAANVAEAEAQKGVRGTARRVRKAITGKHGARKKGKK* |
| Ga0126384_123901812 | 3300010046 | Tropical Forest Soil | AEHHVAAAERHAANVAEQESNKGVRGTARRVRKALTGKQAPGKKGKK* |
| Ga0127489_11059031 | 3300010127 | Grasslands Soil | AIEAEAQAQKGVRGTARRVRKALTGKQAPPKKGKK* |
| Ga0134067_102870882 | 3300010321 | Grasslands Soil | AEHHVAAAQRVAAIEAEAQAQKGVRGTARRVRKALTGKQQPPKKGKK* |
| Ga0134071_101955621 | 3300010336 | Grasslands Soil | VAEHHVAAAQRVAAIEAEAEAQKGVRGTARRVRKALTGKQAPRKKGKK* |
| Ga0074044_101168605 | 3300010343 | Bog Forest Soil | EHHVAAAERVASNLAEAEAQKGARGTIRRVRKALTGKRAPSKKGKK* |
| Ga0126376_1000318119 | 3300010359 | Tropical Forest Soil | AEHHVAAAERHAANVAEAESNKGVRGTARRVRKALTGKQTSGKKGKK* |
| Ga0126376_121577452 | 3300010359 | Tropical Forest Soil | AHIWVGVSEHHIAAAERVAANIAEEQAQKGVRGTARRVRKALTGKQAPAKKGRK* |
| Ga0126376_125593052 | 3300010359 | Tropical Forest Soil | AAAERHATNVAEAEANKGVRGTARRVRKALTGKSQAPKKGKKA* |
| Ga0126377_107066991 | 3300010362 | Tropical Forest Soil | KRTAHLWVAVAEHHVAAAERHAANVAEAESNKGVRGTARRVRKALTGKQTSGKKGKK* |
| Ga0126379_122364661 | 3300010366 | Tropical Forest Soil | AAERHAANVAEAEANKGVRGTARRVRKALTGKQMAKKKGKK* |
| Ga0126381_1033886771 | 3300010376 | Tropical Forest Soil | AERHAANVAEAEAQKGARGTMRRVRKALTGKQQPPKKGKK* |
| Ga0126352_11801933 | 3300010859 | Boreal Forest Soil | AEHHVAAAERVAANVAEAESQKGARGTIRRVRKALTGKRTPSKKGKK* |
| Ga0126346_13212141 | 3300010865 | Boreal Forest Soil | HVAAAERTAAIAAEAQAQKGVRGTARRVRKALTGKQQAPKKGKK* |
| Ga0150983_135500152 | 3300011120 | Forest Soil | AERVAANVAEAEAQKGVRGTARRVRKALTGKQQAPKKGKKK* |
| Ga0137389_106208101 | 3300012096 | Vadose Zone Soil | AEHHVAAAERVAANVAEAEAQKGVRGTARRVRKALTGKQQGPSKKDKK* |
| Ga0137388_112083802 | 3300012189 | Vadose Zone Soil | HLWVAVAEHHIAAAERVAAIEAEAEAQKGVRGTARRVRKALTGKQARPKKGKK* |
| Ga0137364_108708511 | 3300012198 | Vadose Zone Soil | VAAAERVAANVAEAEAQKGVRGTARRVRKALTGKQAPSKKDKK* |
| Ga0137399_110761392 | 3300012203 | Vadose Zone Soil | ANVAEAEAQKGVRGTARRVRKALTGKQGPSKKGKK* |
| Ga0137379_118182502 | 3300012209 | Vadose Zone Soil | VAAAERVAAIQAEAEAQKGVRGTARRVRKALTGKQGPSKKGKK* |
| Ga0137378_116147851 | 3300012210 | Vadose Zone Soil | VAEAEANKGVRGTARRVRKALTGKQQAAKKGKKG* |
| Ga0137387_103661451 | 3300012349 | Vadose Zone Soil | EHHMAAAERHAANLAEAEAQKGVRGVGRRVKKALAGKKVPAKKGKKK* |
| Ga0137371_111849972 | 3300012356 | Vadose Zone Soil | HLAAAERHAANLAEAEAQKGVRGVGRRVKKALAGKKVPAKKGKKK* |
| Ga0137385_109509381 | 3300012359 | Vadose Zone Soil | HHVAAAERVAAIQAEAEAQKGVRGTARRVRKALTGKQAPSKKGKK* |
