| Basic Information | |
|---|---|
| Family ID | F014455 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 263 |
| Average Sequence Length | 48 residues |
| Representative Sequence | MMHFLKKLLMFRIGQKASRGFARSIGLNSLASIVGVVGGVKYMRRHS |
| Number of Associated Samples | 181 |
| Number of Associated Scaffolds | 263 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 82.95 % |
| % of genes near scaffold ends (potentially truncated) | 16.35 % |
| % of genes from short scaffolds (< 2000 bps) | 77.95 % |
| Associated GOLD sequencing projects | 155 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.61 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (84.411 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (20.913 % of family members) |
| Environment Ontology (ENVO) | Unclassified (30.798 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (50.951 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 57.33% β-sheet: 0.00% Coil/Unstructured: 42.67% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.61 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 263 Family Scaffolds |
|---|---|---|
| PF07479 | NAD_Gly3P_dh_C | 38.02 |
| PF05157 | T2SSE_N | 17.49 |
| PF09335 | SNARE_assoc | 4.94 |
| PF02660 | G3P_acyltransf | 2.28 |
| PF02896 | PEP-utilizers_C | 2.28 |
| PF13641 | Glyco_tranf_2_3 | 1.90 |
| PF01053 | Cys_Met_Meta_PP | 1.14 |
| PF00472 | RF-1 | 0.76 |
| PF02518 | HATPase_c | 0.76 |
| PF13632 | Glyco_trans_2_3 | 0.38 |
| PF09594 | GT87 | 0.38 |
| PF02687 | FtsX | 0.38 |
| PF13451 | zf-trcl | 0.38 |
| PF00291 | PALP | 0.38 |
| PF13240 | zinc_ribbon_2 | 0.38 |
| PF00483 | NTP_transferase | 0.38 |
| PF16949 | ABC_tran_2 | 0.38 |
| PF01464 | SLT | 0.38 |
| PF08334 | T2SSG | 0.38 |
| PF01255 | Prenyltransf | 0.38 |
| PF06971 | Put_DNA-bind_N | 0.38 |
| PF00754 | F5_F8_type_C | 0.38 |
| PF09137 | Glucodextran_N | 0.38 |
| PF07075 | DUF1343 | 0.38 |
| PF02652 | Lactate_perm | 0.38 |
| PF00440 | TetR_N | 0.38 |
| PF01475 | FUR | 0.38 |
| PF13432 | TPR_16 | 0.38 |
| PF00072 | Response_reg | 0.38 |
| COG ID | Name | Functional Category | % Frequency in 263 Family Scaffolds |
|---|---|---|---|
| COG0240 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 38.02 |
| COG0398 | Uncharacterized membrane protein YdjX, related to fungal oxalate transporter, TVP38/TMEM64 family | Function unknown [S] | 4.94 |
| COG1238 | Uncharacterized membrane protein YqaA, VTT domain | Function unknown [S] | 4.94 |
| COG0586 | Membrane integrity protein DedA, putative transporter, DedA/Tvp38 family | Cell wall/membrane/envelope biogenesis [M] | 4.94 |
| COG0344 | Phospholipid biosynthesis protein PlsY, probable glycerol-3-phosphate acyltransferase | Lipid transport and metabolism [I] | 2.28 |
| COG0626 | Cystathionine beta-lyase/cystathionine gamma-synthase | Amino acid transport and metabolism [E] | 1.14 |
| COG4100 | Cystathionine beta-lyase family protein involved in aluminum resistance | Inorganic ion transport and metabolism [P] | 1.14 |
| COG2873 | O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependent | Amino acid transport and metabolism [E] | 1.14 |
| COG2008 | Threonine aldolase | Amino acid transport and metabolism [E] | 1.14 |
| COG1982 | Arginine/lysine/ornithine decarboxylase | Amino acid transport and metabolism [E] | 1.14 |
| COG1921 | Seryl-tRNA(Sec) selenium transferase | Translation, ribosomal structure and biogenesis [J] | 1.14 |
| COG0520 | Selenocysteine lyase/Cysteine desulfurase | Amino acid transport and metabolism [E] | 1.14 |
| COG0436 | Aspartate/methionine/tyrosine aminotransferase | Amino acid transport and metabolism [E] | 1.14 |
| COG0399 | dTDP-4-amino-4,6-dideoxygalactose transaminase | Cell wall/membrane/envelope biogenesis [M] | 1.14 |
| COG0156 | 7-keto-8-aminopelargonate synthetase or related enzyme | Coenzyme transport and metabolism [H] | 1.14 |
| COG0075 | Archaeal aspartate aminotransferase or a related aminotransferase, includes purine catabolism protein PucG | Amino acid transport and metabolism [E] | 1.14 |
| COG1186 | Protein chain release factor PrfB | Translation, ribosomal structure and biogenesis [J] | 0.76 |
| COG0216 | Protein chain release factor RF1 | Translation, ribosomal structure and biogenesis [J] | 0.76 |
| COG0020 | Undecaprenyl pyrophosphate synthase | Lipid transport and metabolism [I] | 0.38 |
| COG0735 | Fe2+ or Zn2+ uptake regulation protein Fur/Zur | Inorganic ion transport and metabolism [P] | 0.38 |
| COG1620 | L-lactate permease | Energy production and conversion [C] | 0.38 |
| COG3387 | Glucoamylase (glucan-1,4-alpha-glucosidase), GH15 family | Carbohydrate transport and metabolism [G] | 0.38 |
| COG3876 | Exo-beta-N-acetylmuramidase YbbC/NamZ, DUF1343 family | Cell wall/membrane/envelope biogenesis [M] | 0.38 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 84.41 % |
| Unclassified | root | N/A | 15.59 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000650|AP72_2010_repI_A1DRAFT_1019911 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 576 | Open in IMG/M |
| 3300002568|C688J35102_118392197 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 555 | Open in IMG/M |
| 3300002568|C688J35102_119473777 | Not Available | 702 | Open in IMG/M |
| 3300002568|C688J35102_120490704 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1113 | Open in IMG/M |
| 3300002568|C688J35102_120721361 | All Organisms → cellular organisms → Bacteria | 1418 | Open in IMG/M |
| 3300002568|C688J35102_120757376 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1499 | Open in IMG/M |
| 3300002568|C688J35102_120924654 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2405 | Open in IMG/M |
| 3300004463|Ga0063356_100676042 | All Organisms → cellular organisms → Bacteria | 1414 | Open in IMG/M |
| 3300004479|Ga0062595_100143856 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1372 | Open in IMG/M |
| 3300004479|Ga0062595_100429690 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 960 | Open in IMG/M |
| 3300005166|Ga0066674_10120590 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1227 | Open in IMG/M |
| 3300005171|Ga0066677_10293590 | All Organisms → cellular organisms → Bacteria | 928 | Open in IMG/M |
| 3300005171|Ga0066677_10495445 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 702 | Open in IMG/M |
| 3300005172|Ga0066683_10772922 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
| 3300005172|Ga0066683_10809726 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
| 3300005174|Ga0066680_10149976 | All Organisms → cellular organisms → Bacteria | 1458 | Open in IMG/M |
| 3300005174|Ga0066680_10610880 | Not Available | 681 | Open in IMG/M |
| 3300005176|Ga0066679_10919588 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 550 | Open in IMG/M |
| 3300005177|Ga0066690_10147674 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1543 | Open in IMG/M |
| 3300005178|Ga0066688_10304198 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1029 | Open in IMG/M |
| 3300005178|Ga0066688_10730120 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 626 | Open in IMG/M |
| 3300005179|Ga0066684_10108482 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1712 | Open in IMG/M |
| 3300005181|Ga0066678_10598359 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 733 | Open in IMG/M |
| 3300005184|Ga0066671_10399446 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 879 | Open in IMG/M |
| 3300005187|Ga0066675_10463098 | All Organisms → cellular organisms → Bacteria | 944 | Open in IMG/M |
| 3300005329|Ga0070683_100000042 | All Organisms → cellular organisms → Bacteria | 115507 | Open in IMG/M |
| 3300005329|Ga0070683_101582176 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 37-71-11 | 630 | Open in IMG/M |
| 3300005330|Ga0070690_100577837 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 850 | Open in IMG/M |
| 3300005331|Ga0070670_100249535 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1546 | Open in IMG/M |
| 3300005331|Ga0070670_100575300 | All Organisms → cellular organisms → Bacteria | 1006 | Open in IMG/M |
| 3300005331|Ga0070670_100928954 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 789 | Open in IMG/M |
| 3300005331|Ga0070670_101149292 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 709 | Open in IMG/M |
| 3300005334|Ga0068869_100033480 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 3628 | Open in IMG/M |
