| Basic Information | |
|---|---|
| Family ID | F014335 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 264 |
| Average Sequence Length | 43 residues |
| Representative Sequence | STKYDDPDALAMLNEPVKPVHSYNPLVQIQADKSQLEETRA |
| Number of Associated Samples | 203 |
| Number of Associated Scaffolds | 264 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.38 % |
| % of genes near scaffold ends (potentially truncated) | 99.62 % |
| % of genes from short scaffolds (< 2000 bps) | 91.67 % |
| Associated GOLD sequencing projects | 188 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.31 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (98.864 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (21.970 % of family members) |
| Environment Ontology (ENVO) | Unclassified (24.621 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (56.439 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 10.14% β-sheet: 0.00% Coil/Unstructured: 89.86% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.31 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 264 Family Scaffolds |
|---|---|---|
| PF00313 | CSD | 20.08 |
| PF13458 | Peripla_BP_6 | 1.52 |
| PF16881 | LIAS_N | 1.52 |
| PF04055 | Radical_SAM | 0.76 |
| PF13676 | TIR_2 | 0.38 |
| PF00501 | AMP-binding | 0.38 |
| PF13620 | CarboxypepD_reg | 0.38 |
| PF03544 | TonB_C | 0.38 |
| PF16355 | DUF4982 | 0.38 |
| PF01370 | Epimerase | 0.38 |
| PF02897 | Peptidase_S9_N | 0.38 |
| COG ID | Name | Functional Category | % Frequency in 264 Family Scaffolds |
|---|---|---|---|
| COG0810 | Periplasmic protein TonB, links inner and outer membranes | Cell wall/membrane/envelope biogenesis [M] | 0.38 |
| COG1505 | Prolyl endopeptidase PreP, S9A serine peptidase family | Amino acid transport and metabolism [E] | 0.38 |
| COG1770 | Protease II | Amino acid transport and metabolism [E] | 0.38 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 98.86 % |
| Unclassified | root | N/A | 1.14 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000364|INPhiseqgaiiFebDRAFT_100771674 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 979 | Open in IMG/M |
| 3300000651|AP72_2010_repI_A10DRAFT_1059616 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| 3300001471|JGI12712J15308_10072754 | All Organisms → cellular organisms → Bacteria | 869 | Open in IMG/M |
| 3300001593|JGI12635J15846_10037818 | All Organisms → cellular organisms → Bacteria | 3790 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100883952 | All Organisms → cellular organisms → Bacteria | 775 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101635823 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101754482 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300002562|JGI25382J37095_10183517 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 642 | Open in IMG/M |
| 3300002912|JGI25386J43895_10164098 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
| 3300002914|JGI25617J43924_10323853 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300002915|JGI25387J43893_1034371 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 682 | Open in IMG/M |
| 3300004080|Ga0062385_10467184 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 771 | Open in IMG/M |
| 3300004138|Ga0058905_1527866 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 563 | Open in IMG/M |
| 3300004267|Ga0066396_10052117 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 660 | Open in IMG/M |
| 3300004479|Ga0062595_100631123 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 843 | Open in IMG/M |
| 3300004631|Ga0058899_12182383 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 617 | Open in IMG/M |
| 3300005167|Ga0066672_10768517 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 610 | Open in IMG/M |
| 3300005181|Ga0066678_10278635 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1089 | Open in IMG/M |
| 3300005186|Ga0066676_11029070 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 546 | Open in IMG/M |
| 3300005332|Ga0066388_102117364 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1013 | Open in IMG/M |
| 3300005332|Ga0066388_102449190 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 948 | Open in IMG/M |
| 3300005332|Ga0066388_108332878 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 517 | Open in IMG/M |
| 3300005434|Ga0070709_10606208 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 843 | Open in IMG/M |
| 3300005436|Ga0070713_100477748 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1174 | Open in IMG/M |
| 3300005439|Ga0070711_101338125 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 622 | Open in IMG/M |
| 3300005447|Ga0066689_10220104 | All Organisms → cellular organisms → Bacteria | 1158 | Open in IMG/M |
| 3300005466|Ga0070685_10403421 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 947 | Open in IMG/M |
| 3300005467|Ga0070706_100934373 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 801 | Open in IMG/M |
| 3300005518|Ga0070699_100527762 | All Organisms → cellular organisms → Bacteria | 1074 | Open in IMG/M |
| 3300005537|Ga0070730_10058983 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2741 | Open in IMG/M |
| 3300005537|Ga0070730_10412060 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 873 | Open in IMG/M |
| 3300005547|Ga0070693_100290227 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1099 | Open in IMG/M |
| 3300005555|Ga0066692_10037016 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2630 | Open in IMG/M |
| 3300005555|Ga0066692_10624453 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 674 | Open in IMG/M |
| 3300005555|Ga0066692_10965817 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 521 | Open in IMG/M |
| 3300005556|Ga0066707_10387346 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 911 | Open in IMG/M |
| 3300005560|Ga0066670_10091303 | All Organisms → cellular organisms → Bacteria | 1684 | Open in IMG/M |
| 3300005560|Ga0066670_10383354 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 860 | Open in IMG/M |
| 3300005574|Ga0066694_10466817 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 590 | Open in IMG/M |
| 3300005575|Ga0066702_10541680 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 704 | Open in IMG/M |
| 3300005576|Ga0066708_10641134 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 677 | Open in IMG/M |
| 3300005610|Ga0070763_10923955 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 520 | Open in IMG/M |
| 3300005764|Ga0066903_107667554 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 556 | Open in IMG/M |
| 3300006031|Ga0066651_10466327 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 670 | Open in IMG/M |
| 3300006086|Ga0075019_10565920 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 710 | Open in IMG/M |