| Ga0137360_115578992 | 3300012361 | Vadose Zone Soil | AAAERVAANVAEAEAQKGVRGTARRVRKALTGKQAPPKKGKK* |
| Ga0137390_106425971 | 3300012363 | Vadose Zone Soil | NIAEAEANKGVRGTARRVRKALTGKQQAAKKGKKG* |
| Ga0134034_10356443 | 3300012375 | Grasslands Soil | VAARERVAANVAEAEAQKGVRGTARRVRKALTGKQAPPKKGKK* |
| Ga0134030_12280432 | 3300012387 | Grasslands Soil | AEHHVAAAERVAAIEAEAQAQKGVRGTARRVRKALTGKQAPPKKGKK* |
| Ga0134059_10065971 | 3300012402 | Grasslands Soil | QRVAAIEAEAEAQKGVRGTARRVRKALTGKQAPSKKGRK* |
| Ga0137358_100178301 | 3300012582 | Vadose Zone Soil | RTAHLWVAVAEHHVAAAERVAAIEAEAEAQKGVRGTARRVRKALTGKQAPSKKGKK* |
| Ga0137398_110917532 | 3300012683 | Vadose Zone Soil | AERVASNVAEQQANKGVRGTARRVRKALTGKQQAAKKGKKG* |
| Ga0137395_112435311 | 3300012917 | Vadose Zone Soil | GVAEHHIAAAERVAANVAEAEAQKGVRGTARRVRKALTGKQGPSKKGKK* |
| Ga0137396_101294465 | 3300012918 | Vadose Zone Soil | IEAEAEAQKGVRGTARRVRKALTGKQAPPKKGKK* |
| Ga0137394_100513661 | 3300012922 | Vadose Zone Soil | AERVAANVAEAEAQKGVRGTARRVRKALTGKQQRPSKKGKK* |
| Ga0137359_106269282 | 3300012923 | Vadose Zone Soil | AAIEAEAEAQKGVRGTARRVRKALVGKQQSPKKGKK* |
| Ga0137359_108313511 | 3300012923 | Vadose Zone Soil | VWVAVSEHHVAAAQRHASNGAEQEANKGVRGTGRRVRKALTGKQQAAKKGKKG* |
| Ga0137413_100416391 | 3300012924 | Vadose Zone Soil | NVAEQESNKGVRGTARRVRKALTGKQAPGKKGKK* |
| Ga0137419_114367041 | 3300012925 | Vadose Zone Soil | ANVAEAEAQKGVRGTARRVRKALTGKQAPSKKGKK* |
| Ga0137416_106905832 | 3300012927 | Vadose Zone Soil | AAAQRVAAIEAEAEAQKGVRGTARRVRKALAGKQSGPKKGKK* |
| Ga0137404_105123873 | 3300012929 | Vadose Zone Soil | AAIEAEAEAQKGVRGTARRVRKALTGKQAPPKKGKK* |
| Ga0137404_121521962 | 3300012929 | Vadose Zone Soil | AAAQRVAAIEAEAEAQKGVRGTARRVRKALAGKQSGHKKGKK* |
| Ga0164300_109863402 | 3300012951 | Soil | AAIEAEAEAQKGVRGTARRVRKALTGKQQPLKKGKK* |
| Ga0157378_105381813 | 3300013297 | Miscanthus Rhizosphere | LWVQVAEHHVAAAERHATIVAEAEANKGVRGTARRVRKALTGKSQPPKKGKKG* |
| Ga0181535_102449453 | 3300014199 | Bog | EHHVAAAERVAANLAEAEAQKGVRGTARRVRKALTGKQAPAKKGKK* |
| Ga0120104_10514781 | 3300014829 | Permafrost | AAIEAENESQKGVRGTARRVRKALTGKQQPKPKKGKK* |
| Ga0137411_11823691 | 3300015052 | Vadose Zone Soil | MWQQRSRVAAIEAEAEAQKGVRGTARRVRKALTGKQAPPKKGKK* |
| Ga0167636_10362381 | 3300015075 | Glacier Forefield Soils | AAIEAETEAQKGVRGTARRVRKALTGKQGPNPKKSKK* |
| Ga0167634_10492472 | 3300015090 | Glacier Forefield Soil | EHHVAAAERVAAIKEEAEAQKGVRGTARRVRKALTGKQASPKKGKK* |
| Ga0167661_10578432 | 3300015167 | Glacier Forefield Soil | VAAAERVAAIEAETEAQKGVRGTARRVRKALTGKQGAQPKKGKKK* |