| 3300005337|Ga0070682_100132926 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1686 | Open in IMG/M |
| 3300005338|Ga0068868_100006313 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 8378 | Open in IMG/M |
| 3300005340|Ga0070689_100153845 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1856 | Open in IMG/M |
| 3300005345|Ga0070692_10228034 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1104 | Open in IMG/M |
| 3300005356|Ga0070674_100139262 | Not Available | 1819 | Open in IMG/M |
| 3300005366|Ga0070659_101660401 | Not Available | 571 | Open in IMG/M |
| 3300005434|Ga0070709_10897644 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 701 | Open in IMG/M |
| 3300005434|Ga0070709_11016740 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 660 | Open in IMG/M |
| 3300005436|Ga0070713_100016927 | All Organisms → cellular organisms → Bacteria | 5495 | Open in IMG/M |
| 3300005439|Ga0070711_100196371 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1554 | Open in IMG/M |
| 3300005445|Ga0070708_100035648 | All Organisms → cellular organisms → Bacteria | 4335 | Open in IMG/M |
| 3300005446|Ga0066686_10002549 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 7984 | Open in IMG/M |
| 3300005446|Ga0066686_10174435 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1432 | Open in IMG/M |
| 3300005447|Ga0066689_10271508 | Not Available | 1047 | Open in IMG/M |
| 3300005451|Ga0066681_10308164 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 969 | Open in IMG/M |
| 3300005454|Ga0066687_10862867 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 539 | Open in IMG/M |
| 3300005459|Ga0068867_100341831 | All Organisms → cellular organisms → Bacteria | 1246 | Open in IMG/M |
| 3300005459|Ga0068867_100462623 | All Organisms → cellular organisms → Bacteria | 1083 | Open in IMG/M |
| 3300005467|Ga0070706_100591616 | Not Available | 1031 | Open in IMG/M |
| 3300005468|Ga0070707_100036848 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4668 | Open in IMG/M |
| 3300005468|Ga0070707_100397093 | All Organisms → cellular organisms → Bacteria | 1339 | Open in IMG/M |
| 3300005468|Ga0070707_101228504 | Not Available | 716 | Open in IMG/M |
| 3300005471|Ga0070698_100091326 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3028 | Open in IMG/M |
| 3300005518|Ga0070699_101090151 | All Organisms → cellular organisms → Bacteria | 732 | Open in IMG/M |
| 3300005529|Ga0070741_10000448 | All Organisms → cellular organisms → Bacteria | 151120 | Open in IMG/M |
| 3300005529|Ga0070741_10165998 | All Organisms → cellular organisms → Bacteria | 2195 | Open in IMG/M |
| 3300005534|Ga0070735_10042576 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3059 | Open in IMG/M |
| 3300005535|Ga0070684_100113914 | Not Available | 2427 | Open in IMG/M |
| 3300005535|Ga0070684_101354047 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 37-71-11 | 670 | Open in IMG/M |
| 3300005536|Ga0070697_100359574 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1258 | Open in IMG/M |
| 3300005536|Ga0070697_101156235 | All Organisms → cellular organisms → Bacteria | 689 | Open in IMG/M |
| 3300005537|Ga0070730_10225726 | All Organisms → cellular organisms → Bacteria | 1243 | Open in IMG/M |
| 3300005537|Ga0070730_10244492 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1186 | Open in IMG/M |
| 3300005539|Ga0068853_100701775 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 965 | Open in IMG/M |
| 3300005544|Ga0070686_100885404 | Not Available | 725 | Open in IMG/M |
| 3300005544|Ga0070686_101321081 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 603 | Open in IMG/M |
| 3300005546|Ga0070696_100164759 | All Organisms → cellular organisms → Bacteria | 1635 | Open in IMG/M |
| 3300005547|Ga0070693_100756322 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 717 | Open in IMG/M |
| 3300005552|Ga0066701_10138892 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1455 | Open in IMG/M |
| 3300005552|Ga0066701_10930285 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 515 | Open in IMG/M |
| 3300005554|Ga0066661_10106751 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1681 | Open in IMG/M |
| 3300005555|Ga0066692_10718559 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 618 | Open in IMG/M |
| 3300005557|Ga0066704_10100794 | All Organisms → cellular organisms → Bacteria | 1895 | Open in IMG/M |
| 3300005560|Ga0066670_10875726 | Not Available | 546 | Open in IMG/M |
| 3300005575|Ga0066702_10007197 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4711 | Open in IMG/M |
| 3300005575|Ga0066702_10103773 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1629 | Open in IMG/M |
| 3300005575|Ga0066702_10908886 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 525 | Open in IMG/M |
| 3300005576|Ga0066708_10177022 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1327 | Open in IMG/M |
| 3300005576|Ga0066708_10684846 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 650 | Open in IMG/M |
| 3300005576|Ga0066708_10997013 | Not Available | 520 | Open in IMG/M |
| 3300005578|Ga0068854_100032827 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3614 | Open in IMG/M |
| 3300005587|Ga0066654_10189294 | All Organisms → cellular organisms → Bacteria | 1064 | Open in IMG/M |
| 3300005615|Ga0070702_100012421 | All Organisms → cellular organisms → Bacteria | 4267 | Open in IMG/M |
| 3300005615|Ga0070702_101259753 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 599 | Open in IMG/M |
| 3300005840|Ga0068870_10014572 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3715 | Open in IMG/M |
| 3300005891|Ga0075283_1014472 | Not Available | 1203 | Open in IMG/M |
| 3300005937|Ga0081455_10235441 | All Organisms → cellular organisms → Bacteria | 1349 | Open in IMG/M |
| 3300006028|Ga0070717_10418576 | All Organisms → cellular organisms → Bacteria | 1205 | Open in IMG/M |
| 3300006028|Ga0070717_10978896 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 770 | Open in IMG/M |
| 3300006032|Ga0066696_10029146 | All Organisms → cellular organisms → Bacteria | 2931 | Open in IMG/M |
| 3300006163|Ga0070715_10296733 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 863 | Open in IMG/M |
| 3300006173|Ga0070716_100194882 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1342 | Open in IMG/M |
| 3300006173|Ga0070716_101591262 | Not Available | 536 | Open in IMG/M |
| 3300006175|Ga0070712_102004599 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 507 | Open in IMG/M |
| 3300006755|Ga0079222_11647138 | All Organisms → cellular organisms → Bacteria | 611 | Open in IMG/M |
| 3300006791|Ga0066653_10384716 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 716 | Open in IMG/M |
| 3300006794|Ga0066658_10049621 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1798 | Open in IMG/M |
| 3300006794|Ga0066658_10092917 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1408 | Open in IMG/M |
| 3300006794|Ga0066658_10517767 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 649 | Open in IMG/M |
| 3300006796|Ga0066665_10794623 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 747 | Open in IMG/M |
| 3300006796|Ga0066665_11243636 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 569 | Open in IMG/M |
| 3300006854|Ga0075425_100000002 | All Organisms → cellular organisms → Bacteria | 362431 | Open in IMG/M |
| 3300006854|Ga0075425_100011469 | All Organisms → cellular organisms → Bacteria | 9479 | Open in IMG/M |
| 3300006854|Ga0075425_100755764 | All Organisms → cellular organisms → Bacteria | 1115 | Open in IMG/M |
| 3300006854|Ga0075425_101575098 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 741 | Open in IMG/M |
| 3300006871|Ga0075434_101041305 | Not Available | 832 | Open in IMG/M |
| 3300006903|Ga0075426_10204211 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1433 | Open in IMG/M |
| 3300006904|Ga0075424_102601157 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
| 3300006914|Ga0075436_100639519 | Not Available | 785 | Open in IMG/M |
| 3300006914|Ga0075436_100826711 | Not Available | 691 | Open in IMG/M |
| 3300009012|Ga0066710_100065406 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4626 | Open in IMG/M |
| 3300009038|Ga0099829_11253746 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 613 | Open in IMG/M |
| 3300009088|Ga0099830_10229874 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1461 | Open in IMG/M |