| 3300006163|Ga0070715_10326393 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 830 | Open in IMG/M |
| 3300006172|Ga0075018_10777684 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 523 | Open in IMG/M |
| 3300006175|Ga0070712_100433182 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1092 | Open in IMG/M |
| 3300006176|Ga0070765_100140053 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2146 | Open in IMG/M |
| 3300006176|Ga0070765_101885695 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 560 | Open in IMG/M |
| 3300006354|Ga0075021_10357848 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 911 | Open in IMG/M |
| 3300006354|Ga0075021_10983132 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 550 | Open in IMG/M |
| 3300006794|Ga0066658_10915009 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 506 | Open in IMG/M |
| 3300006796|Ga0066665_10867235 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 703 | Open in IMG/M |
| 3300006804|Ga0079221_10207477 | All Organisms → cellular organisms → Bacteria | 1079 | Open in IMG/M |
| 3300006806|Ga0079220_10760650 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 725 | Open in IMG/M |
| 3300006854|Ga0075425_100036362 | All Organisms → cellular organisms → Bacteria | 5485 | Open in IMG/M |
| 3300006904|Ga0075424_101296313 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 774 | Open in IMG/M |
| 3300006914|Ga0075436_100673638 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 765 | Open in IMG/M |
| 3300006954|Ga0079219_11744130 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 579 | Open in IMG/M |
| 3300007255|Ga0099791_10133746 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1153 | Open in IMG/M |
| 3300007265|Ga0099794_10318875 | All Organisms → cellular organisms → Bacteria | 806 | Open in IMG/M |
| 3300007265|Ga0099794_10448394 | All Organisms → cellular organisms → Bacteria | 676 | Open in IMG/M |
| 3300007265|Ga0099794_10731841 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
| 3300009012|Ga0066710_101351260 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1105 | Open in IMG/M |
| 3300009089|Ga0099828_10103568 | All Organisms → cellular organisms → Bacteria | 2465 | Open in IMG/M |
| 3300009089|Ga0099828_10969149 | All Organisms → cellular organisms → Bacteria | 758 | Open in IMG/M |
| 3300009137|Ga0066709_100509967 | All Organisms → cellular organisms → Bacteria | 1696 | Open in IMG/M |
| 3300009545|Ga0105237_12230041 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 557 | Open in IMG/M |
| 3300010046|Ga0126384_10257454 | All Organisms → cellular organisms → Bacteria | 1414 | Open in IMG/M |
| 3300010048|Ga0126373_10793589 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1009 | Open in IMG/M |
| 3300010048|Ga0126373_12014963 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
| 3300010159|Ga0099796_10151068 | All Organisms → cellular organisms → Bacteria | 914 | Open in IMG/M |
| 3300010159|Ga0099796_10296439 | All Organisms → cellular organisms → Bacteria | 684 | Open in IMG/M |
| 3300010329|Ga0134111_10342081 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 631 | Open in IMG/M |
| 3300010333|Ga0134080_10531680 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
| 3300010358|Ga0126370_10584219 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 961 | Open in IMG/M |
| 3300010359|Ga0126376_10502532 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1123 | Open in IMG/M |
| 3300010360|Ga0126372_10957862 | All Organisms → cellular organisms → Bacteria | 864 | Open in IMG/M |
| 3300010361|Ga0126378_12038757 | All Organisms → cellular organisms → Bacteria | 654 | Open in IMG/M |
| 3300010366|Ga0126379_10960865 | All Organisms → cellular organisms → Bacteria | 958 | Open in IMG/M |
| 3300010398|Ga0126383_10597235 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1175 | Open in IMG/M |
| 3300010398|Ga0126383_11279983 | All Organisms → cellular organisms → Bacteria | 823 | Open in IMG/M |
| 3300011120|Ga0150983_10460596 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 535 | Open in IMG/M |
| 3300011120|Ga0150983_11273896 | All Organisms → cellular organisms → Bacteria | 696 | Open in IMG/M |
| 3300011120|Ga0150983_11581570 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 769 | Open in IMG/M |
| 3300011120|Ga0150983_11984008 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| 3300011120|Ga0150983_16004428 | All Organisms → cellular organisms → Bacteria | 649 | Open in IMG/M |
| 3300011120|Ga0150983_16394536 | All Organisms → cellular organisms → Bacteria | 652 | Open in IMG/M |
| 3300011269|Ga0137392_10411409 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1123 | Open in IMG/M |
| 3300011270|Ga0137391_10720796 | All Organisms → cellular organisms → Bacteria | 827 | Open in IMG/M |
| 3300011271|Ga0137393_10476435 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1071 | Open in IMG/M |
| 3300011271|Ga0137393_10735724 | All Organisms → cellular organisms → Bacteria | 844 | Open in IMG/M |
| 3300011271|Ga0137393_10743807 | All Organisms → cellular organisms → Bacteria | 839 | Open in IMG/M |
| 3300011271|Ga0137393_11641318 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| 3300012189|Ga0137388_10996620 | All Organisms → cellular organisms → Bacteria | 773 | Open in IMG/M |
| 3300012199|Ga0137383_10610490 | All Organisms → cellular organisms → Bacteria | 798 | Open in IMG/M |
| 3300012202|Ga0137363_10586644 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 940 | Open in IMG/M |
| 3300012202|Ga0137363_10754994 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 824 | Open in IMG/M |
| 3300012202|Ga0137363_11570415 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
| 3300012203|Ga0137399_10583771 | All Organisms → cellular organisms → Bacteria | 939 | Open in IMG/M |
| 3300012212|Ga0150985_120397945 | All Organisms → cellular organisms → Bacteria | 677 | Open in IMG/M |
| 3300012349|Ga0137387_10129110 | All Organisms → cellular organisms → Bacteria | 1787 | Open in IMG/M |
| 3300012351|Ga0137386_10677621 | All Organisms → cellular organisms → Bacteria | 741 | Open in IMG/M |
| 3300012357|Ga0137384_11304561 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
| 3300012362|Ga0137361_11047317 | All Organisms → cellular organisms → Bacteria | 736 | Open in IMG/M |
| 3300012362|Ga0137361_11698933 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
| 3300012582|Ga0137358_10022169 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4102 | Open in IMG/M |
| 3300012582|Ga0137358_10931581 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| 3300012683|Ga0137398_10352664 | All Organisms → cellular organisms → Bacteria | 996 | Open in IMG/M |
| 3300012683|Ga0137398_10827401 | All Organisms → cellular organisms → Bacteria | 647 | Open in IMG/M |