| Ga0167638_11063192 | 3300015197 | Glacier Forefield Soil | VAAAERVAAIEAESEAQKGVRGTARRVRKALTGKQGGGQPKKGKKK* |
| Ga0134073_102301572 | 3300015356 | Grasslands Soil | RYQRGTADLWVGVGEHKVAAAERVDANVAEAEAQKGVRGTARRVRKALTGKQAPSKKGKK |
| Ga0134089_101540361 | 3300015358 | Grasslands Soil | VAAAERVAANVAEAEAQKGVRGTARRVRKALTGKQAPPKKGKK* |
| Ga0134085_101374193 | 3300015359 | Grasslands Soil | AERVAAIQAEAEAQKGVRGTARRVRKALTGKQAPPKKGKK* |
| Ga0182036_101082241 | 3300016270 | Soil | HHIAAAERVAANLAEAEAQKGVRGTARRVRKALTGKQAPPKKGKK |
| Ga0182033_105956423 | 3300016319 | Soil | ANIAEEQAQKGVRGTARRVRKALTGKQAPAKKGRK |
| Ga0181505_106158217 | 3300016750 | Peatland | VAEHHVAAAERVAANLAEAEAQKGVRGTARRVRKALTGKQTPGKKGKK |
| Ga0187818_105071741 | 3300017823 | Freshwater Sediment | EHHVAAAERVAANIAEAEAQKGVRGTARRVRKALTGKQAPGKKGKK |
| Ga0187849_11776311 | 3300017929 | Peatland | RVAANIAEAEAQKGVRGTARRVRKALTGKQSPRKKGKK |
| Ga0187877_10744273 | 3300017931 | Peatland | AHIWVGVSEHHVAAAERVAANIAEAEAQKGVRGTARRVRKALTGKQSPRKKGKK |
| Ga0187775_102211812 | 3300017939 | Tropical Peatland | TAERTAAIAAEAEAQKGVRGTARRVRKVLTGRQTPSKKGKK |
| Ga0187785_100402745 | 3300017947 | Tropical Peatland | AERVAANIAEAEAQKGVRGTARRVRKALTGKQSAPKKGKK |
| Ga0187779_104562551 | 3300017959 | Tropical Peatland | AAAERTAAIAAEAEAQKGVRGTARRVRKALTGRQTPQKKGKK |
| Ga0187776_112390961 | 3300017966 | Tropical Peatland | AERVAANIAEAEAQKGARGTMRRVRKALTGKQGPTKKGKK |
| Ga0187781_101095535 | 3300017972 | Tropical Peatland | HVAAAERVAANIAEAEAQKGVRGTARRVRKALTGKQAPPKKGKK |
| Ga0187777_108862632 | 3300017974 | Tropical Peatland | ANIAEAEAQKGVRGTARRVRKALTGKQTAPKKGKK |
| Ga0187823_103983001 | 3300017993 | Freshwater Sediment | VASNLAEAEAQKGARGTIRRVRKALTGKRTPSKKGKK |
| Ga0187865_11208751 | 3300018004 | Peatland | HIWVGVSEHHVAAAERVAANIAEAEAQKGVRGTARRVRKALTGKQSPRKKGKK |
| Ga0187804_102953022 | 3300018006 | Freshwater Sediment | GVAEHHVAAAERVAANIAEAEAQKGVRGTARRVRKALTGKQQAPKKGKK |
| Ga0187805_101453283 | 3300018007 | Freshwater Sediment | AANIAEAEAEKGVRGTARRVRKALTGKQAGPKKGKK |
| Ga0187861_100266621 | 3300018020 | Peatland | AHIWVGVSEHHVAAAERVAANIAEAEAQKGVRGTARRVRKALTGKQSPAKKGKK |
| Ga0187858_103474671 | 3300018057 | Peatland | HHVAAAERVAANLAEAEAQKGVRGTARRVRKALTGKQAPAKKGKK |
| Ga0066669_100427178 | 3300018482 | Grasslands Soil | GAAIEAEAQEQKGVRGTARRVRKALTGKQAPPKKGKK |
| Ga0182028_10256193 | 3300019788 | Fen | AANIAEAEAQNGVRGTARRVRKALTGKQSPAKKGKK |
| Ga0182028_10469151 | 3300019788 | Fen | HVAAVGVSEHHVAAAERVAANIAEAEAQKGVRGTARRVRKALTGKQSPAKKGKK |
| Ga0193728_10400081 | 3300019890 | Soil | HASNVAEAEANKGVRGTARRVRKALTGKQQAAKKGKKG |