| 3300009089|Ga0099828_10947818 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 768 | Open in IMG/M |
| 3300009090|Ga0099827_10064992 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2796 | Open in IMG/M |
| 3300009090|Ga0099827_10391115 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1187 | Open in IMG/M |
| 3300009090|Ga0099827_11550259 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 577 | Open in IMG/M |
| 3300009093|Ga0105240_10031279 | All Organisms → cellular organisms → Bacteria | 6904 | Open in IMG/M |
| 3300009098|Ga0105245_10000598 | All Organisms → cellular organisms → Bacteria | 32661 | Open in IMG/M |
| 3300009098|Ga0105245_10156010 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2162 | Open in IMG/M |
| 3300009098|Ga0105245_11313302 | Not Available | 772 | Open in IMG/M |
| 3300009137|Ga0066709_100928418 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1270 | Open in IMG/M |
| 3300009137|Ga0066709_101729650 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 884 | Open in IMG/M |
| 3300009147|Ga0114129_10098148 | All Organisms → cellular organisms → Bacteria | 4054 | Open in IMG/M |
| 3300009176|Ga0105242_13308431 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 501 | Open in IMG/M |
| 3300009177|Ga0105248_12392642 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 602 | Open in IMG/M |
| 3300009177|Ga0105248_12706953 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 566 | Open in IMG/M |
| 3300010373|Ga0134128_10045369 | All Organisms → cellular organisms → Bacteria | 5110 | Open in IMG/M |
| 3300010400|Ga0134122_11551597 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 684 | Open in IMG/M |
| 3300010401|Ga0134121_12203929 | Not Available | 588 | Open in IMG/M |
| 3300010403|Ga0134123_12779055 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 558 | Open in IMG/M |
| 3300011119|Ga0105246_10780271 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 846 | Open in IMG/M |
| 3300011269|Ga0137392_10409860 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1125 | Open in IMG/M |
| 3300012189|Ga0137388_11976170 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 512 | Open in IMG/M |
| 3300012198|Ga0137364_10143560 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1720 | Open in IMG/M |
| 3300012198|Ga0137364_10370200 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1070 | Open in IMG/M |
| 3300012199|Ga0137383_11124928 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 567 | Open in IMG/M |
| 3300012201|Ga0137365_10689301 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 747 | Open in IMG/M |
| 3300012204|Ga0137374_10243516 | All Organisms → cellular organisms → Bacteria | 1513 | Open in IMG/M |
| 3300012204|Ga0137374_10790266 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 705 | Open in IMG/M |
| 3300012206|Ga0137380_10688974 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 888 | Open in IMG/M |
| 3300012208|Ga0137376_10373019 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1239 | Open in IMG/M |
| 3300012208|Ga0137376_11210526 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 645 | Open in IMG/M |
| 3300012208|Ga0137376_11284510 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 622 | Open in IMG/M |
| 3300012208|Ga0137376_11328685 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 609 | Open in IMG/M |
| 3300012208|Ga0137376_11800535 | Not Available | 503 | Open in IMG/M |
| 3300012211|Ga0137377_10636563 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1002 | Open in IMG/M |
| 3300012211|Ga0137377_11237176 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 676 | Open in IMG/M |
| 3300012212|Ga0150985_116364216 | Not Available | 711 | Open in IMG/M |
| 3300012212|Ga0150985_121346904 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 501 | Open in IMG/M |
| 3300012285|Ga0137370_10598785 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 681 | Open in IMG/M |
| 3300012350|Ga0137372_10252583 | All Organisms → cellular organisms → Bacteria | 1386 | Open in IMG/M |
| 3300012354|Ga0137366_10619949 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 775 | Open in IMG/M |
| 3300012355|Ga0137369_10741663 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 673 | Open in IMG/M |
| 3300012360|Ga0137375_10004766 | All Organisms → cellular organisms → Bacteria | 16156 | Open in IMG/M |
| 3300012362|Ga0137361_10837142 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 836 | Open in IMG/M |
| 3300012363|Ga0137390_10585997 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1084 | Open in IMG/M |
| 3300012532|Ga0137373_10855850 | Not Available | 669 | Open in IMG/M |
| 3300012917|Ga0137395_10889311 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 644 | Open in IMG/M |
| 3300012958|Ga0164299_11195340 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 575 | Open in IMG/M |
| 3300012960|Ga0164301_11828213 | Not Available | 511 | Open in IMG/M |
| 3300012960|Ga0164301_11863431 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 507 | Open in IMG/M |
| 3300012975|Ga0134110_10104604 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1146 | Open in IMG/M |
| 3300013296|Ga0157374_12089171 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 593 | Open in IMG/M |
| 3300013297|Ga0157378_10006004 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 10640 | Open in IMG/M |
| 3300013297|Ga0157378_12378469 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 582 | Open in IMG/M |
| 3300013308|Ga0157375_10000077 | All Organisms → cellular organisms → Bacteria | 100528 | Open in IMG/M |
| 3300014157|Ga0134078_10568923 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 538 | Open in IMG/M |
| 3300014487|Ga0182000_10593854 | Not Available | 533 | Open in IMG/M |
| 3300014745|Ga0157377_10000348 | All Organisms → cellular organisms → Bacteria | 20596 | Open in IMG/M |
| 3300015083|Ga0167624_1000075 | All Organisms → cellular organisms → Bacteria | 12144 | Open in IMG/M |
| 3300015158|Ga0167622_1000659 | All Organisms → cellular organisms → Bacteria | 15543 | Open in IMG/M |
| 3300015162|Ga0167653_1000694 | All Organisms → cellular organisms → Bacteria | 8309 | Open in IMG/M |
| 3300015164|Ga0167652_1037846 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 936 | Open in IMG/M |
| 3300015171|Ga0167648_1036831 | All Organisms → cellular organisms → Bacteria | 1158 | Open in IMG/M |
| 3300015359|Ga0134085_10399804 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 617 | Open in IMG/M |
| 3300015359|Ga0134085_10439149 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 590 | Open in IMG/M |
| 3300015371|Ga0132258_11982312 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1465 | Open in IMG/M |
| 3300015374|Ga0132255_105729664 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 526 | Open in IMG/M |
| 3300017927|Ga0187824_10332448 | Not Available | 544 | Open in IMG/M |
| 3300017994|Ga0187822_10144411 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 760 | Open in IMG/M |
| 3300018431|Ga0066655_10124629 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1486 | Open in IMG/M |
| 3300018431|Ga0066655_10481336 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 821 | Open in IMG/M |
| 3300018431|Ga0066655_10876578 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
| 3300018433|Ga0066667_11318153 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 631 | Open in IMG/M |
| 3300018468|Ga0066662_10034159 | All Organisms → cellular organisms → Bacteria | 3063 | Open in IMG/M |
| 3300018468|Ga0066662_10770168 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 929 | Open in IMG/M |
| 3300018468|Ga0066662_10780044 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 924 | Open in IMG/M |
| 3300018468|Ga0066662_11166579 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 776 | Open in IMG/M |
| 3300018468|Ga0066662_11179612 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 773 | Open in IMG/M |
| 3300018468|Ga0066662_11447899 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 713 | Open in IMG/M |
| 3300018468|Ga0066662_12047752 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 599 | Open in IMG/M |
| 3300018468|Ga0066662_12504364 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 544 | Open in IMG/M |