| 3300012917|Ga0137395_10450981 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 924 | Open in IMG/M |
| 3300012918|Ga0137396_10072576 | All Organisms → cellular organisms → Bacteria | 2408 | Open in IMG/M |
| 3300012918|Ga0137396_10393815 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1026 | Open in IMG/M |
| 3300012924|Ga0137413_10673827 | All Organisms → cellular organisms → Bacteria | 782 | Open in IMG/M |
| 3300012925|Ga0137419_10177891 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 1559 | Open in IMG/M |
| 3300012925|Ga0137419_10690304 | All Organisms → cellular organisms → Bacteria | 827 | Open in IMG/M |
| 3300012930|Ga0137407_10034289 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 3990 | Open in IMG/M |
| 3300012930|Ga0137407_10182052 | All Organisms → cellular organisms → Bacteria | 1875 | Open in IMG/M |
| 3300012930|Ga0137407_11983772 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
| 3300012931|Ga0153915_11540288 | All Organisms → cellular organisms → Bacteria | 777 | Open in IMG/M |
| 3300012944|Ga0137410_10005986 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 8279 | Open in IMG/M |
| 3300012971|Ga0126369_11316468 | All Organisms → cellular organisms → Bacteria | 812 | Open in IMG/M |
| 3300012971|Ga0126369_12560447 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
| 3300012987|Ga0164307_11467737 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
| 3300014154|Ga0134075_10441436 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 578 | Open in IMG/M |
| 3300014157|Ga0134078_10137420 | All Organisms → cellular organisms → Bacteria | 950 | Open in IMG/M |
| 3300015051|Ga0137414_1037758 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1026 | Open in IMG/M |
| 3300015053|Ga0137405_1416151 | All Organisms → cellular organisms → Bacteria | 2721 | Open in IMG/M |
| 3300015089|Ga0167643_1018543 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1057 | Open in IMG/M |
| 3300015373|Ga0132257_100068740 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4000 | Open in IMG/M |
| 3300016294|Ga0182041_11047073 | All Organisms → cellular organisms → Bacteria | 739 | Open in IMG/M |
| 3300016387|Ga0182040_11935969 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300016445|Ga0182038_11018279 | All Organisms → cellular organisms → Bacteria | 734 | Open in IMG/M |
| 3300017822|Ga0187802_10184144 | All Organisms → cellular organisms → Bacteria | 801 | Open in IMG/M |
| 3300017936|Ga0187821_10396884 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 564 | Open in IMG/M |
| 3300018058|Ga0187766_10471065 | All Organisms → cellular organisms → Bacteria | 841 | Open in IMG/M |
| 3300018468|Ga0066662_10429022 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1174 | Open in IMG/M |
| 3300018468|Ga0066662_10464042 | All Organisms → cellular organisms → Bacteria | 1139 | Open in IMG/M |
| 3300018468|Ga0066662_12033255 | Not Available | 602 | Open in IMG/M |
| 3300019789|Ga0137408_1168910 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1132 | Open in IMG/M |
| 3300019882|Ga0193713_1044299 | All Organisms → cellular organisms → Bacteria | 1285 | Open in IMG/M |
| 3300020199|Ga0179592_10385375 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
| 3300020199|Ga0179592_10428037 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
| 3300020199|Ga0179592_10494095 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300020579|Ga0210407_10057807 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2901 | Open in IMG/M |
| 3300020579|Ga0210407_10146132 | All Organisms → cellular organisms → Bacteria | 1820 | Open in IMG/M |
| 3300020579|Ga0210407_10407755 | All Organisms → cellular organisms → Bacteria | 1063 | Open in IMG/M |
| 3300020579|Ga0210407_10828421 | All Organisms → cellular organisms → Bacteria | 712 | Open in IMG/M |
| 3300020580|Ga0210403_10499423 | All Organisms → cellular organisms → Bacteria | 988 | Open in IMG/M |
| 3300020581|Ga0210399_10830253 | All Organisms → cellular organisms → Bacteria | 753 | Open in IMG/M |
| 3300020582|Ga0210395_10337070 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1134 | Open in IMG/M |
| 3300020583|Ga0210401_10644863 | All Organisms → cellular organisms → Bacteria | 920 | Open in IMG/M |
| 3300021046|Ga0215015_10023396 | All Organisms → cellular organisms → Bacteria | 1876 | Open in IMG/M |
| 3300021046|Ga0215015_10704667 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300021046|Ga0215015_10936784 | All Organisms → cellular organisms → Bacteria | 1025 | Open in IMG/M |
| 3300021086|Ga0179596_10403218 | All Organisms → cellular organisms → Bacteria | 690 | Open in IMG/M |
| 3300021168|Ga0210406_10874670 | All Organisms → cellular organisms → Bacteria | 678 | Open in IMG/M |
| 3300021168|Ga0210406_11093983 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
| 3300021171|Ga0210405_10770083 | All Organisms → cellular organisms → Bacteria | 739 | Open in IMG/M |
| 3300021178|Ga0210408_10937869 | All Organisms → cellular organisms → Bacteria | 672 | Open in IMG/M |
| 3300021402|Ga0210385_10717041 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 766 | Open in IMG/M |
| 3300021404|Ga0210389_10086999 | All Organisms → cellular organisms → Bacteria | 2402 | Open in IMG/M |
| 3300021405|Ga0210387_10518039 | All Organisms → cellular organisms → Bacteria | 1060 | Open in IMG/M |
| 3300021418|Ga0193695_1057337 | Not Available | 846 | Open in IMG/M |
| 3300021432|Ga0210384_10063240 | All Organisms → cellular organisms → Bacteria | 3341 | Open in IMG/M |
| 3300021432|Ga0210384_10437718 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1178 | Open in IMG/M |
| 3300021432|Ga0210384_10838288 | All Organisms → cellular organisms → Bacteria | 818 | Open in IMG/M |
| 3300021474|Ga0210390_10359685 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1231 | Open in IMG/M |
| 3300021559|Ga0210409_10326862 | All Organisms → cellular organisms → Bacteria | 1380 | Open in IMG/M |
| 3300021559|Ga0210409_10838738 | All Organisms → cellular organisms → Bacteria | 792 | Open in IMG/M |
| 3300021559|Ga0210409_10860991 | All Organisms → cellular organisms → Bacteria | 779 | Open in IMG/M |
| 3300022506|Ga0242648_1045664 | All Organisms → cellular organisms → Bacteria | 653 | Open in IMG/M |
| 3300022714|Ga0242671_1047372 | All Organisms → cellular organisms → Bacteria | 704 | Open in IMG/M |
| 3300022726|Ga0242654_10196863 | All Organisms → cellular organisms → Bacteria | 699 | Open in IMG/M |
| 3300024181|Ga0247693_1034468 | All Organisms → cellular organisms → Bacteria | 706 | Open in IMG/M |
| 3300024222|Ga0247691_1020260 | All Organisms → cellular organisms → Bacteria | 1044 | Open in IMG/M |
| 3300024288|Ga0179589_10069597 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 1375 | Open in IMG/M |