| Ga0193716_12925802 | 3300020061 | Soil | AQRVASNEAEVEAQKGVRGTARRVRKALTGKQAPAKKKGKK |
| Ga0179592_101553353 | 3300020199 | Vadose Zone Soil | EHHVAAAERVAANVAEAEAQKGVRGTARRVRKALTGKQAPSKKGKK |
| Ga0179592_102882631 | 3300020199 | Vadose Zone Soil | QRVAAIEAEAEAQKGVRGTARRVRKALAGKQGGPKKGKK |
| Ga0210407_110792342 | 3300020579 | Soil | KRTAHLWIVVKEHHVAAAERHAANVAEAESQKGVRGTARRVRKALTGKQVAGKKGKK |
| Ga0210401_103197541 | 3300020583 | Soil | HVAAAERVASNLAEAEAQKGARGTIRRVRKALTGKRAPSKKGKK |
| Ga0210406_101422365 | 3300021168 | Soil | AAERVAANIAEAESQKGVRGTARRVRKALTGKQPPAKKKGKK |
| Ga0210400_101067471 | 3300021170 | Soil | AIEAEAEAQKGVRGTARRVRKALTGKQVGPKKGKK |
| Ga0210400_103341583 | 3300021170 | Soil | RLASNLAEAEAQKGARGTIRRVRKALTGKRTPSKKGKK |
| Ga0210396_101900495 | 3300021180 | Soil | HVAAAERVASNLAEAESQKGARGTIRRVRKALTGKRTAPTKKGKK |
| Ga0210393_104364173 | 3300021401 | Soil | WWGDVAEHHVAAAERVASNLAEAEAEKGARGTIRRVRKALTGKRPSKKGKK |
| Ga0210389_114141641 | 3300021404 | Soil | AAIQEEAEAQKGVRGTARRVRKALTGKQAPPKKGKKK |
| Ga0210387_104021191 | 3300021405 | Soil | GVGVSEHHVAAAERVAAIEAEAEAQKGVRGTARRVRKALTGKQAPPKKGKK |
| Ga0210394_106037901 | 3300021420 | Soil | VAEHHVAAAERVASNLAEAEANKGVRGTARRVRKALTGKQQAAKKGKKG |
| Ga0210391_102300814 | 3300021433 | Soil | SNLAEAEAQKGARGTIRRVRKALTGKRTPSKKGKK |
| Ga0210398_105288872 | 3300021477 | Soil | AIEAEAEAQKGVRGTARRVRKALTGKQAPPKKGKK |
| Ga0210402_108301191 | 3300021478 | Soil | AERVAAIEAEAEAQKGVRGTARRVRKALTGKQQPPKKGKK |
| Ga0210402_111176241 | 3300021478 | Soil | VAAAERVASNLAEAEAEKGARGTIRRVRKALTGKRPSKKGKK |
| Ga0210410_107572972 | 3300021479 | Soil | GVAEHHVAAAERVAANVAEAEAQKGVRGTARRVRKALTGKQQGPSKKGKK |
| Ga0126371_100811081 | 3300021560 | Tropical Forest Soil | HHVAAAERVAANIAEVEAQKGVRGTARRVRKALTGKQAPAKKGKK |
| Ga0242644_10072622 | 3300022498 | Soil | GVAEHHTAAAERVAANLAEMEAQKGVRGTARRVRKALTGKQQAGKKGKK |
| Ga0242653_10467431 | 3300022712 | Soil | EHHVAAAERVAANIAEAESQKGVKGTARRVRKALTGKQAPAKKKGKK |
| Ga0242653_10940131 | 3300022712 | Soil | HVAAAQRVAAIEAETEAQKGVRGTARRVRKALAGKQGGPKKGKK |
| Ga0242665_101773611 | 3300022724 | Soil | AERVAANVAEAEAQKGVRGTARRVRKALTGKQQAPKKGKK |
| Ga0247667_10060091 | 3300024290 | Soil | AEHHVAAAERVAANVAEAEAQKGARGTIRRVRKALTGKRAPSKKGKK |
| Ga0207642_105057132 | 3300025899 | Miscanthus Rhizosphere | AAERHATIVAEAEANKGVRGTARRVRKALTGKSQPPKKGKKG |
| Ga0207699_108966751 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | ERVAANVAEAEAQKGARGTIRRVRKALTGKRAPSKKGKK |