| 3300020005|Ga0193697_1000078 | All Organisms → cellular organisms → Bacteria | 37918 | Open in IMG/M |
| 3300021289|Ga0213903_111675 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 509 | Open in IMG/M |
| 3300021358|Ga0213873_10000414 | All Organisms → cellular organisms → Bacteria | 6945 | Open in IMG/M |
| 3300021384|Ga0213876_10114607 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1430 | Open in IMG/M |
| 3300023046|Ga0233356_1000018 | All Organisms → cellular organisms → Bacteria | 86107 | Open in IMG/M |
| 3300025321|Ga0207656_10060859 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1656 | Open in IMG/M |
| 3300025893|Ga0207682_10141264 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1081 | Open in IMG/M |
| 3300025908|Ga0207643_10089149 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1796 | Open in IMG/M |
| 3300025910|Ga0207684_10108958 | All Organisms → cellular organisms → Bacteria | 2370 | Open in IMG/M |
| 3300025910|Ga0207684_10769473 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 815 | Open in IMG/M |
| 3300025910|Ga0207684_11079318 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 669 | Open in IMG/M |
| 3300025910|Ga0207684_11294778 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 600 | Open in IMG/M |
| 3300025913|Ga0207695_10147772 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2292 | Open in IMG/M |
| 3300025922|Ga0207646_10008616 | All Organisms → cellular organisms → Bacteria | 10193 | Open in IMG/M |
| 3300025922|Ga0207646_10621403 | Not Available | 969 | Open in IMG/M |
| 3300025922|Ga0207646_10971990 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 751 | Open in IMG/M |
| 3300025924|Ga0207694_10000001 | All Organisms → cellular organisms → Bacteria | 4078485 | Open in IMG/M |
| 3300025925|Ga0207650_10000071 | All Organisms → cellular organisms → Bacteria | 137924 | Open in IMG/M |
| 3300025925|Ga0207650_10028314 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4016 | Open in IMG/M |
| 3300025925|Ga0207650_10611624 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 917 | Open in IMG/M |
| 3300025925|Ga0207650_10959997 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 727 | Open in IMG/M |
| 3300025926|Ga0207659_10679686 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 881 | Open in IMG/M |
| 3300025927|Ga0207687_10001350 | All Organisms → cellular organisms → Bacteria | 16794 | Open in IMG/M |
| 3300025927|Ga0207687_10007875 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 6983 | Open in IMG/M |
| 3300025928|Ga0207700_10003916 | All Organisms → cellular organisms → Bacteria | 8696 | Open in IMG/M |
| 3300025936|Ga0207670_10000810 | All Organisms → cellular organisms → Bacteria | 16319 | Open in IMG/M |
| 3300025936|Ga0207670_10340324 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1185 | Open in IMG/M |
| 3300025942|Ga0207689_10097913 | All Organisms → cellular organisms → Bacteria | 2409 | Open in IMG/M |
| 3300025944|Ga0207661_10000002 | All Organisms → cellular organisms → Bacteria | 816104 | Open in IMG/M |
| 3300025994|Ga0208142_1028225 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 617 | Open in IMG/M |
| 3300026089|Ga0207648_10362675 | All Organisms → cellular organisms → Bacteria | 1308 | Open in IMG/M |
| 3300026095|Ga0207676_12626795 | Not Available | 500 | Open in IMG/M |
| 3300026312|Ga0209153_1239153 | Not Available | 591 | Open in IMG/M |
| 3300026325|Ga0209152_10228391 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 695 | Open in IMG/M |
| 3300026325|Ga0209152_10450040 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 518 | Open in IMG/M |
| 3300026328|Ga0209802_1327973 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 506 | Open in IMG/M |
| 3300026332|Ga0209803_1143500 | Not Available | 931 | Open in IMG/M |
| 3300026335|Ga0209804_1065020 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1743 | Open in IMG/M |
| 3300026527|Ga0209059_1044202 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1976 | Open in IMG/M |
| 3300026536|Ga0209058_1140194 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1159 | Open in IMG/M |
| 3300026537|Ga0209157_1019089 | All Organisms → cellular organisms → Bacteria | 4279 | Open in IMG/M |
| 3300026538|Ga0209056_10316335 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1060 | Open in IMG/M |
| 3300026542|Ga0209805_1274137 | Not Available | 647 | Open in IMG/M |
| 3300026550|Ga0209474_10038222 | All Organisms → cellular organisms → Bacteria | 3532 | Open in IMG/M |
| 3300026550|Ga0209474_10695478 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 526 | Open in IMG/M |
| 3300026550|Ga0209474_10747705 | Not Available | 509 | Open in IMG/M |
| 3300026551|Ga0209648_10288306 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1185 | Open in IMG/M |
| 3300026552|Ga0209577_10461089 | Not Available | 877 | Open in IMG/M |
| 3300027775|Ga0209177_10236815 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 667 | Open in IMG/M |
| 3300027857|Ga0209166_10145158 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1297 | Open in IMG/M |
| 3300027857|Ga0209166_10375336 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 741 | Open in IMG/M |
| 3300027882|Ga0209590_10085137 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1855 | Open in IMG/M |
| 3300028047|Ga0209526_10894030 | Not Available | 541 | Open in IMG/M |
| 3300030510|Ga0268243_1173676 | Not Available | 529 | Open in IMG/M |
| 3300030991|Ga0073994_12005929 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 686 | Open in IMG/M |
| 3300030998|Ga0073996_11956200 | Not Available | 574 | Open in IMG/M |
| 3300031047|Ga0073995_10811157 | Not Available | 716 | Open in IMG/M |
| 3300031058|Ga0308189_10547260 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 504 | Open in IMG/M |
| 3300031082|Ga0308192_1083457 | Not Available | 524 | Open in IMG/M |
| 3300031996|Ga0308176_12178102 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 592 | Open in IMG/M |
| 3300032955|Ga0335076_10099764 | All Organisms → cellular organisms → Bacteria | 2833 | Open in IMG/M |
| 3300034268|Ga0372943_0521156 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 776 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 20.91% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 12.55% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 12.17% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 6.08% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 3.80% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.80% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 3.04% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 3.04% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.66% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.66% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.66% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 2.28% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 2.28% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 1.90% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.90% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.90% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.52% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.52% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.14% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.14% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.14% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.76% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.76% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.76% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.76% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.76% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.76% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.76% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.76% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.38% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.38% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.38% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.38% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.38% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.38% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.38% |
| Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 0.38% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.38% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.38% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000650 | Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A1 | Environmental | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
| 3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
| 3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
| 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
| 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
| 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
| 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
| 3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
| 3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
| 3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
| 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
| 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
| 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
| 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
| 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
| 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
| 3300005891 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_80N_304 | Environmental | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300014487 | Bulk soil microbial communities from Mexico - Magueyal (Ma) metaG | Environmental | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300015083 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G1C, Ice margin) | Environmental | Open in IMG/M |
| 3300015158 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G1A, Ice margin) | Environmental | Open in IMG/M |
| 3300015162 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-4c, rock/ice/stream interface) | Environmental | Open in IMG/M |
| 3300015164 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-4b, rock/ice/stream interface) | Environmental | Open in IMG/M |
| 3300015171 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-3a, vegetated patch on medial moraine) | Environmental | Open in IMG/M |
| 3300015359 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015 | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300017927 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_4 | Environmental | Open in IMG/M |
| 3300017994 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2 | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300020005 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3m2 | Environmental | Open in IMG/M |
| 3300021289 | Switchgrass-associated microbial communities from reclaimed mine lands soil in West Virginia, United States ? Hobet_Cave_3 | Environmental | Open in IMG/M |
| 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Host-Associated | Open in IMG/M |
| 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Host-Associated | Open in IMG/M |
| 3300023046 | Soil microbial communities from Shasta-Trinity National Forest, California, United States - GEON-SFM-MS | Environmental | Open in IMG/M |
| 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025994 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_80N_304 (SPAdes) | Environmental | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026312 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 (SPAdes) | Environmental | Open in IMG/M |
| 3300026315 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 (SPAdes) | Environmental | Open in IMG/M |
| 3300026325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes) | Environmental | Open in IMG/M |
| 3300026328 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes) | Environmental | Open in IMG/M |
| 3300026332 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes) | Environmental | Open in IMG/M |
| 3300026335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes) | Environmental | Open in IMG/M |
| 3300026527 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 (SPAdes) | Environmental | Open in IMG/M |
| 3300026536 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes) | Environmental | Open in IMG/M |
| 3300026537 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 (SPAdes) | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300026542 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes) | Environmental | Open in IMG/M |
| 3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300027775 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes) | Environmental | Open in IMG/M |
| 3300027857 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300030510 | Bulk soil microbial communities from Mexico - Magueyal (Ma) metaG (v2) | Environmental | Open in IMG/M |
| 3300030991 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-1A (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030998 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-3A (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031047 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-1B (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031058 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_184 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031082 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_193 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300034268 | Forest soil microbial communities from Eldorado National Forest, California, USA - SNFC_MG_FRD_1.2 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| AP72_2010_repI_A1DRAFT_10199112 | 3300000650 | Forest Soil | MMHFLKKLLMFRIGQKASRGFARSIGMNSLASIVGVVGGVKYMRRHS* |
| C688J35102_1183921971 | 3300002568 | Soil | MLHFLKKLLMFRIGQKASRGFARSIGFNSLAHIAGVVGGVKYMRRHS* |
| C688J35102_1194737771 | 3300002568 | Soil | MLHFLKKLLMFRIGQKASRGFARSLGMSSLASIVGVVGGVKYMRRHS* |
| C688J35102_1204907041 | 3300002568 | Soil | MLHFLKKLLMFRVGQKTTRGVARSIGLGKIATIVGLIGGYKHMRKHA* |
| C688J35102_1207213612 | 3300002568 | Soil | MLRFLKKLLMFRVGQKASRGFARSIGLSGVSAVVGLIGGVKYMRRHG* |
| C688J35102_1207573762 | 3300002568 | Soil | MLHFLKKLLMFRVGQKATRGVARSIGLGKIATIVGLIGGYKHMRKHA* |
| C688J35102_1209246543 | 3300002568 | Soil | MLHFLKKLLLFRVGQKASRGFAKSIGLHTISGAVGLWGGLKYMKRHS* |
| Ga0063356_1006760421 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MYRLLKRLLMFRVGQRTARGFARTIGLKRVSRLVGIIGGIKYMHKHA* |
| Ga0062595_1001438562 | 3300004479 | Soil | MLHFLKKLLLFRVGQRASRGFAKSIGLHAISGAVGIWGGLKYMRRHT* |
| Ga0062595_1004296902 | 3300004479 | Soil | MLHFLRKLLMFRVGQKASRGFAKSIGLHAISSAVGIVGGLKYMRRHS* |
| Ga0066674_101205902 | 3300005166 | Soil | MYHFLKKVLMFRVGQRTSRGFARKIGIHRPIANLIGIIGGVKYMRRHA* |
| Ga0066677_100034224 | 3300005171 | Soil | MWNVLRNLFLFRVGQKASRGVARTFGLGSLASIIGIAGGVRYMRRHSRTHQG* |
| Ga0066677_102935902 | 3300005171 | Soil | MMHFLKKLLMFRIGQKASRGFARSIGLNSLASIVGVVGGVKYMRRHS* |
| Ga0066677_104954452 | 3300005171 | Soil | MLRLLKKLLLFRIGQKTSRGFARTIGLDSLAAIVGVIGGIKYMRRHS* |
| Ga0066683_107729222 | 3300005172 | Soil | MLRFLKKVLMFRVGQKASRGFARTIGVRKPFSSVIGVIGGFKYMRRHA* |
| Ga0066683_108097262 | 3300005172 | Soil | MMHFLKKLLMFRIGEKASRGFARSIGLNSLASIVGVVGGVKYMRRHS* |
| Ga0066680_101499763 | 3300005174 | Soil | VALRLHFSRIMLRFLKKVLMFRIGQKASRGFARTIGVHKPFSSLIGVIGGFKYMRRHA* |
| Ga0066680_106108801 | 3300005174 | Soil | LMFRIGQKASRGFARTIGVRRPFSGIIGLIGGMKYMRRHA* |
| Ga0066679_109195882 | 3300005176 | Soil | MYRFLKKVLMFRIGQKTSRGFARKIGVRRPFANIIGLIGGVKYMRRHA* |
| Ga0066690_101476742 | 3300005177 | Soil | MKQEADMLHFLKKLLMFRVGQKTTRGVARTIGLGRIATIVGLIGGYKYMRRHA* |
| Ga0066688_103041981 | 3300005178 | Soil | MLRFLKKIALFRVGQKASRGFARTIGVRKPFSGIIGLIGGFKYMRRHA* |
| Ga0066688_107301202 | 3300005178 | Soil | MMHFLKKLLMFRIGQKASRGFARSIGLDSLAAIVGVVGGVKYMRRHS |
| Ga0066684_101084821 | 3300005179 | Soil | MLHFLKKLLMFRIGQKASRGFARSIGLNSLATIVGVVGGVKYM |
| Ga0066678_105983592 | 3300005181 | Soil | MLRFLKKVLMFRVGQKASRGFARSIGVRKPFSSLVGLIGGVKYMRRHA* |
| Ga0066671_100008079 | 3300005184 | Soil | MWNVLRNLFLFRVGQKASRGVARTFGLGSLASIIGIAGGVRYMRRHSRTHQV* |
| Ga0066671_103994462 | 3300005184 | Soil | MLRFLKKLLLFRVGQKTSRGFAKTIGLNSIAAVVGVIGGLKYMRHHS* |
| Ga0066675_104630982 | 3300005187 | Soil | MMHFLKKLLMFRIGQKASRGFARSIGLDSLAAIVGVVGGVKYMRRHS* |
| Ga0070683_10000004270 | 3300005329 | Corn Rhizosphere | MLHFLKKLLMFRVGQKTTRGVARSIGLGKIATVVGLIGGYKHMRKHA* |
| Ga0070683_1015821762 | 3300005329 | Corn Rhizosphere | FLRKLLMFRVGQKATRGFARSIGLGRIAGLVGLVGGYKQMRRHA* |
| Ga0070690_1005778372 | 3300005330 | Switchgrass Rhizosphere | MLRLLKKLLLFRIGQKTSRGFARTIGLDSLAAIVGIVGGIRYMRRHS* |
| Ga0070670_1002495352 | 3300005331 | Switchgrass Rhizosphere | MRHFLKKVLMFRIGQKAAKGFARSIGLRRAAAIIGVIGGVKHMRRHA* |