| 3300024290|Ga0247667_1038777 | All Organisms → cellular organisms → Bacteria | 899 | Open in IMG/M |
| 3300024330|Ga0137417_1109241 | All Organisms → cellular organisms → Bacteria | 978 | Open in IMG/M |
| 3300024330|Ga0137417_1189163 | All Organisms → cellular organisms → Bacteria | 1310 | Open in IMG/M |
| 3300025900|Ga0207710_10324270 | All Organisms → cellular organisms → Bacteria | 781 | Open in IMG/M |
| 3300025905|Ga0207685_10388964 | All Organisms → cellular organisms → Bacteria | 712 | Open in IMG/M |
| 3300025910|Ga0207684_10772045 | All Organisms → cellular organisms → Bacteria | 814 | Open in IMG/M |
| 3300025914|Ga0207671_10618938 | All Organisms → cellular organisms → Bacteria | 863 | Open in IMG/M |
| 3300025922|Ga0207646_10863790 | All Organisms → cellular organisms → Bacteria | 804 | Open in IMG/M |
| 3300025939|Ga0207665_10049325 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2828 | Open in IMG/M |
| 3300026095|Ga0207676_12203888 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 549 | Open in IMG/M |
| 3300026291|Ga0209890_10076811 | All Organisms → cellular organisms → Bacteria | 1186 | Open in IMG/M |
| 3300026301|Ga0209238_1012108 | All Organisms → cellular organisms → Bacteria | 3360 | Open in IMG/M |
| 3300026309|Ga0209055_1154324 | All Organisms → cellular organisms → Bacteria | 771 | Open in IMG/M |
| 3300026309|Ga0209055_1296417 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300026310|Ga0209239_1324081 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
| 3300026312|Ga0209153_1201131 | All Organisms → cellular organisms → Bacteria | 699 | Open in IMG/M |
| 3300026317|Ga0209154_1029551 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2523 | Open in IMG/M |
| 3300026328|Ga0209802_1068053 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1692 | Open in IMG/M |
| 3300026328|Ga0209802_1119623 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1158 | Open in IMG/M |
| 3300026329|Ga0209375_1194848 | All Organisms → cellular organisms → Bacteria | 779 | Open in IMG/M |
| 3300026342|Ga0209057_1025844 | All Organisms → cellular organisms → Bacteria | 3194 | Open in IMG/M |
| 3300026342|Ga0209057_1074243 | All Organisms → cellular organisms → Bacteria | 1466 | Open in IMG/M |
| 3300026359|Ga0257163_1060056 | All Organisms → cellular organisms → Bacteria | 609 | Open in IMG/M |
| 3300026490|Ga0257153_1082798 | All Organisms → cellular organisms → Bacteria | 643 | Open in IMG/M |
| 3300026552|Ga0209577_10392081 | All Organisms → cellular organisms → Bacteria | 1004 | Open in IMG/M |
| 3300026557|Ga0179587_10380451 | All Organisms → cellular organisms → Bacteria | 918 | Open in IMG/M |
| 3300027024|Ga0207819_1009562 | All Organisms → cellular organisms → Bacteria | 1441 | Open in IMG/M |
| 3300027516|Ga0207761_1011681 | All Organisms → cellular organisms → Bacteria | 1900 | Open in IMG/M |
| 3300027528|Ga0208985_1097551 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
| 3300027583|Ga0209527_1103418 | Not Available | 638 | Open in IMG/M |
| 3300027587|Ga0209220_1176235 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 548 | Open in IMG/M |
| 3300027603|Ga0209331_1074603 | All Organisms → cellular organisms → Bacteria | 844 | Open in IMG/M |
| 3300027651|Ga0209217_1016748 | All Organisms → cellular organisms → Bacteria | 2373 | Open in IMG/M |
| 3300027671|Ga0209588_1040264 | All Organisms → cellular organisms → Bacteria | 1508 | Open in IMG/M |
| 3300027671|Ga0209588_1106600 | All Organisms → cellular organisms → Bacteria | 901 | Open in IMG/M |
| 3300027674|Ga0209118_1059610 | All Organisms → cellular organisms → Bacteria | 1114 | Open in IMG/M |
| 3300027678|Ga0209011_1049265 | All Organisms → cellular organisms → Bacteria | 1292 | Open in IMG/M |
| 3300027765|Ga0209073_10332660 | All Organisms → cellular organisms → Bacteria | 609 | Open in IMG/M |
| 3300027775|Ga0209177_10480912 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300027846|Ga0209180_10076191 | All Organisms → cellular organisms → Bacteria | 1888 | Open in IMG/M |
| 3300027862|Ga0209701_10624749 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| 3300027875|Ga0209283_10273467 | All Organisms → cellular organisms → Bacteria | 1118 | Open in IMG/M |
| 3300027894|Ga0209068_10599014 | All Organisms → cellular organisms → Bacteria | 641 | Open in IMG/M |
| 3300027903|Ga0209488_10221036 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1425 | Open in IMG/M |
| 3300028047|Ga0209526_10372021 | All Organisms → cellular organisms → Bacteria | 953 | Open in IMG/M |
| 3300028047|Ga0209526_10832394 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
| 3300028536|Ga0137415_10552938 | All Organisms → cellular organisms → Bacteria | 960 | Open in IMG/M |
| 3300028536|Ga0137415_11458613 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300028759|Ga0302224_10073468 | All Organisms → cellular organisms → Bacteria | 1297 | Open in IMG/M |
| 3300028792|Ga0307504_10210746 | All Organisms → cellular organisms → Bacteria | 693 | Open in IMG/M |
| 3300028795|Ga0302227_10265841 | All Organisms → cellular organisms → Bacteria | 655 | Open in IMG/M |
| 3300028798|Ga0302222_10037504 | All Organisms → cellular organisms → Bacteria | 1978 | Open in IMG/M |
| 3300028906|Ga0308309_11093312 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 689 | Open in IMG/M |
| 3300028906|Ga0308309_11463547 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
| 3300029636|Ga0222749_10519697 | All Organisms → cellular organisms → Bacteria | 646 | Open in IMG/M |
| 3300030707|Ga0310038_10417012 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
| 3300030848|Ga0075388_11575334 | All Organisms → cellular organisms → Bacteria | 705 | Open in IMG/M |
| 3300030916|Ga0075386_10779642 | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
| 3300030923|Ga0138296_1159692 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
| 3300031015|Ga0138298_1542938 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
| 3300031022|Ga0138301_1756886 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| 3300031128|Ga0170823_15772656 | All Organisms → cellular organisms → Bacteria | 629 | Open in IMG/M |
| 3300031446|Ga0170820_11653477 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300031469|Ga0170819_12851471 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300031474|Ga0170818_115186986 | All Organisms → cellular organisms → Bacteria | 653 | Open in IMG/M |
| 3300031525|Ga0302326_10008912 | All Organisms → cellular organisms → Bacteria | 22051 | Open in IMG/M |
| 3300031719|Ga0306917_10685758 | All Organisms → cellular organisms → Bacteria | 805 | Open in IMG/M |
| 3300031719|Ga0306917_10886743 | All Organisms → cellular organisms → Bacteria | 698 | Open in IMG/M |
| 3300031719|Ga0306917_11310368 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