| Ga0207663_112057492 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | WVAVAEHHVAAAERHAANVAEQESNKGVRGTARRVRKALTGKQAPGKKGKK |
| Ga0207689_104857393 | 3300025942 | Miscanthus Rhizosphere | AAIEAEAEAQKGVRGTARRVRKALTGKQQPPKKGKK |
| Ga0209240_11056431 | 3300026304 | Grasslands Soil | EHHVAAAERVAAIQAEAQAQKGVRGTARRVRKALTGKQAPPKKGKK |
| Ga0209240_11577111 | 3300026304 | Grasslands Soil | RVAAIEAEAEAQKGVRGTARRVRKALVGKQQSPKKGKK |
| Ga0209240_12268631 | 3300026304 | Grasslands Soil | RVAAIEAEAEAQKGVRGTARRVRKALAGKQSGPKKGKK |
| Ga0209802_11127741 | 3300026328 | Soil | VAANVAEAEAQKGVRGTARRVRKALTGKQAPPKKGKK |
| Ga0209377_100497017 | 3300026334 | Soil | VAEHHMAAAERHAANLAEAEAQKGVRGVGRRVKKALAGKKVPAKKGKKK |
| Ga0257153_10088581 | 3300026490 | Soil | RVAANIAEAESQKGVRGTARRVRKALTGKQPPAKKKGKK |
| Ga0257164_10900432 | 3300026497 | Soil | AAQRVAAIEAEAEAQKGVRGTARRVRKALTGKQAPPKKGKK |
| Ga0257156_10341151 | 3300026498 | Soil | YHVAAAQRVAAIEAEAEAQKGVRGTARRVRKALVGKQQSPKKGKK |
| Ga0209806_11060203 | 3300026529 | Soil | EHHVAAAERVAANVAEAEAQKGVRGTARRVRKALTGKQAPPKKGKK |
| Ga0209807_10612541 | 3300026530 | Soil | AEHHVAAAERVAAIEAEAQAQKGVRGTARRVRKALTGKQAPPKKGKK |
| Ga0209160_10870391 | 3300026532 | Soil | HHVAAAERVAANVAEAEAQKGVRGTARRVRKALTGKQAPPKKGKK |
| Ga0209648_108299362 | 3300026551 | Grasslands Soil | VAAIEAEAEAQKGVRGTARRVRKALVGKQQSPKKGKK |
| Ga0179587_106309332 | 3300026557 | Vadose Zone Soil | VAANVAEAEAQKGVRGTARRVRKALTGKQAPSKKGKK |
| Ga0207727_1233572 | 3300026854 | Tropical Forest Soil | IWVGVSEHHVAAAERVAANIAEAEAQKGVRGTARRVRKALTGKQTAPKKGKK |
| Ga0207840_10197171 | 3300026910 | Tropical Forest Soil | PRGPEADPHHVAAAERVAANIAEAEAQKGVRGTARRVRKALTGKQTAPKKGKK |
| Ga0207819_10405582 | 3300027024 | Tropical Forest Soil | HIAAAERVAANLAEAEAQKGVRGTARRVRKALTGKQTSPKKGKK |
| Ga0207776_10485862 | 3300027035 | Tropical Forest Soil | AANIAEAEAQKGVRGTARRVRKALTGKQAPGKKGKK |
| Ga0207726_10054931 | 3300027045 | Tropical Forest Soil | RVAANIAEAEAQKGVRGTARRVRKALTGKQTAPKKGKK |
| Ga0208730_10117701 | 3300027047 | Forest Soil | GVAEHHVAAAERVAANIAEAESQKGVRGTARRVRKALTGKQAPAKKKGKK |
| Ga0208859_10089193 | 3300027069 | Forest Soil | RVAAIEAEAEAQKGVRGTARRVRKALTGKQAPPKKGKK |
| Ga0208365_10397822 | 3300027070 | Forest Soil | VAAIEAEAEAQKGVRGTARRVRKALSGKQGAPKKGKK |
| Ga0208997_10257482 | 3300027181 | Forest Soil | GVAEHHVAAAQRVAAIEAEAEAQKGVRGTARRVRKALAGKQGGPKKGKK |
| Ga0209731_10523401 | 3300027326 | Forest Soil | RVAANIAEAEAQKGVRGTARRVRKALTGKQTQGKKGKK |
| Ga0207777_10368871 | 3300027330 | Tropical Forest Soil | VAAAERVAANIAEAEAQKGVRGTARRVRKALTGKQAPGKKGKK |