| Ga0070670_1005753002 | 3300005331 | Switchgrass Rhizosphere | MLHFLRKLLMFRVGQKTTRGFARSIGLGRIAGLVGLVGGYKHMRRHA* |
| Ga0070670_1009289542 | 3300005331 | Switchgrass Rhizosphere | MLHFLRKLLMFRVGQKATRGFARSIGLGRIAGLVGLVGGYKHMRRHA* |
| Ga0070670_1011492922 | 3300005331 | Switchgrass Rhizosphere | MLHFLKKLLLFRVGQKASRGFANSIGLHGIARAVGIWGGLKYMRKHS* |
| Ga0068869_1000334802 | 3300005334 | Miscanthus Rhizosphere | MRHFLKRVLMFRIGQKAAKGFARSIGLKRAAGVIGLVGGYKHMRRHV* |
| Ga0070682_1001329262 | 3300005337 | Corn Rhizosphere | MLHFLKKLLMFRVGQKATRGVARSIGLGKIATVVGLIGGYKHMRKHA* |
| Ga0068868_1000063137 | 3300005338 | Miscanthus Rhizosphere | MLHFLRKLLMFRVGQKASRGFAKSIGLHAISGAVGVLGGLKYMRRHS* |
| Ga0070689_1001538452 | 3300005340 | Switchgrass Rhizosphere | MRHFLKKLLMFRIGQKTAKGFARGIGLKRVAPLIGVVGGLKHMRRHA* |
| Ga0070692_102280342 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | MLHFLRKLLMFRVGQKATRGFARSIGLGRIAGLVGLIGGYKQMRRHA* |
| Ga0070674_1001392624 | 3300005356 | Miscanthus Rhizosphere | MLRFLKKLLLFRIGQKTTRGFARTIGLDGLAAIAGLIGGVKYMRRHS* |
| Ga0070659_1016604012 | 3300005366 | Corn Rhizosphere | MLSLLKKLLLFRVGQKTTRGVARTIGLHKLSRLIGIVGGVHYMRKHSQRSQPAARA* |
| Ga0070709_108976441 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MHFLKKLLMFRIGQKASRGFARSIGLNSLASIVGVVGGVKYMRRHS |
| Ga0070709_110167402 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MLHFLRKLLMFRVGQKASRGFAKSIGLHAISGAVGVVGGLKYMRRHS* |
| Ga0070713_1000169277 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MSHFLKKLLMFRIGQKASRGFARTIGLNSLATIVGVIGGVKYMRRHS* |
| Ga0070701_1000052111 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | MWNVLRNLFFFRVGQKTSRSMARTFGLRSLASIIGIVGGVRYMRRHSQQQTAR* |
| Ga0070711_1001963712 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MLRFLKKLLLFRIGQKTTKGFVRTIGLDSLAAIAGIIGGVKYMRRHS* |
| Ga0070708_1000356484 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MLHFLKKVLMFRVGQKASRGFARAIGVRRPISSIVGLIGGVKYMRRHA* |
| Ga0066686_100025492 | 3300005446 | Soil | MLRFLKKVLMFRIGQKASRGFARSIGVRKPFSGIVGLIGGFKYMRRHA* |
| Ga0066686_101744352 | 3300005446 | Soil | MLHFLKKVLMFRIGQKASRGFARSIGVRRPFSSAIGVIGGIKYMRRHA* |
| Ga0066689_102715082 | 3300005447 | Soil | MRHFLKKVLMFRIGQKAAKVFARGLGLKRAAPLIGVVGGFKHMRRHT* |
| Ga0066681_103081642 | 3300005451 | Soil | MLRLLKKLLLFRVGQKTSRRFSKMIGLDSIAAIVGIIGGLKYMRRHS* |
| Ga0066687_108628672 | 3300005454 | Soil | MRHFLKRVLMFRIGQKAAKGFAKSLGLKHTARLIGLVGGYKHMRRHA* |
| Ga0068867_1003418312 | 3300005459 | Miscanthus Rhizosphere | MLRFLKKLLLFRVGQKASRGFAKSIGLRTISHAVGIVGGLKYMRHHSS* |
| Ga0068867_1004626232 | 3300005459 | Miscanthus Rhizosphere | MLHFLRKLLMFRVGQKASRGFAKSIGLRGISNAVGIVGGLKYMRRHS* |
| Ga0070706_1005916162 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MLHFLKKLLMFRIGQKASRGFARGIGLDAVAGLVGLVGGVKYMRRHS* |
| Ga0070707_1000368484 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MLRFLKKVLMFRVGQKASRGFARAIGVRRPISSIVGLIGGVKYMRRHS* |
| Ga0070707_1003970932 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MLRFLKKILMFRIGQKASRGFARSIGFHKPITGIVGLIGGMKYMRRHS* |
| Ga0070707_1012285042 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MYRFLKKVLMFRIGQKASRGFARKIGVRRPFANVIGLIGGVKYMRRHA* |
| Ga0070698_1000913261 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MLRFLKKVLMFRVGQKASRGFARSIGVRKPFSSLVGVIGGVKYMRRHA* |
| Ga0070699_1010901512 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MLHFLKKVLMFRVGQKASRGFARAIGVRRPISSIVGLIGGVKYMRRHS* |
| Ga0070741_1000044814 | 3300005529 | Surface Soil | MLRFLKRLFMFRVGQKASRGFARSIGLHSIAGAVGLVGGLKYMRRHS* |
| Ga0070741_101659983 | 3300005529 | Surface Soil | MWRLLKKMLMFRLGQKASRGFARRVGINRLLANFIGVIGGMKSMRRHP* |
| Ga0070735_100425764 | 3300005534 | Surface Soil | MLRFLKRVLMFRVGQKSSRFFARKVGISRPFASMIGMVGGFKYMRRHS* |
| Ga0070684_1001139145 | 3300005535 | Corn Rhizosphere | MYKFLKKMLMFRVGQKASRGFAKQIGLRGMANVLGVVGGVKYMRRHS* |
| Ga0070684_1013540471 | 3300005535 | Corn Rhizosphere | MLHFLRKLLMFRVGQKATRGFARSIGLGRMAGLVGLVGGYKQMRRHA* |
| Ga0070697_1003595742 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MLHFLKKVLMFRVGQKASRGFARMIGVRKPISSIVGLIGGVKYMRRHA* |
| Ga0070697_1011562352 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MLRFLKKILMFRIGQKTSRRFARTIGVRSPLANIIGVIGGFKYMRRHA* |
| Ga0070730_102257262 | 3300005537 | Surface Soil | MLRFLKRVLMFRVGQKSSRFFARKVGISWPFASMIGMIGGFKYMRRHS* |
| Ga0070730_102444922 | 3300005537 | Surface Soil | MYRLLKRLLMFRVGQKTSRGFAKSIGLRRISPIVGIIGGIKYMRKHA* |
| Ga0068853_1007017752 | 3300005539 | Corn Rhizosphere | MIRLLKKLLLFRIGQKTSRGFARTIGLDSLAAIVGILGGIKYMRRHS* |
| Ga0070686_1008854041 | 3300005544 | Switchgrass Rhizosphere | MLSLLKKLFLFRVGQKTSRGFARTIGLDSIARIVGVIGGVRYMRRHSH* |
| Ga0070686_1013210812 | 3300005544 | Switchgrass Rhizosphere | MLHFLKKLLLFRVGQKASRGFARSIGLHGFARVAGVIGGVKYMRRHS* |
| Ga0070696_1001647593 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | MSHFLKKLLMFRIGQKASRGFARSIGLDALAGIVGLVGGVKYMRRHS* |
| Ga0070693_1007563221 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | MSHFLKKLLMFRIGQKASRGFARSIGLDALAGVVGLIGGVKYMRRHS* |
| Ga0066701_101388922 | 3300005552 | Soil | MLHFLKKVLMFRIGQKASRGFARSIGVRRPFSSAIGLIGGIKYMRRHA* |
| Ga0066701_109302852 | 3300005552 | Soil | MLRFLKKVLMFRIGQKASRGFARSIGVRRPFSSMIGVIGGMKYMRRHS* |
| Ga0066661_101067513 | 3300005554 | Soil | MLHFLKKLVLFRVGQKTTRGVARTIGLGKIATIVGLIGGYKYMRRHA* |
| Ga0066692_107185591 | 3300005555 | Soil | MLRFLKKILMFRIGQKASRGFARSIGVRRPFSSMIGVIGGMKYMRRHS* |
| Ga0066704_101007942 | 3300005557 | Soil | MLRFLKKVLMFRIGQKASRGFARTIGVHKPFSSLIGVIGGFKYMRRHA* |
| Ga0066670_108757262 | 3300005560 | Soil | MRHFLKKVLMFRIGQKAAKGFAKSLGLKHAATLIGVVGGYKHMRRHA* |
| Ga0066702_100071976 | 3300005575 | Soil | MLHFLKQLLMFRVGQKATRGFARTIGLGRIATLVGLIGGYKHMRRHA* |
| Ga0066702_101037733 | 3300005575 | Soil | MLSLLKKLLLFRIGQKTTKAFSHRIGLHSIAWMAGLVGG |
| Ga0066702_109088862 | 3300005575 | Soil | MMHFLKKLLMFRIGQKASRGFARSIGLNSLASIVGVVGGVKYM |
| Ga0066708_101770221 | 3300005576 | Soil | MMHFLKKLLMFRIGQKASRGFARSIGLSSLASIVGVVGGVKYMRRHS* |
| Ga0066708_106848462 | 3300005576 | Soil | LMFRIGQKASRGFARSIGVRRPFSSAIGVIGGIKYMRRHA* |
| Ga0066708_109970131 | 3300005576 | Soil | MRHFLKKVLMFRIGQKTAKGFARGLGLKRAAPLIGVVGGFKHMRRHT* |
| Ga0068854_1000328272 | 3300005578 | Corn Rhizosphere | MLHFLKKLLMFRVGQKTTRGVARSIGFGKIATIAGLIGGYKYMRRHA* |
| Ga0066654_101892941 | 3300005587 | Soil | HFLKKLLMFRIGQKASRGFARSIGFNSLAHIAGVVGGVKYMRRHS* |
| Ga0070702_1000124214 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | MIRLLKKLLLFRIGQKTSRGFARTIGLDSLAAIVGILGGIKYMRHHS* |
| Ga0070702_1012597532 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | MLHFLKKLMMFRIGQKASRGFARSIGFNSVASIVGVVGGVKYMRRHS* |
| Ga0068870_100145725 | 3300005840 | Miscanthus Rhizosphere | MQMIHFLKKLLLFRVGQKAARGFARSIGLHGISRAVGVIGGVKYMRRHS* |
| Ga0075283_10144722 | 3300005891 | Rice Paddy Soil | MYRLLKRLLMFRVGQKTARGFARGIGMRGVAPIIGIIGGFRHMRRHA* |
| Ga0081455_102354413 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MRHFLKKVLMFRIGQKAAKGFARSIGLKRAAAVIGLIGGVKHMRRHA* |
| Ga0070717_104185763 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MLSLLKKLLLFRVGQKTSKGFSHRIGLHSIAWMVGLVGGYRYMRRHS* |
| Ga0070717_109788962 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MLHFLKKLLLFRIGQKAARGFAHSIGLGKIAQVAGLVGGYKHMKRHA* |
| Ga0066696_100291463 | 3300006032 | Soil | MLHFLKQLLMFRVGQKATRGFARTIGLGRIATIVGLIGGYKHMRKHA* |
| Ga0070715_102967332 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | MMHFLKKLLMFRVGQKTTRGVARSIGFGKIATIAGLIGGYKYMRRHA* |
| Ga0070716_1001948822 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MQQEALMLRLLKKLLLFRIGQRTSRRFTRMIGLDSLAAIIGVIGGIKYMRRHS* |
| Ga0070716_1015912622 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MLRFLKKLLLFRIGQKTTRGFARTIGLDGLAAIAGIIGGVKYMRRHS* |
| Ga0070712_1020045991 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MLEADMYRFLRKVLMFRIGQRTSRGFARKIGVWRPFANLIGIIGGVKYMRRHA* |
| Ga0079222_116471382 | 3300006755 | Agricultural Soil | MRHFLKRVLMFRIGQKAAKGFAKSLGLKRSAPLIGVVGGFKHMRRHA* |
| Ga0066653_103847162 | 3300006791 | Soil | MRHFLKKVLMFRIGQKAAKGFARGLGLKRAAPLIGVVSGFKHMRRHA* |
| Ga0066658_100496212 | 3300006794 | Soil | MRYFLKKVLMFRIGQKAAKGFAKSIGMKKTSSLIGVIGGYKHMRRHA* |
| Ga0066658_100929172 | 3300006794 | Soil | MLRLLKKLLLFRIGQKTSRGFARTIGLDSLAALVGIVGGIKYMRRHS* |
| Ga0066658_105177672 | 3300006794 | Soil | MRHFLKKVLMFRIGQKAAKGFAKSLGLKHTARLIGVVGGFKHMRRHA* |
| Ga0066665_107946232 | 3300006796 | Soil | MRHFLKQVLMFRIGQKAAKVFARGLGLKRAAPLIGVVGGFKHMRRHT* |