| 3300031720|Ga0307469_10799457 | All Organisms → cellular organisms → Bacteria | 865 | Open in IMG/M |
| 3300031740|Ga0307468_101229656 | All Organisms → cellular organisms → Bacteria | 677 | Open in IMG/M |
| 3300031744|Ga0306918_10987496 | All Organisms → cellular organisms → Bacteria | 654 | Open in IMG/M |
| 3300031754|Ga0307475_11187918 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
| 3300031823|Ga0307478_11377016 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 585 | Open in IMG/M |
| 3300031879|Ga0306919_11066143 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
| 3300031962|Ga0307479_11034309 | All Organisms → cellular organisms → Bacteria | 789 | Open in IMG/M |
| 3300031962|Ga0307479_11387351 | All Organisms → cellular organisms → Bacteria | 662 | Open in IMG/M |
| 3300031962|Ga0307479_11992301 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300031962|Ga0307479_12098114 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300032051|Ga0318532_10176530 | All Organisms → cellular organisms → Bacteria | 759 | Open in IMG/M |
| 3300032160|Ga0311301_12037218 | All Organisms → cellular organisms → Bacteria | 668 | Open in IMG/M |
| 3300032174|Ga0307470_10758742 | All Organisms → cellular organisms → Bacteria | 746 | Open in IMG/M |
| 3300032205|Ga0307472_102350486 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
| 3300032782|Ga0335082_10806914 | All Organisms → cellular organisms → Bacteria | 800 | Open in IMG/M |
| 3300033004|Ga0335084_10118017 | All Organisms → cellular organisms → Bacteria | 2758 | Open in IMG/M |
| 3300033289|Ga0310914_10742684 | All Organisms → cellular organisms → Bacteria | 878 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 21.97% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 14.39% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 10.23% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 8.33% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.55% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.55% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 4.17% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.79% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.03% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.65% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.65% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.89% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.89% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.89% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.89% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.52% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.52% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.14% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.76% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.76% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.76% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.76% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.76% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.38% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.38% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.38% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.38% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.38% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.38% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.38% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.38% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.38% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.38% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.38% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000651 | Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A10 | Environmental | Open in IMG/M |
| 3300001471 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300002562 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002912 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002914 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm | Environmental | Open in IMG/M |
| 3300002915 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm | Environmental | Open in IMG/M |
| 3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300004138 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF246 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004267 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 6 MoBio | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300004631 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF234 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
| 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
| 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
| 3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
| 3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300015051 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015089 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G8A, Adjacent to main proglacial river, end of transect (Watson river)) | Environmental | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
| 3300017936 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1 | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300019882 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3a2 | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021046 | Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depth | Environmental | Open in IMG/M |
| 3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021418 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3s2 | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300022506 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-26-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022714 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022726 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300024181 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK34 | Environmental | Open in IMG/M |
| 3300024222 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK32 | Environmental | Open in IMG/M |
| 3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300024290 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK08 | Environmental | Open in IMG/M |
| 3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026291 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049 (SPAdes) | Environmental | Open in IMG/M |
| 3300026301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026309 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes) | Environmental | Open in IMG/M |
| 3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026312 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 (SPAdes) | Environmental | Open in IMG/M |
| 3300026317 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes) | Environmental | Open in IMG/M |
| 3300026328 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes) | Environmental | Open in IMG/M |