| Ga0209332_10742772 | 3300027439 | Forest Soil | HHVAAAERVAANIAEAESQKGVRGTARRVRKALTGKQAPAKKKGKK |
| Ga0208984_11397181 | 3300027546 | Forest Soil | EHHVAAAQRVAAIEAEAEAQKGVRGTARRVRKALAGKQGGPKKGKK |
| Ga0208988_11647792 | 3300027633 | Forest Soil | AAIEAEAEAQKGVRGTARRVRKALAGKQGGPKKGKK |
| Ga0209117_10828442 | 3300027645 | Forest Soil | GVAEHHVAAAERVAATEAEAEAQKGVRGTARRVRKALTGKQVASKKSKK |
| Ga0209588_11341651 | 3300027671 | Vadose Zone Soil | GVAEHHVAAAERVAANVAEAEAQKGVRGTARRVRKALTGKQGPSKKGKK |
| Ga0209060_101917453 | 3300027826 | Surface Soil | IGVAEHHVAAAERVAANVAEAEAQKGVRGTARRVRKALTGKQAPGKKGKK |
| Ga0209580_103297781 | 3300027842 | Surface Soil | AERVAANIAEAESQKGVRGTARRVRKALTGKQPPAKKKGKK |
| Ga0209701_102057973 | 3300027862 | Vadose Zone Soil | EHHMAAAERVAANVAEAEAQKGVRGTARRVRKALTGKQGPSKKGKK |
| Ga0209701_104500672 | 3300027862 | Vadose Zone Soil | AAIEAEAAAQKGVRGTARRVRKALTGKQAPPKKGKK |
| Ga0209068_107491881 | 3300027894 | Watersheds | HVAAAERVAANVAEAEAQKGVRGTARRVRKALTGKQQGPSKKGKK |
| Ga0209415_109432761 | 3300027905 | Peatlands Soil | VAEHHVAAAERVAANIAEAEAQKGVRGTARRVRKALTGKQVRGKKGKK |
| Ga0209006_104776863 | 3300027908 | Forest Soil | AERVAAIEAETEAQKGVRGTARRVRKALTGKQVAHPKKGKKK |
| Ga0209069_106368862 | 3300027915 | Watersheds | RPSLGVAEHHVAAAERVAANVAEAEAQKGVRGTARRVRKALTGKQAPSKKGKK |
| Ga0209168_102017393 | 3300027986 | Surface Soil | RVAANLAEAESQKGARGTMRRVRKALTGKRTPSKKGKK |
| Ga0247662_10365611 | 3300028293 | Soil | HVAAAERHASIVAEAEANKGVRGTARRVRKALTGKSQPPKKGKKA |
| Ga0302232_102929602 | 3300028789 | Palsa | AEHHIAAAERVAAIEAETEAHKGVRGTARRVRKALTGKQATPRKKGKK |
| Ga0308309_118794422 | 3300028906 | Soil | AAIEAEAEAQKGVRGTARRVRKALTGKQAPPKKGNK |
| Ga0222749_107764732 | 3300029636 | Soil | EHHVAAAERVAANIAEAESQKGVRGTARRVRKALTGKQPPAKKKGKK |
| Ga0307511_104097192 | 3300030521 | Ectomycorrhiza | NQAEAEAQKGVRGTARRVRKALTGKQNAPKKKGKK |
| Ga0310038_104167102 | 3300030707 | Peatlands Soil | VAANIAEAEAQKGVRGTARRVRKALTGKQTQGKKGKK |
| Ga0073995_121807891 | 3300031047 | Soil | AAERVAANVAEAEAQKGVRGTARRVRKALTGKQAPSKKGKK |
| Ga0170834_1101865601 | 3300031057 | Forest Soil | VAAAERVAANQAEAEAQKGVRGTARRVRKALTGKNAPKKGKKK |
| Ga0170824_1253692352 | 3300031231 | Forest Soil | AAAERVAANVAEAESQKGVRGTARRVRKALTGKQPPAKKKGKK |
| Ga0318541_104299462 | 3300031545 | Soil | HVAAAERLAANIAEVEAQKGVRGTARRVRKALTGKQAPAKKGKK |
| Ga0318528_100972321 | 3300031561 | Soil | AANIAEEQAQKGVRGTARRVRKALTGKQAPAKKGRK |
| Ga0318561_100764521 | 3300031679 | Soil | SEHYIAAAERVAANIAEEQAQKGVRGTARRVRKALTGKQAPAKKGRK |