| Ga0066665_112436362 | 3300006796 | Soil | MRHFLKKLLMFRIGQKASKGFARSIGLKRAAGVIGLIGGYKHMRRHA* |
| Ga0075425_100000002151 | 3300006854 | Populus Rhizosphere | MMHFLKKLLMFRIGQKASRGFAKTIGLDALAGIVGLVGGVKYMRRHS* |
| Ga0075425_1000114696 | 3300006854 | Populus Rhizosphere | MLRLLKKLLLFRIGQKTSRRFVRMIGLDSVAAIVGVIGGIKYMRRHS* |
| Ga0075425_1007557641 | 3300006854 | Populus Rhizosphere | MLHFLKKVLMFRVGQKASSGFARAIGVRRPISSIVGLIGGVKYMRRHA* |
| Ga0075425_1015750982 | 3300006854 | Populus Rhizosphere | MLHFLRKLLLFRVGQKASRGFAKSIGLHAISSAVGIVGGLKYMRRHS* |
| Ga0075434_1010413051 | 3300006871 | Populus Rhizosphere | AGGNSMLRFLKKLLLFRIGQKTSRGFARTIGLDGFAAIAGIIGGVKYMRRHS* |
| Ga0075426_102042114 | 3300006903 | Populus Rhizosphere | LRKVLMFRIGQRTSRGFARKIGVRRPFANIIGIIGGVKYMRRHA* |
| Ga0075424_1026011572 | 3300006904 | Populus Rhizosphere | MLRFLKKLLLFRIGQKTSRGFARTIGLDGFAAIAGIIGGVKYMRRHS* |
| Ga0075436_1006395192 | 3300006914 | Populus Rhizosphere | SALQFLELEGDMYRLLRKVLMFRIGQRTSRGFARKIGVRRPFANIIGIIGGVKYMRRHA* |
| Ga0075436_1008267112 | 3300006914 | Populus Rhizosphere | FIEREAMMLRLLKKLLLFRIGQKTSRRFVRMIGLDSVAAIVGIIGGIKYMRRHS* |
| Ga0066710_1000654065 | 3300009012 | Grasslands Soil | MLRFLKKVLMFRIGQKASRGFARSIGVRRPFSSVIGLIGGMKYMRSHT |
| Ga0099829_112537461 | 3300009038 | Vadose Zone Soil | MLRFLKKVLMFRVGQKASRGFARAIGVRRPISSVVGLIGGVKYMRRHA* |
| Ga0099830_102298742 | 3300009088 | Vadose Zone Soil | MLRFLKRLLMFRVGQKTTRGFARSIGLGRFAFFAGLIGGYKMMKRHA* |
| Ga0099828_109478183 | 3300009089 | Vadose Zone Soil | MLRFLKKVLMFRLGQKASRGFARAIGVRRPISSIVGLIGGVKYMRRHA* |
| Ga0099827_100649924 | 3300009090 | Vadose Zone Soil | LLAVFSGKEADMLRFLKKVLMFRIGQKASRGFAWSIGVRQPFSGIIGLIGGVKYMRRHA* |
| Ga0099827_103911151 | 3300009090 | Vadose Zone Soil | MLRFLKKVLMFRVGQKASRGFARAIGVRRPISSIVGLIGGVKYMRRHA* |
| Ga0099827_115502592 | 3300009090 | Vadose Zone Soil | LKAGDANMYRFLKKVLMFRIGQKASRGFARKIGVRRPFANVIGLIGGVKYMRRHA* |
| Ga0105240_100312797 | 3300009093 | Corn Rhizosphere | MLSLLKKLLLFRIGQKTTKAFSHRIGLHSIAWMAGLIGGVRYMRRHS* |
| Ga0105245_1000059829 | 3300009098 | Miscanthus Rhizosphere | MQMLHFLRKLLMFRVGQKASRGFAKSIGLHAISSAVGVVGGLKYMRRHS* |
| Ga0105245_101560102 | 3300009098 | Miscanthus Rhizosphere | MLRLLKKLLLFRIGQKTSRGFARTIGLDSLAAIVGIIGGVKYMRRHS* |
| Ga0105245_113133022 | 3300009098 | Miscanthus Rhizosphere | KLLLFRIGQKTTRGFARTIGLDGLAAIAGLIGGVKYMRRHS* |
| Ga0066709_1009284182 | 3300009137 | Grasslands Soil | MLRFLKKILLFRLGQKASRGFARSIGFRMPITGIVGVIGGMKYMRRHS* |
| Ga0066709_1017296502 | 3300009137 | Grasslands Soil | MLRFLKKVLMFRIGQKASRGFARTIGVRRPFSGIIGLIGGMKYMRRHA* |
| Ga0114129_100981482 | 3300009147 | Populus Rhizosphere | MLRFLKKVLMFRVGQKASRGFARSIGVRKPFFSLVGVIGGVKYMRRHA* |
| Ga0105242_133084312 | 3300009176 | Miscanthus Rhizosphere | LRFLKKLLLFRVGQKASRGFAKSIGLRTISHFVGIVGGLKYMRHHSS* |
| Ga0105248_123926421 | 3300009177 | Switchgrass Rhizosphere | MLHFLKKLMMFRIGQKASRGFARSIGLNSVASIVGVVGGVKYMRRHS* |
| Ga0105248_127069532 | 3300009177 | Switchgrass Rhizosphere | MQMLHFLRKLLMFRVGQKASRGFAKSIGLHAISGAVGVLGGLKYMRRHS* |
| Ga0134128_100453694 | 3300010373 | Terrestrial Soil | MAHFLKKLLMFRIGQKASRGFARSIGLDALSGIVGLVGGVKYMRRHS* |
| Ga0134122_115515972 | 3300010400 | Terrestrial Soil | MLRLLKKLLLFRVGQKTSRGFARTIGLDSLAAIVGIIGGVKYMRRHS* |
| Ga0134121_122039292 | 3300010401 | Terrestrial Soil | MVPGGIDMLRFLKKLLLFRIGQKTTRGFARTIGLDGLAAIAGLIGGVKYMRRHS* |
| Ga0134123_127790552 | 3300010403 | Terrestrial Soil | MLHFLKKLMMFRIGQKASRGFARSIGLNSVASIVGVVGGVKYMRRDS* |
| Ga0105246_107802712 | 3300011119 | Miscanthus Rhizosphere | MQEADMLHFLKKLLMFRVGQKTTRGVARSIGFGKIATIAGLIGGYKYMRRHA* |
| Ga0137392_104098602 | 3300011269 | Vadose Zone Soil | MLRFLKKVLMFRIGQKASRGFAWSIGVRQPFSGIIGLIGGVKYMRRHA* |
| Ga0137388_119761702 | 3300012189 | Vadose Zone Soil | MLRFLKKLLLFRIGQKTTKAFVRTIGLDSLAAVAGIIGGVKYMRRHS* |
| Ga0137364_101435602 | 3300012198 | Vadose Zone Soil | MYRLLKKVLMFRIGQKTSRGFARKIGVRRPFANLIGIIGGVKYMRRHA* |
| Ga0137364_103702002 | 3300012198 | Vadose Zone Soil | MMHFLKKLLMFRIGQKASRGFARSIGLDSLAAIVGVVGGLKYMRRHS* |
| Ga0137383_111249282 | 3300012199 | Vadose Zone Soil | MLRFLKKVLMFRVGQKASRGFARSIGVRKPFSSLVGIIGGVKYMRRHA* |
| Ga0137365_106893012 | 3300012201 | Vadose Zone Soil | MLRFLKKVLMFRVGQKASRGFARSIGVRRPFSSLVGVIGGVKYMRRHA* |
| Ga0137374_102435164 | 3300012204 | Vadose Zone Soil | MHFLKKLLMFRIGQKASRGFARSIGLNSLASIVGVVGGVKYMRRHS* |
| Ga0137374_107902662 | 3300012204 | Vadose Zone Soil | QKTSRGVARKIGVRRPFSSMVGLIGGMKYMRRHS* |
| Ga0137380_106889742 | 3300012206 | Vadose Zone Soil | MLRFLKKVLMFRIGQKASRGFARTIGVRQPFSGIIGLIGGMKYMRRHA* |
| Ga0137376_103730191 | 3300012208 | Vadose Zone Soil | MYRLLKKVLMFRIGQRTSRGFARKIGVRRPFANLIGIVGGVKYMRRHA* |
| Ga0137376_112105261 | 3300012208 | Vadose Zone Soil | MRHFLKKVLMFRIGQKAAKGFARGLGLKRAAPLIGVVGGFKHMRRHT* |
| Ga0137376_112845101 | 3300012208 | Vadose Zone Soil | MLSLLKKLLLFRIGQKTTKGFSHKIGLHGIAWMVGLVGGYKYMRRHS* |
| Ga0137376_113286852 | 3300012208 | Vadose Zone Soil | MLRFLKKVLMFRIGQRTSRGFARSIGVRRPLSNIIGVIGGIKYMRRHA* |
| Ga0137376_118005352 | 3300012208 | Vadose Zone Soil | MMHFLKKLLMFRIGQKASRGFARAIGLNSLAAMVGVVGGLKYMRRHS* |
| Ga0137377_106365631 | 3300012211 | Vadose Zone Soil | MLHFLKKVLMFRVGQKASRGFARSIGVRRPFSSAIGVIGGIKYMRRHA* |
| Ga0137377_112371761 | 3300012211 | Vadose Zone Soil | MRHFLKKVLMFRIGQKAAKGFARGLGLKRAAPLIGVVGGFKHMRRHA* |
| Ga0150985_1163642161 | 3300012212 | Avena Fatua Rhizosphere | LLMFRVGQKATRGVARSIGLGKIATIVGLIGGYKHMRKHA* |
| Ga0150985_1213469041 | 3300012212 | Avena Fatua Rhizosphere | LPMLRFLKKLFLFRVGQKASRGFARTIGLNSIAAVVGVVGGMKYMRRHS* |
| Ga0137370_105987852 | 3300012285 | Vadose Zone Soil | MPEADMYRFLRKVLMFRIGQRTSRGFARKIGVRRPFANLIGIIGGMKYMRRHA* |
| Ga0137372_102525831 | 3300012350 | Vadose Zone Soil | MMHFLKKLLMFRIGQRASRGFARSIGLNSLATIVGVVGGVKYMRRHS* |
| Ga0137366_106199492 | 3300012354 | Vadose Zone Soil | MLRFLKKVLMFRIGQKASRGFARSIGVRKPFSGIVGLIGGVKYMRRHA* |
| Ga0137369_107416632 | 3300012355 | Vadose Zone Soil | MMHFLKKLLMFRIGQKASRGFARSIGLNSLAAIVGVVGGV |
| Ga0137375_100047662 | 3300012360 | Vadose Zone Soil | MLHFLKKVLMFRIGQKTSRGVARKIGVRRPFSSMVGLIGGMKYMRRHS* |
| Ga0137361_108371422 | 3300012362 | Vadose Zone Soil | MLHFLKKLLMFRVGQKASRGFARTIGLKSVAGLVGVVGGMKYMRRHS* |
| Ga0137390_105859972 | 3300012363 | Vadose Zone Soil | MWRFLKKVLMFRVGQKASRGFARSIGVRKPFSSLVGVIGGV |
| Ga0137373_108558501 | 3300012532 | Vadose Zone Soil | MLHFLKKLLMFRIGKKASRGFARSIGLDMLAGLVGVVGGVKYMRRHS* |
| Ga0137395_108893112 | 3300012917 | Vadose Zone Soil | MLRFLKKVLMFRVGQKASRGFARSIGVRKPFSSVIGLIGGVKYMRRHA* |
| Ga0164299_111953402 | 3300012958 | Soil | MLSLLKKLLLFRIGQKTTKGFAHRIGLHSIAWMAGLVGGVRYMRRHS* |
| Ga0164301_118282131 | 3300012960 | Soil | MLSLLKKLLLFRIGQKTSKGFSHRIGLHSIAWMVGLVGGYRYMRRHS* |
| Ga0164301_118634312 | 3300012960 | Soil | MLHFLKKLLLFRVGQKTTRGVARSIGLGKIATIVGLIGGYKHMRKHA* |
| Ga0134110_101046041 | 3300012975 | Grasslands Soil | MMHFLKKLLMFRIGQKASRGFARSIGLNSLASIVGVVGGVK |
| Ga0157374_120891712 | 3300013296 | Miscanthus Rhizosphere | MHMLHFLRKLLMFRVGQKASRGFAKSIGLHAISSAIGIVGGLKYMRRHS* |
| Ga0157378_100060049 | 3300013297 | Miscanthus Rhizosphere | MHMLRFLKKLLLFRVGQKASRGFARSIGLSGIASAVGLVGGLKYMRHHS* |
| Ga0157378_123784692 | 3300013297 | Miscanthus Rhizosphere | RFLKKLLLFRVGQKASRGFAKSIGLRTISHFVGIVGGLKYMRHHSS* |
| Ga0157375_1000007756 | 3300013308 | Miscanthus Rhizosphere | MHMLHFLRKLLMFRVGQKASRGFAKSIGLRGISNAVGIVGGLKYMRRHS* |
| Ga0134078_105689232 | 3300014157 | Grasslands Soil | MLRFLKKVLMFRVGQKASRGFARSIGVRKPFSSLVGLIGGFKYMRRHA* |
| Ga0182000_105938542 | 3300014487 | Soil | MLHFLKKVLMFRIGQKASRGFARSIGLTSVASLIGWVGGLKYMRRHS* |
| Ga0157377_100003487 | 3300014745 | Miscanthus Rhizosphere | MFRIGQKAAKGFARSIGLKRAAAVIGLVGGYKHMRRHA* |
| Ga0167624_10000759 | 3300015083 | Glacier Forefield Soil | MFRLLKKLLLFRIGQKATRGVARSIGLGKVAGAAGVVGGVRYMRKHA* |
| Ga0167622_10006594 | 3300015158 | Glacier Forefield Soil | MLHFLKKLLLFRVGQKATRGVARSIGLGKIATLVGLIGGYKHMRKHA* |
| Ga0167653_10006944 | 3300015162 | Glacier Forefield Soil | MLHFLKKLLMFRVGQKTTRGVARSIGLGKLAPVAGLVGGYKYMRRHE* |
| Ga0167652_10378461 | 3300015164 | Glacier Forefield Soil | MLHFLKKLLLFRVGQKTTRGVARSIGLGKIAMIIGLIGGYKHMRKHA* |
| Ga0167648_10368312 | 3300015171 | Glacier Forefield Soil | MLLFLRKLVMFRIGQKAARGIARTIGLGKVAQLAGLVGGYKHMRRHASVVLHK* |
| Ga0134085_103998041 | 3300015359 | Grasslands Soil | KKVLMFRIGQKASRGFARSIGVRKPFSGIVGLIGGFKYMRRHA* |
| Ga0134085_104391492 | 3300015359 | Grasslands Soil | MRHFLKKVLMFRIGQKAAKGFARGLGLKRAAPLIG |