| 3300026329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 (SPAdes) | Environmental | Open in IMG/M |
| 3300026342 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 (SPAdes) | Environmental | Open in IMG/M |
| 3300026359 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-06-A | Environmental | Open in IMG/M |
| 3300026490 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-A | Environmental | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027024 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 42 (SPAdes) | Environmental | Open in IMG/M |
| 3300027516 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 34 (SPAdes) | Environmental | Open in IMG/M |
| 3300027528 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027583 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027587 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027603 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027651 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027674 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027678 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027765 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes) | Environmental | Open in IMG/M |
| 3300027775 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028759 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_1 | Environmental | Open in IMG/M |
| 3300028792 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S | Environmental | Open in IMG/M |
| 3300028795 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_1 | Environmental | Open in IMG/M |
| 3300028798 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_2 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030707 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG (v2) | Environmental | Open in IMG/M |
| 3300030848 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OA8 EcM (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030916 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA12 EcM (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030923 | Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A3_MS_autumn Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300031015 | Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A9_MS_autumn Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300031022 | Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A3_MS_spring Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300031128 | Oak Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031469 | Fir Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032051 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f26 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| INPhiseqgaiiFebDRAFT_1007716743 | 3300000364 | Soil | GGLWATIKAGLTTSYADRDALEMLDEPVKPVHAFNPLVQIEAGKAQMEETRA* |
| AP72_2010_repI_A10DRAFT_10596162 | 3300000651 | Forest Soil | DDDALQLLNEPVRPVHSYNPLVQIASSKTQMEETRA* |
| JGI12712J15308_100727541 | 3300001471 | Forest Soil | DALQMLNEPVKPVHSFNPLVQISSTDSAMEETRA* |
| JGI12635J15846_100378188 | 3300001593 | Forest Soil | YEDADALQMLNEPVKPVHAFNPLVQISSTSSAMEETRA* |
| JGIcombinedJ26739_1008839522 | 3300002245 | Forest Soil | KYEDSDALAMLNEPAKPVHAFNPLVQINSSKTQLEETRA* |
| JGIcombinedJ26739_1016358232 | 3300002245 | Forest Soil | AGNYEDADALQMLNEPVKPVHSFNPLVQISSTDSAMEETRA* |
| JGIcombinedJ26739_1017544821 | 3300002245 | Forest Soil | FSTKYEDPDALELLNKTVKPVHAFNPLVQINTDNAQLEETRA* |
| JGI25382J37095_101835171 | 3300002562 | Grasslands Soil | LRGLWATVKAELSTKYNDSDALAMLNEPAKPVHSYNPLVQIQSDKSQLEETRA* |
| JGI25386J43895_101640982 | 3300002912 | Grasslands Soil | STSYADRDALEMLNEPVKPVHSYNPLVQIDTDKGQFEETHA* |
| JGI25617J43924_103238531 | 3300002914 | Grasslands Soil | AFAGRYEDSDALALLNEPAKPVHAFNPLVQINSNKTQLEETRA* |
| JGI25387J43893_10343711 | 3300002915 | Grasslands Soil | STRYQDSDALAMLNEPARPVHSYNPLVQIQADKSQVEETRA* |
| Ga0062385_104671841 | 3300004080 | Bog Forest Soil | MKATFTTDYADADAMEMLKEPVKPLHAFNPLVQINTTKNQMEESRA* |
| Ga0058905_15278662 | 3300004138 | Forest Soil | TFSGQYKDPDALSLLNEPAKPVHAFNPLVQIDANKAQFEETRA* |
| Ga0066396_100521172 | 3300004267 | Tropical Forest Soil | KASFSTKYEDPGALALLNEPVKPVHAFNPLVQIQSADSQLEESRA* |
| Ga0062595_1006311231 | 3300004479 | Soil | KATFGGAYKDDEALRMLNERVKPVHAFDPLVQINTQNAPLEETRA* |
| Ga0058899_121823832 | 3300004631 | Forest Soil | FSTKYEDPDAIALLNEPVKPVHAFNPLVQISSSDNAQMEETRA* |
| Ga0066672_107685171 | 3300005167 | Soil | SSWRGLWDTVKASLSTSYSDPDALAMLNVPVKPVHSYNPLVQIQSDKGQLEETRA* |
| Ga0066678_102786351 | 3300005181 | Soil | LWATAKAALSTKYEDPDALAMLNEPVKPVHSYNPLVQIDAGKSQLEETRA* |
| Ga0066676_110290702 | 3300005186 | Soil | LWATIKAGLTTRYRDPDALDMLDEPVKPVHAFNPLVQIEAGKTQMEETRA* |
| Ga0066388_1021173641 | 3300005332 | Tropical Forest Soil | KATFSSGYRDPDALMMLKEPVKPVHSYNPLIQIDTAKSQFEETRA* |
| Ga0066388_1024491901 | 3300005332 | Tropical Forest Soil | STTYADSDALAMLNEPVKPVHSYNPLVQIDTSKSQFEETHA* |
| Ga0066388_1083328781 | 3300005332 | Tropical Forest Soil | RAAFSFRYRDALALELLDEPVHPVHSFNPLVQIEPGKTPMEQTRA* |
| Ga0070709_106062081 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | FSGTYKDPDAVALLSEPAKPVHAYNPLVQIHSGDKAQMEETRA* |
| Ga0070713_1004777483 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | YKDPDAVALLSEPAKPVHAYNPLVQIHSGDKAQMEETRA* |
| Ga0070711_1013381251 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | TTTYRDPDALDMLEEPVKPVHAFNPLVQIEAGKTQMEETRV* |
| Ga0066689_102201041 | 3300005447 | Soil | ELSTKYNDSDALAMLNEPVKPVHSYNPLVQIQSDKSQIEETRA* |
| Ga0070685_104034211 | 3300005466 | Switchgrass Rhizosphere | TTYGDQGAFEMLNEPVRPVHSYNPLIQIETGKSQMEETRA* |
| Ga0070706_1009343732 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | LWATIKAGLTTTYRDPDALDMLNEPVKPVHAFNPLVQIEAGKTQMEETRA* |
| Ga0070699_1005277623 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | EYEDSDALAMLNEATKPVHAYNPLVQINSGGKSQLEETRA* |
| Ga0070730_100589836 | 3300005537 | Surface Soil | FSGLRGIWETVKAELTTTYADPDALAMLNEPVKPVHSYNPLIQIETGKGQFEETRV* |
| Ga0070730_104120602 | 3300005537 | Surface Soil | FSGLRGIWETVKAELTTTYADPDALAMLNEPVKPVHSYNPLIQIETGNGQFEETRV* |
| Ga0070693_1002902273 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | AFSGEYHDPDALSLLNEPVKPVHAYNPLVQINSSKNQLEETRA* |
| Ga0066692_100370161 | 3300005555 | Soil | TVKAELSTKYNDSDALAMLNEPAKPVHSYNPLVQIQSDKSQLEETRA* |
| Ga0066692_106244532 | 3300005555 | Soil | LRGLWATIKAELSTKYHDSDALTMLNEPVKPVHSYNPLVQIHADKGQLEETRA* |
| Ga0066692_109658172 | 3300005555 | Soil | WATVKAELSTKYEDSDALAMLNEPVKPVHSYNPLVQIQADKNQFEETRA* |
| Ga0066707_103873461 | 3300005556 | Soil | ELSTKYKDSDALAMLNEPAKPVHSYNPLVQIQADKSQLEETRA* |
| Ga0066670_100913035 | 3300005560 | Soil | KASLSTTYSDPDALAMLNEPVKPVHSYNPLVQIETSKGQFEENHA* |
| Ga0066670_103833541 | 3300005560 | Soil | STKYDDPDALAMLNEPVKPVHSYNPLVQIQADKSQLEETRA* |
| Ga0066694_104668172 | 3300005574 | Soil | WQTVKAMLHTTYADPDAAALLNEPAKPVHAFNPLVQIESSKTQMEETRA* |