| Ga0307476_107065242 | 3300031715 | Hardwood Forest Soil | AEHHVAAAERVAANVAEAESQKGARGTIRRVRKALTGKRTAPTKKGKK |
| Ga0307474_104635633 | 3300031718 | Hardwood Forest Soil | WVAVSEHHIAAAERHASNVAEAEANKGVRGTARRVRKALTGKQQAAKKGKKG |
| Ga0306917_100059411 | 3300031719 | Soil | HIAAAERVAAIQAEAEAQKGVRGTARRVRKALTGKQAAGKKGKK |
| Ga0306917_108528521 | 3300031719 | Soil | ANIAEAEAQKGVRGTARRVRKALTGKQAPAKKGKK |
| Ga0307469_105459391 | 3300031720 | Hardwood Forest Soil | VAAAERHAANVAEQESNKGVRGTARRVRKALTGKQTSGKKGKK |
| Ga0307469_111771971 | 3300031720 | Hardwood Forest Soil | VAAIEAEAEAQKGVRGTARRVRKALTGKQAPPKKGKK |
| Ga0307469_119009102 | 3300031720 | Hardwood Forest Soil | AERVAANLAEMEAQKGVRGTARRVRKALTGKQQAGKKGKK |
| Ga0307516_107843252 | 3300031730 | Ectomycorrhiza | TAHVTVAVAEHHVAAAERVASNLAEAEANKGVRGTARRVRKALTGKQQAAKKGKKG |
| Ga0306918_102140534 | 3300031744 | Soil | VAANIAEEQAQKGVRGTARRVRKALTGKQAPAKKGRK |
| Ga0306918_110919051 | 3300031744 | Soil | VSEHHIAAAERVAANIAEAEAQKGVRGTARRVRKVLTGKQTSPKKGKK |
| Ga0318492_102769041 | 3300031748 | Soil | HYIAAAERVAANIAEEQAQKGVRGTARRVRKALTGKQAPAKKGRK |
| Ga0307477_106380542 | 3300031753 | Hardwood Forest Soil | SNVAEAEANKGVRGTARRVRKALTGKQQAAKKGKKG |
| Ga0307475_101406885 | 3300031754 | Hardwood Forest Soil | AEHHVAAAQRVAAIEAEAEAQKGVRGTARRVRKALSGRQSGPKKGKK |
| Ga0307475_103999903 | 3300031754 | Hardwood Forest Soil | HHVAAAQRVAAIEAEAEAQKGVRGTARRVRKALTGKQAPPKKGKK |
| Ga0307475_107182661 | 3300031754 | Hardwood Forest Soil | GVAEHHVAAAQRVAAIEAEAEAQKGVRGTARRVRKALTGKQGAPKKGKK |
| Ga0307475_110381101 | 3300031754 | Hardwood Forest Soil | ANVAEAEAQKGVRGTARRVRKALTGKQAPSKKGKK |
| Ga0307475_112970521 | 3300031754 | Hardwood Forest Soil | ERVAAIEAETEAQKGVRGTARRVRKALTGKQGPHPKKGKKK |
| Ga0318509_105699741 | 3300031768 | Soil | HHRAAAERVAANLAEAEAQKGVRGTARRVRKALTGKQAPAKKGKK |
| Ga0318547_101597321 | 3300031781 | Soil | GVSEHHMAAAERVAANIAEAEAQKGVRGTARRVRKVLTGKQTSPKKGKK |
| Ga0318568_104253312 | 3300031819 | Soil | LWVEVAEHHVAAAERHAVNVAEAEANKGVRGTARRVRKALTGKQQAPRKGKKG |
| Ga0307473_100603265 | 3300031820 | Hardwood Forest Soil | ANVAEAEAQKGVRGTARRVRKALTGKQAPPKKGKK |
| Ga0307478_110153021 | 3300031823 | Hardwood Forest Soil | EHHVAAAERLASNLAEAEAQKGARGTIRRVRKALTGKRTPSKKGKK |
| Ga0306925_102929155 | 3300031890 | Soil | GVSEHHIAAAERVAANIAEEQAQKGVRGTARRVRKALTGKQAPAKKGRK |
| Ga0318520_104975422 | 3300031897 | Soil | ANIAEAEAQKGVRGTARRVRKVLTGKQTSPKKGKK |
| Ga0310916_104264291 | 3300031942 | Soil | EHHIAAAERVAANVAEVEAQKGVRGTARRVRKALTGKQTASKKGKK |
| Ga0310916_106521932 | 3300031942 | Soil | HHIAAAERVAANLAEAEAQKGVRGTARRVRKALTGKQTPPKKGKK |