| Ga0132258_119823122 | 3300015371 | Arabidopsis Rhizosphere | MLSLLKKLLLFRIGQKTTKGFAHKIGLHSIAWMAGLVGGVKYMRRHS* |
| Ga0132255_1057296642 | 3300015374 | Arabidopsis Rhizosphere | MSHFLKKLLMFRIGQKASRGFARSIGLDAVAGIVGLVGGVKYMRRHS* |
| Ga0187824_103324482 | 3300017927 | Freshwater Sediment | AGGESMLRFLKRVLMFRVGQKSSRFFARKVGISRPFASMIGVVGGFKYMRRHS |
| Ga0187822_101444112 | 3300017994 | Freshwater Sediment | MLRFLKRVLMFRVGQKSSRFFARKVGISRPFASMIGMVGGFKYMRRHS |
| Ga0066655_101246292 | 3300018431 | Grasslands Soil | MLHFLRKLLMFRVGQKASRGFAKSIGLHAISSAIGIVGGLKYMRRHS |
| Ga0066655_104813362 | 3300018431 | Grasslands Soil | MLHFLKKVLMFRIGQKASRGFARSIGVRRPFSSAIGVIGGIKYMRRHA |
| Ga0066655_108765782 | 3300018431 | Grasslands Soil | MLSLLKKLLLFRIGQKTTKAFSHRIGLHSIAWMAGLVGGVRYMRRHS |
| Ga0066667_113181531 | 3300018433 | Grasslands Soil | MLRFLKKILLFRLGQMASRGFARSIGFGMPSTGIVGVIRGVKYICGLS |
| Ga0066662_100341593 | 3300018468 | Grasslands Soil | MLRLLKKLLLFRIGQKTSRGFARTIGLDSLAAIVGVIGGIKYMRRHS |
| Ga0066662_107701683 | 3300018468 | Grasslands Soil | LKKLLMFRVGQKTTRGVARSIGLGKIATIVGLIGGYKHMRKHA |
| Ga0066662_107800443 | 3300018468 | Grasslands Soil | MFRIGQKAAKGFAKSLGLKHTARLIGLVGGYKHMRRHA |
| Ga0066662_111665792 | 3300018468 | Grasslands Soil | MRYFLKKVLMFRIGQKAAKGFAKSIGMKKTSSLIGVIGG |
| Ga0066662_111796122 | 3300018468 | Grasslands Soil | MLHFLRKLLMFRVGQKASRGFAKSIGLHAISGAIGVLGGLKYMRRHS |
| Ga0066662_114478992 | 3300018468 | Grasslands Soil | MLHFLKKLLMFRVGQKATRGVARSIGLGRIATIVGLIGGYKHMRKHASS |
| Ga0066662_120477522 | 3300018468 | Grasslands Soil | MMHFLKKLVMFRIGQKASRGFARSIGLNAMAGLVGLVGGVKYMRRHS |
| Ga0066662_125043642 | 3300018468 | Grasslands Soil | MLRFLKKVLMFRLGQKASRGFARSIGVRKPFSSLIGLIGGVKYMRRHA |
| Ga0193697_100007828 | 3300020005 | Soil | MLHFLRKLLMFRVGQKASRGFAKSIGLRGISSAVGIVGGLKYMRRHS |
| Ga0213903_1116751 | 3300021289 | Soil | LMFRVGQKASRGFAKQIGLRGMANVLGVVGGVKYMRRHS |
| Ga0213873_100004143 | 3300021358 | Rhizosphere | MLHFLKKLLMFRVGQKTTRGVARSIGLGRIATIVGLIGGYKHMRRHA |
| Ga0213876_101146072 | 3300021384 | Plant Roots | MLNFLKKLLMFRVGQKSGRGAARALGLRRLALPVGLVTGYKYMRRHS |
| Ga0233356_100001830 | 3300023046 | Soil | MLHFLKKLLMFRVGQKTTRGVARSIGFGKIATIAGLIGGYKYMRKHA |
| Ga0207656_100608593 | 3300025321 | Corn Rhizosphere | MIRLLKKLLLFRIGQKTSRGFARTIGLDSLAAIVGILGGIKYMRHHS |
| Ga0207682_101412641 | 3300025893 | Miscanthus Rhizosphere | MLHFLRKLLMFRVGQKASRGFAKSIGLRGISNAVGIVGGLKYMRRHS |
| Ga0207643_100891493 | 3300025908 | Miscanthus Rhizosphere | MQMIHFLKKLLLFRVGQKAARGFARSIGLHGISRAVGVIGGVKYMRRHS |
| Ga0207684_101089582 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MLHFLKKVLMFRVGQKASRGFARAIGVRRPISSIVGLIGGVKYMRRHA |
| Ga0207684_107694731 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | VGQKASRGFAKSIGLHAISSAVGIVGGLKYMRRHS |
| Ga0207684_110793182 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MYRFLKKVLMFRIGQKASRGFARKIGVRRPFANVIGLIGGVKYMRRHA |
| Ga0207684_112947782 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MLHFLKKLLMFRIGQKASRGFARGIGLDAVAGLVGLVGGVKYIRRHS |
| Ga0207695_101477724 | 3300025913 | Corn Rhizosphere | MLSLLKKLLLFRIGQKTTKAFSHRIGLHSIAWMAGLIGGVRYMRRHS |
| Ga0207646_100086164 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MLHFLKKVLMFRVGQKASRGFARAIGVRRPISSIVGLIGGVKYMRRHS |
| Ga0207646_106214031 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | LAVFKHWRREHMYRFLKKVLMFRIGQKASRGFARKIGVRRPFANVIGLIGGVKYMRRHA |
| Ga0207646_109719901 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MLRFLKKILMFRIGQKASRGFARSIGFHKPITGIVGLIGGMKYMRRHS |
| Ga0207694_100000013549 | 3300025924 | Corn Rhizosphere | MLHFLKKLLMFRVGQKTTRGVARSIGFGKIATIAGLIGGYKYMRRHA |
| Ga0207650_1000007189 | 3300025925 | Switchgrass Rhizosphere | MLHFLKKLLMFRVGQKTTRGVARSIGLGKIATIVGLIGGYKHMRKHA |
| Ga0207650_100283144 | 3300025925 | Switchgrass Rhizosphere | MLHFLRKLLMFRVGQKATRGFARSIGLGRIAGLVGLVGGYKHMRRHA |
| Ga0207650_106116242 | 3300025925 | Switchgrass Rhizosphere | MRHFLKKVLMFRIGQKAAKGFARSIGLRRAAAIIGVIGGVKHMRRHA |
| Ga0207650_109599971 | 3300025925 | Switchgrass Rhizosphere | MLHFLKKLLLFRVGQKASRGFANSIGLHGIARAVGIWGGLKYMRKHS |
| Ga0207659_106796862 | 3300025926 | Miscanthus Rhizosphere | MLRLLKKLLLFRIGQKTSRGFARTIGLDSLAAIVGIVGGIRYMRRHS |
| Ga0207687_100013505 | 3300025927 | Miscanthus Rhizosphere | MLHFLRKLLMFRVGQKASRGFAKSIGLHAISSAVGVVGGLKYMRRHS |
| Ga0207687_100078756 | 3300025927 | Miscanthus Rhizosphere | MLRLLKKLLLFRIGQKTSRGFARTIGLDSLAAIVGIIGGVKYMRRHS |
| Ga0207700_100039162 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MSHFLKKLLMFRIGQKASRGFARTIGLNSLATIVGVIGGVKYMRRHS |
| Ga0207670_100008108 | 3300025936 | Switchgrass Rhizosphere | MLHFLRKLLMFRVGQKASRGFAKSIGLHAISSAVGIVGGLKYMRRHS |
| Ga0207670_103403242 | 3300025936 | Switchgrass Rhizosphere | MRHFLKKLLMFRIGQKTAKGFARGIGLKRVAPLIGVVGGLKHMRRHA |
| Ga0207689_100979134 | 3300025942 | Miscanthus Rhizosphere | MRHFLKRVLMFRIGQKAAKGFARSIGLKRAAGVIGLVGGYKHMRRHV |
| Ga0207661_10000002649 | 3300025944 | Corn Rhizosphere | MLHFLKKLLMFRVGQKTTRGVARSIGLGKIATVVGLIGGYKHMRKHA |
| Ga0208142_10282251 | 3300025994 | Rice Paddy Soil | MYRLLKRLLMFRVGQKTARGFARGIGMRGVAPIIGIIGGFRHMRRHA |
| Ga0207648_103626752 | 3300026089 | Miscanthus Rhizosphere | MLRFLKKLLLFRVGQKASRGFAKSIGLRTISHAVGIVGGLKYMRHHSS |
| Ga0207676_126267952 | 3300026095 | Switchgrass Rhizosphere | DMLHFLKKLLMFRVGQKTTRGVARSIGLGKIATIVGLIGGYKHMRKHA |
| Ga0209153_10057682 | 3300026312 | Soil | MWNVLRNLFLFRVGQKASRGVARTFGLGSLASIIGIAGGVRYMRRHSRTHQV |
| Ga0209153_12391531 | 3300026312 | Soil | FKTHAEAPMLRLLKKLLLFRIGQKTSRGFARTIGLDSLAAIVGVIGGIKYMRRHS |
| Ga0209686_10380683 | 3300026315 | Soil | MWNVLRNLFLFRVGQKASRGVARTFGLGSLASIIGIAGGVRYMRRHSRTHQG |
| Ga0209152_102283911 | 3300026325 | Soil | MRHFLKKVLMFRIGQKAAKGFAKSLGLKHTARLIGVVGGFKHMRRHA |
| Ga0209152_104500402 | 3300026325 | Soil | MRYFLKKVLMFRIGQKAAKGFAKSIGMKKTSSLIGVIGGYKHMRRHA |
| Ga0209802_13279732 | 3300026328 | Soil | VALRLHFSRIMLRFLKKVLMFRIGQKASRGFARTIGVHKPFSSLIGVIGGFKYMRRHA |
| Ga0209803_11435002 | 3300026332 | Soil | MRHFLKKVLMFRIGQKAAKVFARGLGLKRAAPLIGVVGGFKHMRRHT |
| Ga0209804_10650202 | 3300026335 | Soil | MKQEADMLHFLKKLLMFRVGQKTTRGVARTIGLGRIATIVGLIGGYKYMRRHA |
| Ga0209059_10442023 | 3300026527 | Soil | MLHFLKQLLMFRVGQKATRGFARTIGLGRIATLVGLIGGYKHMRRHA |
| Ga0209058_11401942 | 3300026536 | Soil | MLRFLKKVLMFRVGQKASRGFARTIGVRKPFSSVIGVIGGFKYMRRHA |
| Ga0209157_10190892 | 3300026537 | Soil | MLRFLKKVLMFRIGQKASRGFARSIGVRKPFSGIVGLIGGFKYMRRHA |
| Ga0209056_103163353 | 3300026538 | Soil | MLRFLKKVLMFRIGQKASRGFARTIGVRRPFSGIIGLIGGMKYMRRHA |
| Ga0209805_12741371 | 3300026542 | Soil | KKLLMCRVGQKTTRGVARTIGLGRIATIVGLIGGYKYMRRHA |
| Ga0209474_100382224 | 3300026550 | Soil | MLHFLKQLLMFRVGQKATRGFARTIGLGRIATIVGLIGGYKHMRKHA |
| Ga0209474_106954782 | 3300026550 | Soil | MLHFLKKLLMFRIGQKASRGFARSIGLNSLATIVGVVGGVK |
| Ga0209474_107477051 | 3300026550 | Soil | SREAPMLRFLKKLLLFRIGQKTTKGFVRTIGLDSLAAIAGIIGGVKYMRRHS |
| Ga0209648_102883061 | 3300026551 | Grasslands Soil | MWRFLKKVLMFRVGQKASRGFARSIGVRKPFSSLVGVIGGVKYMRRHA |
| Ga0209577_104610891 | 3300026552 | Soil | MLHFLKKLLMFRVGQKTTRGVARTIGLGRIATIVGLIGGYKYMRRHA |
| Ga0209177_102368152 | 3300027775 | Agricultural Soil | MRHFLKKVLMFRVGQKAAKGFAKSLGLKHSARFIGLVGGYKHMRRHA |
| Ga0209166_101451582 | 3300027857 | Surface Soil | MLRFLKRVLMFRVGQKSSRFFARKVGISWPFASMIGMIGGFKYMRRHS |
| Ga0209166_103753362 | 3300027857 | Surface Soil | MYRLLKRLLMFRVGQKTSRGFAKSIGLRRISPIVGIIGGIKYMRKHA |
| Ga0209590_100851372 | 3300027882 | Vadose Zone Soil | MLRFLKKVLMFRIGQKASRGFAWSIGVRQPFSGIIGLIGGVKYMRRHA |
| Ga0209526_108940301 | 3300028047 | Forest Soil | MLRFLKKVLMFRVGQKASRGFARSIGVRRPISGIIGLIGGFKYMRRHA |
| Ga0268243_11736762 | 3300030510 | Soil | MLHFLKKVLMFRIGQKASRGFARSIGLTSVASLIGWVGGLKYMRRHS |
| Ga0073994_120059292 | 3300030991 | Soil | MLHFLKKLLMFRVGQKTTRGVARSIGFGKIATVAGLVGGYKYMRRHA |
| Ga0073996_119562002 | 3300030998 | Soil | MLRFLKKILMFRLGQKASRGFARSIGVRRPFSNLIGVIGGIKYMRRHA |
| Ga0073995_108111572 | 3300031047 | Soil | PNMLHFLKKLLMFRVGQKTTRGVARSIGFGKIATVAGLVGGYKYMRRHA |
| Ga0308189_105472602 | 3300031058 | Soil | LRFLKSVLMFRVGQKASRGFARSIGVRKPFSSLVGVIGGVKYMRRH |
| Ga0308192_10834572 | 3300031082 | Soil | LHLLKKLFMFRVGQKATRGFARSIGLSKVAFLAGLVGGYKNMRRHA |
| Ga0308176_121781022 | 3300031996 | Soil | MLHFLRKLLMFRVGQKASRGFAKSIGLHAISGAVGVLGGLKYMRRHS |
| Ga0335076_100997643 | 3300032955 | Soil | MLSLLKKLLLFRIGQKTTKAFSHRIGLHSIAWMVGLIGGFRYMRRHS |
| Ga0372943_0521156_305_454 | 3300034268 | Soil | MLNFLKKLLMFRVGQKATRGVARSIGLGRIATILGLIGGYKHMRRHASS |
| ⦗Top⦘ |