| Ga0066702_105416801 | 3300005575 | Soil | YQDDDALQMLNEPVRPVHAFNPLVQIDTSKGQFEETRA* |
| Ga0066708_106411342 | 3300005576 | Soil | GLWATVKAELSTKYDDSDALAMLNEPVKPVHSYNPLVQIQADKSQLEETRA* |
| Ga0070763_109239551 | 3300005610 | Soil | PDAIALLNEPVKPVHAFNPLVQISSSDNAQMEETRA* |
| Ga0066903_1076675542 | 3300005764 | Tropical Forest Soil | WATIKASLSTTYADPDALALLNEPVKPVHSYNPLVQIDTGKGQFEETRA* |
| Ga0066651_104663271 | 3300006031 | Soil | TTYSDPDAFAMLDEPVKPVHSYNPLVQIETGKGQFEETHV* |
| Ga0075019_105659201 | 3300006086 | Watersheds | AGLWATVKAEFSTKYVDADALVMLNEPVKPVHSHNPLVQIQAGKNQMEETRA* |
| Ga0070715_103263932 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | KSGFSTTYADVDALEMLNEPVKPVHAFNPLVQIEASKSQLEETRA* |
| Ga0075018_107776842 | 3300006172 | Watersheds | ATVKAELSTKYDDSDALAMLNEPAKPVHSYNPLVQIQSDKNQLEETRA* |
| Ga0070712_1004331821 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | TYADQDALEMLNEPVRPVHSFNPLVQIETGKSQMEETRA* |
| Ga0070765_1001400535 | 3300006176 | Soil | GNYEDADALQMLNEPVKPVHAFNPLVQISSNDSAMEETRA* |
| Ga0070765_1018856951 | 3300006176 | Soil | FATIKATFSGNYADPDALALLNEPTKPVHSYNPLIQIDKGKSQLEETRA* |
| Ga0075021_103578483 | 3300006354 | Watersheds | KYNDADALAMLNEPAKPVHSYNPLVQIQSEKNQLEETRA* |
| Ga0075021_109831322 | 3300006354 | Watersheds | DPDALAMLNEPAKPVHSYNPLVQIQSDKSQLEETRA* |
| Ga0066658_109150091 | 3300006794 | Soil | SGLRGLWATVKAELSTKYNDADALAMLHEPVKPVHSYNPLVQIQSDKNQLEETRA* |
| Ga0066665_108672352 | 3300006796 | Soil | GLWATVKAELSTKYNDSDALAMLNEPVKPVNSYNPLVQIQSDKGQLEETRA* |
| Ga0079221_102074774 | 3300006804 | Agricultural Soil | ADRDALALLNEPTKPVHSFNPLVQIDSAKGQFEETRA* |
| Ga0079220_107606502 | 3300006806 | Agricultural Soil | LWATIKASLSTTYADSDALAMLNEPAKPVHSYNPLVQIDPGNGQFEETHV* |
| Ga0075425_10003636211 | 3300006854 | Populus Rhizosphere | DALATLNEPVRPVHSYNPLVQIEAGKGEFEETRV* |
| Ga0075424_1012963133 | 3300006904 | Populus Rhizosphere | YADQDALEMLNEPVQPVHSFNPLVQIETGKSQMEETRA* |
| Ga0075436_1006736382 | 3300006914 | Populus Rhizosphere | KAMFNTNYADPDAVAMLNEPVKPVHAFNPLIQIESSKTQMEETRA* |
| Ga0079219_117441302 | 3300006954 | Agricultural Soil | DPDALAMLNEPVKPVHSYNPLVQIEPGKGQFEETRA* |
| Ga0099791_101337461 | 3300007255 | Vadose Zone Soil | AELSTKYNDSDALAMLNETVKPVHSYNPLVQIQADKSQLEETRA* |
| Ga0099794_103188751 | 3300007265 | Vadose Zone Soil | ALSTKYEDPDALAMLNEPAKPVHSYNPLVQIDAGKSQLEETRA* |
| Ga0099794_104483941 | 3300007265 | Vadose Zone Soil | DDPDALAMLNEPIKPVHSYNPLVQIDAGKSQLEETRA* |
| Ga0099794_107318412 | 3300007265 | Vadose Zone Soil | SDALAMLNETVKPVHSYNPLVQIQADKSQLEETRA* |
| Ga0066710_1013512603 | 3300009012 | Grasslands Soil | KASFSGKYEDNDALALLNEPVKPVHAFNPLVQIDTNGGQFEETHA |
| Ga0099828_101035681 | 3300009089 | Vadose Zone Soil | NDSDALAMLNEPVKPVHSYNPLVQIQSDKSQLEETRA* |
| Ga0099828_109691493 | 3300009089 | Vadose Zone Soil | DALAMLNDPVKPVHSYNPLVQIQSDKSQLEETRA* |
| Ga0066709_1005099671 | 3300009137 | Grasslands Soil | GALEMLNEPVKPVHAFNALVQINTQNAPREETRS* |
| Ga0105237_122300412 | 3300009545 | Corn Rhizosphere | VKEEFSTTYADQDALEMLNEPVRPVHSFNPLVQIETGKSQMEETRA* |
| Ga0126384_102574541 | 3300010046 | Tropical Forest Soil | YDDADALQMLNEPVKPVHAFNPLVQISSTSSAMEETRA* |
| Ga0126373_107935892 | 3300010048 | Tropical Forest Soil | SGLRGLLAHVKASLRATYSDPGALALLNEPVKPVHSYNPMVQIETHKGQFGETHA* |
| Ga0126373_120149631 | 3300010048 | Tropical Forest Soil | DPDALAMLNEPVKPVHSYNPLVQIEPSKGQFEETRV* |
| Ga0099796_101510681 | 3300010159 | Vadose Zone Soil | RYEDSDALALLNEPTKPVHTYNPLVQINSGSKSQLEETRA* |
| Ga0099796_102964391 | 3300010159 | Vadose Zone Soil | TTYADAEALEMLNEPAKPVHAFNPLVQIEASKTQMEET* |
| Ga0134111_103420811 | 3300010329 | Grasslands Soil | IWATVKASLSTTYSDPDAFAMLDEPVKPVHSYNPLVQIETGKGQFEETHV* |
| Ga0134080_105316801 | 3300010333 | Grasslands Soil | TYADPDAVALLNEPAKPVHAFNPLVQIESSKTQMEETRA* |
| Ga0126370_105842193 | 3300010358 | Tropical Forest Soil | TKNEDHEALRMLNEPVAPVHSYNPLVQIDAKTNKLEETRA* |
| Ga0126376_105025321 | 3300010359 | Tropical Forest Soil | LNSVYRDNEALEMLSEPVKPVHAFNPLIQIEAAKSQMEETRA* |
| Ga0126372_109578623 | 3300010360 | Tropical Forest Soil | GFGGLWAAARAAFSFRYHDAGALELLEEPVHPVHSFNPLVQIEPGKTPMEETRA* |
| Ga0126378_120387571 | 3300010361 | Tropical Forest Soil | VKAEFSADYADAGALEMLNEPVRPVHSFNPLVQIETGKAQMEQTRA* |
| Ga0126379_109608651 | 3300010366 | Tropical Forest Soil | KASLSTTYADPNALALLNEPVKPVHSYNPLVQIDTGKGQFEETRA* |
| Ga0126383_105972351 | 3300010398 | Tropical Forest Soil | KGEFNKSYADPDAVALLNEPVCPVHSFNPLVQIETGETQMEESRA* |
| Ga0126383_112799833 | 3300010398 | Tropical Forest Soil | LWQYIKAALDGVYKDPDALALLNEPVKPVHAFNPLVQIESTKTQMEQTRA* |
| Ga0150983_104605962 | 3300011120 | Forest Soil | ATIKATFSGNYADSDALALLNEPAKPVHSYNPLVQIEATKGQFEETSA* |
| Ga0150983_112738962 | 3300011120 | Forest Soil | TKSAFAGKYEDSGALAMLNEPAKPVHAFNPLVQINSSKTQLEETRA* |
| Ga0150983_115815702 | 3300011120 | Forest Soil | AELSTKYDDSDALAMLNEPAKPVHSYNPLVQIQSDKSQLEETRA* |
| Ga0150983_119840082 | 3300011120 | Forest Soil | PDSDALALLNEPAKPVHSYNPLIQIDKGKSQLEETRA* |
| Ga0150983_160044281 | 3300011120 | Forest Soil | DSDALDLLNEPTKPVHSYNPLIQIDKCKSQLEETRA* |
| Ga0150983_163945362 | 3300011120 | Forest Soil | DALALLNEPAKPVHSYNPLIQIDKGKSQLEETRA* |
| Ga0137392_104114091 | 3300011269 | Vadose Zone Soil | ASLSTKYDDPGALAMLNEPVKPVHSYNPLVQINAAKGEFGETRA* |
| Ga0137391_107207962 | 3300011270 | Vadose Zone Soil | SYKDPDALALLNEPAKPVHTYNPLVQINSSGKTQLEETPA* |
| Ga0137393_104764351 | 3300011271 | Vadose Zone Soil | ELSTKYSDPDALAMLNEPSIPVHSYNPLVQIQSDKNQLEETRA* |
| Ga0137393_107357243 | 3300011271 | Vadose Zone Soil | YADPDAAAMLNEPVRPVHSFNPLVQIESPKSQMEESRA* |
| Ga0137393_107438071 | 3300011271 | Vadose Zone Soil | DSDALAMLNEPIQPVHSYNPLVQIQSDKTYLEETRA* |
| Ga0137393_116413182 | 3300011271 | Vadose Zone Soil | WATVKAELSTKYNDPDALAMLNEPVKPVHSYNPLVQIQSDKSQLEETRA* |
| Ga0137388_109966202 | 3300012189 | Vadose Zone Soil | ASLSTKYDDPGALAMLNEPVKPVHSYNPLVQINATKGEFGETHA* |
| Ga0137383_106104901 | 3300012199 | Vadose Zone Soil | ASLSTKYDDPGALAMLNEPVKPVHSYNPLVQINAAKGEFEETRA* |
| Ga0137363_105866442 | 3300012202 | Vadose Zone Soil | WATVKAELSTKYADSDALAMLNEPVKPVHSYNPLVQIQSDKTQLEETRA* |
| Ga0137363_107549942 | 3300012202 | Vadose Zone Soil | RGLWATAKAALSTKYEDPDALAMLNEPAKPVHSYNPLVQIDAGKSQLEETRA* |
| Ga0137363_115704151 | 3300012202 | Vadose Zone Soil | DPDALAMLNEPVKPVHSYNPLVQIDAGKNQLEETRA* |
| Ga0137399_105837712 | 3300012203 | Vadose Zone Soil | LWATIKSELKTKYTDADALEMLNEPVQPVHAFNPLVQIEAGKSQMEETRA* |
| Ga0150985_1203979452 | 3300012212 | Avena Fatua Rhizosphere | AKATFAGNYEDTGALEMLNEPVKPVHAFNPLVQINAQNAPLEETRV* |
| Ga0137387_101291101 | 3300012349 | Vadose Zone Soil | AELSTRYADQDALAMLREPVKPVHSYNPLVQIQADKSQLEETRA* |
| Ga0137386_106776211 | 3300012351 | Vadose Zone Soil | DALAMLNEPVKPVHSYNPLVQIQSDKSQLEETRA* |
| Ga0137384_113045611 | 3300012357 | Vadose Zone Soil | DALDMLDEPVKPVHAFNPLVQIEAGNTQMEETRV* |
| Ga0137361_110473171 | 3300012362 | Vadose Zone Soil | TTYADADALEMLSEPVKPVHAFNPLVQIEASKTQMEETRA* |