| Ga0310916_114714661 | 3300031942 | Soil | HAANVAEAESNKGVRGTARRVRKALTGKQTAGKKGKK |
| Ga0310913_104704672 | 3300031945 | Soil | AAERVAANLAEAEAQKGVRGTARRVRKALTGKQTPPKKGKK |
| Ga0310913_108441502 | 3300031945 | Soil | AANVAEAEAQKGVRGTARRVRKVLTGKQPPPKKGKK |
| Ga0306926_107635663 | 3300031954 | Soil | AAERHAANVAEQKSNKGVRGTARRVRKALTGKQTSGKKGKK |
| Ga0307479_100222281 | 3300031962 | Hardwood Forest Soil | EAETEAQKGVRGTARRVRKALTGKQGGQPKKGKKK |
| Ga0307479_102830675 | 3300031962 | Hardwood Forest Soil | EHHVAAAERVASNLAEAEAQKGARGTIRRVRKALTGKRTPSKKGKK |
| Ga0318531_101343303 | 3300031981 | Soil | ATRSAANVAEAEAQKGVRGTARRVRKALTGKQAPPKKGKK |
| Ga0306922_106573743 | 3300032001 | Soil | ANLAEAEAQKGVRGTARRVRKALTGKQTPPKKGKK |
| Ga0318562_106995131 | 3300032008 | Soil | VAANVAEAEAQKGVRGTARRVRKALTGKQAPKKGKK |
| Ga0310911_103303122 | 3300032035 | Soil | HVAAAERVAANVAEAEAQKGVRGTARRVRKALTGKQAPKKGKK |
| Ga0318506_103678981 | 3300032052 | Soil | AANIAEAEAQKGVRGTARRVRKALTGKQAPKKGKK |
| Ga0318575_102746771 | 3300032055 | Soil | AHIWVCVSEHHIAAAERVAAIQAEAEAQKGVRGTARRVRKALTGKQAAGKKGKK |
| Ga0318514_105817871 | 3300032066 | Soil | SEHHIAAAERVAANLAEAEAQKGVRGTARRVRKALTGKQAPPKKGKK |
| Ga0318553_105381931 | 3300032068 | Soil | VCVSEHHIAAAERVAAIQAEVEAQKGVRGTARRVRKALTGKQAAGKKGKK |
| Ga0306924_114349752 | 3300032076 | Soil | AAAERHAANVAEAEAQKGARGTMRRVRKALTGKQQAPKKGKK |
| Ga0307471_10001310614 | 3300032180 | Hardwood Forest Soil | VSEHHVAAAERVAANVAEAEAQKGVRGTARRVRKALTGKQVPGKKGKK |
| Ga0307471_10004196310 | 3300032180 | Hardwood Forest Soil | AANIAEAESQKGVRGTARRVRKALTGKQPPAKKKGKK |
| Ga0307471_1000636261 | 3300032180 | Hardwood Forest Soil | AAAERHAANVAEAESQKGARGTMRRVRKALTGKQQAAKKGKK |
| Ga0307471_1021102562 | 3300032180 | Hardwood Forest Soil | HHTAAAERVAANLAEMEAQKGVRGTARRVRKALTGKQQAGKKGKK |
| Ga0307471_1021364712 | 3300032180 | Hardwood Forest Soil | AIEAEAEAQKGVRGTARRVRKALSGRQSGPKKGKK |
| Ga0307471_1025076222 | 3300032180 | Hardwood Forest Soil | AIEAEAEAQKGVRGTARRVRKALSGKQGTPKKGKK |
| Ga0307472_1014458742 | 3300032205 | Hardwood Forest Soil | SNLAEAEANKGVRGTARRVRKALTGKQQAAKKGKKG |
| Ga0348332_100358362 | 3300032515 | Plant Litter | AERHAANIAEAESQKGVRGTARRVRKALTGKQAPGKKGKK |
| Ga0310914_1004728910 | 3300033289 | Soil | EHHIAAAERVAANIAEAEAQKGVRGTARRVRKVLTGKQTSPKKGKK |
| Ga0310914_106597532 | 3300033289 | Soil | HIAAAERVAANLAEAEAQKGVRGTARRVRKALTGKQTPPKKGKK |
| Ga0373958_0136324_13_147 | 3300034819 | Rhizosphere Soil | VAAAERHASIVAEAEANKGVRGTARRVRKALTGKSRAPKKGKKA |
| ⦗Top⦘ |