| Ga0137361_116989332 | 3300012362 | Vadose Zone Soil | TYADPDALEMLNEPVKPVHAFNPLVQIEANKTQMEETRA* |
| Ga0137358_100221691 | 3300012582 | Vadose Zone Soil | AELSTKYDDRDALAMLNEPVKPVHSYNPLVQIQADKNQLEETRA* |
| Ga0137358_109315812 | 3300012582 | Vadose Zone Soil | KYVDADALALLNEPSKPVHAYNPLVQIDSGNGQLTETRV* |
| Ga0137398_103526643 | 3300012683 | Vadose Zone Soil | LWATIKAELSTKYDDADALAMLNEPVKPVHSYNPLVQIQSDKNQLEETRA* |
| Ga0137398_108274012 | 3300012683 | Vadose Zone Soil | ELSTKYNDSDALAMLNEPAKPVHSYNPLVQIQSDKGQLEETRA* |
| Ga0137395_104509811 | 3300012917 | Vadose Zone Soil | DPDAVALLNEPVQPVHAFNPLVQIESSKTQMEETRA* |
| Ga0137396_100725761 | 3300012918 | Vadose Zone Soil | YNDSDALAMLNEPVKPVHSYNPLVQIQADKSQLEETRA* |
| Ga0137396_103938151 | 3300012918 | Vadose Zone Soil | TVKAELSTKYNDADALAMLNEPVKPVHSYNPLVQIQSGKNQLEETRA* |
| Ga0137413_106738272 | 3300012924 | Vadose Zone Soil | TRYEDPDALALLNEPIKPVHAFNPLVQISSTDHAQMEETRA* |
| Ga0137419_101778914 | 3300012925 | Vadose Zone Soil | LRGLWATVKAELSTKYNDSDALAMLNAPVKPVHSYNPLVQIQSDKSQLEETRA* |
| Ga0137419_106903042 | 3300012925 | Vadose Zone Soil | SDALALLNEPTKPVHAFNPLVQINSGSKSQLEETRA* |
| Ga0137407_100342891 | 3300012930 | Vadose Zone Soil | SGLGGLWATIKAGLTTTYRDPDALDMLNEPVKPVHAFNPLVQIAAGKTQMEETRV* |
| Ga0137407_101820525 | 3300012930 | Vadose Zone Soil | EDSDALALLNEPTKPVHTYNPLVQINSGSKSQLEETRA* |
| Ga0137407_119837721 | 3300012930 | Vadose Zone Soil | ADALEMLNEPVQPVHAFNPLVQIEAGKSQMEETRA* |
| Ga0153915_115402882 | 3300012931 | Freshwater Wetlands | WATVKASLSTTYADPDALAMLSEPAKPVHSFNPLVQIETNKSQLEETRA* |
| Ga0137410_100059861 | 3300012944 | Vadose Zone Soil | SDALAMLNEPAKPVHSYNPLVQIQSDKNQLEETRA* |
| Ga0126369_113164683 | 3300012971 | Tropical Forest Soil | GLWQYIRAALDGVYKDPDAVALLNEPVKPVHAFNPLVQIESTRTQMEQTRA* |
| Ga0126369_125604471 | 3300012971 | Tropical Forest Soil | TTYTDPDALEMLDEQVRPVHSFNPLVQIKTGKTEMEETRA* |
| Ga0164307_114677372 | 3300012987 | Soil | DDEALRMLNEPVKPVHAFNPLVQITANNSQLEETRA* |
| Ga0134075_104414362 | 3300014154 | Grasslands Soil | LWATMKASLSTSYADRDALEMLNEPVKPVHSYNPLVQIDTDKGQFEETHA* |
| Ga0134078_101374202 | 3300014157 | Grasslands Soil | LSTTYSDPDALAMLHEPAKPVHSYNPLVQIEPGKGQFEETRA* |
| Ga0137414_10377583 | 3300015051 | Vadose Zone Soil | SDALAMLNEPTQPVHSYNPLVQIQSDKSQLEETRA* |
| Ga0137405_14161515 | 3300015053 | Vadose Zone Soil | MKAGLMTTYADPDALEMLNEPVKPVHAFNPLVQIESSKAQMEETRA* |
| Ga0167643_10185433 | 3300015089 | Glacier Forefield Soil | VKATLSTTYDDRDALSLLEEPTKPVHAFNPLVQIQTRDAQMEETRA* |
| Ga0132257_1000687401 | 3300015373 | Arabidopsis Rhizosphere | ELSITYADQDALEMLNEPVRPVHSFNPLVQIETGKGQMEETRA* |
| Ga0182041_110470732 | 3300016294 | Soil | LFTKNQDDEALRMLNEPAKPVHSYNPLVQIDRNPSKFEETRA |
| Ga0182040_119359691 | 3300016387 | Soil | PDPDALAMLNEPVRPVHSYNPLVQIETSEGNFGETHA |
| Ga0182038_110182791 | 3300016445 | Soil | DYADPDALAMLKEPVKPVHSYNPLIQIDTAKSQFEETHA |
| Ga0187802_101841442 | 3300017822 | Freshwater Sediment | TNYLDPDALAMLNEPVKPVHSYNPLVQIEPDKTQLEESRA |
| Ga0187821_103968842 | 3300017936 | Freshwater Sediment | KASLSAAYEDADALLLLNEPVTPVHSYNPLVQIDSGKTQMEETRA |
| Ga0187766_104710651 | 3300018058 | Tropical Peatland | AGALELLNEKVKPVHSYNPLVQIDAEPAKLEGTRP |
| Ga0066662_104290223 | 3300018468 | Grasslands Soil | GLRGLWATVKAELSTKYNDSDALAMLNEPTQPVHSYNPLVQIQSDKSQLEETRA |
| Ga0066662_104640421 | 3300018468 | Grasslands Soil | LKLLNEPVHPVHSYNPLVQINAQISGQMGESPSQLEETRA |
| Ga0066662_120332551 | 3300018468 | Grasslands Soil | EAALERLNEPVDPVHAYSPLVQIETTASQLEGTRA |
| Ga0137408_11689101 | 3300019789 | Vadose Zone Soil | SGLGGLWATIKAGLTTAYRDPDALDMLDEPVKPVHAFNPLVQIEAGKTQMEETRA |
| Ga0193713_10442994 | 3300019882 | Soil | YDDPDALATLNEPVKPVHSYNPLVQIEAGKSQLEETRA |
| Ga0179592_103853751 | 3300020199 | Vadose Zone Soil | GLWATIKSGLSTTYADADALEMLNEPVKPVHAFNPLVQIEASKTQMEETRA |
| Ga0179592_104280372 | 3300020199 | Vadose Zone Soil | TYTDPDAVALLNEPVKPVHAFNPLVQIESPKTQMEETRA |
| Ga0179592_104940951 | 3300020199 | Vadose Zone Soil | ELSTKYSDPDALAMLNEPSKPVHSYNPLVQIQSDKNQLEETRA |
| Ga0210407_100578071 | 3300020579 | Soil | GLWATVKASLSTTYPDPDALAMLNEPVKPVHSYNPLVQIDSGKSQLEETRA |
| Ga0210407_101461321 | 3300020579 | Soil | KDPDALALLHEPSKPVHAYNPLVQINSGGKTQLEETRA |
| Ga0210407_104077553 | 3300020579 | Soil | NYEDADALALLNEPAKPVHSYNPLVQIEAGKTQLEETRA |
| Ga0210407_108284212 | 3300020579 | Soil | DSDALAMLNEPAKPVHSYNPLIQIDKGKSQLEETSA |
| Ga0210403_104994231 | 3300020580 | Soil | GQYEDPDAVAMLREPVKPVHSYNPLVQIDAGKSQLEETRA |
| Ga0210399_108302531 | 3300020581 | Soil | TLQYADSDALAMLNEPAKPVHSYNPLIQIDKGKSQLEETSA |
| Ga0210395_103370703 | 3300020582 | Soil | ATFATTYEDPDALTLLNEPVKPVHAFNPLVQIRTDSGQMEETRA |
| Ga0210401_106448632 | 3300020583 | Soil | QYEDSDALAMLNEPAKPVHAYNPLVQINSGGKSQLEETRA |
| Ga0215015_100233961 | 3300021046 | Soil | DRYKDPDALALLNEPAKPAHAYNPLVQIQADKGQMEETRA |
| Ga0215015_107046671 | 3300021046 | Soil | TIKSGLSTTYADADALEMLNEPVKPVHAFNPLVQIEASKTQMEETRA |
| Ga0215015_109367842 | 3300021046 | Soil | STTYADPDALELLNEPVKPVHSYNPLVQIDPGKTQLEETRA |
| Ga0179596_104032182 | 3300021086 | Vadose Zone Soil | STKYNDSDALAMLNEPAKPVHSYNPLVQIQSEKNQLEETRA |
| Ga0210406_108746701 | 3300021168 | Soil | LSGKYEDADALALLNEPSKPVHAYNPLVQIDSGNGQLTETRV |
| Ga0210406_110939832 | 3300021168 | Soil | IKATFAGQYEDPDAVAMLREPVKPVHSYNPLIQIDAGKSQLEETRA |
| Ga0210405_107700831 | 3300021171 | Soil | NYADPDAMDLLNEPVKPVHSYNPLIQIDTGKSQLEETRA |
| Ga0210408_109378691 | 3300021178 | Soil | ASIKAEFSTKYADPDALAMLNEPVKPVHSYNPLVQIDSGESQMEETRA |
| Ga0210385_107170412 | 3300021402 | Soil | ATFSGRYADQDALALLNEPTNPVHSYNPLIQIDTGKSQLEETRA |
| Ga0210389_100869991 | 3300021404 | Soil | IKATFSGRYADPDAMALLNEPVKPVHSYNPLIQIEKGKSQLEETRA |
| Ga0210387_105180391 | 3300021405 | Soil | YADPDALALLNEPTKPVHSYNPLIQIDKGKSQLEETRA |
| Ga0193695_10573371 | 3300021418 | Soil | MTTYADPDALEMLNEPVKPVHAFNPLVQIESSKVQMEETRA |
| Ga0210384_100632401 | 3300021432 | Soil | STKYDDADALAMLNELVTPVHSYNPLVQIQSGKNQLEETRA |
| Ga0210384_104377181 | 3300021432 | Soil | SGLRGLWATVKAELSTKYNDSDALAMLNEPVKPVHSYNPLVQIQSDKGQLEETRA |
| Ga0210384_108382881 | 3300021432 | Soil | LWATVKAELSTKYNDGDALAMLNEPSKPVHSYNPLVQIQSDKNQLEETRA |
| Ga0210390_103596853 | 3300021474 | Soil | TYEDPDALALLNEPVKPVHAFNPLVQIRTDSAQMEETRA |
| Ga0210409_103268621 | 3300021559 | Soil | KYNDADALAMLNEPVKPVHSYNPLVQIRSEKSQLEETRA |
| Ga0210409_108387382 | 3300021559 | Soil | FTTDYADADAMEMLKEPVKPVHAFNPLVQINTTKNQMEESRA |
| Ga0210409_108609911 | 3300021559 | Soil | DDSDALAMLNEPAKPVHSYNPLVQIQSDKSQLEETRA |
| Ga0242648_10456642 | 3300022506 | Soil | LRGLWATVKAELSTKYNDSDALAMLNETVKPVHSYNPLVQIQSEKSQLEETRA |
| Ga0242671_10473722 | 3300022714 | Soil | SDALALLNETAKPVHSYNPLIQIDKGKSQLEETRA |
| Ga0242654_101968631 | 3300022726 | Soil | DSDALAMLNEPVKPVHSYNPLVQIQSDKGHLEETGA |
| Ga0247693_10344682 | 3300024181 | Soil | DQDALEMLNEPVRPVHSFNPLVQIETGKGQMEETRA |
| Ga0247691_10202603 | 3300024222 | Soil | AMFNANYTDPDAVAVLNEPVQPVHAFNPLVQIESPKAQMEETRA |
| Ga0179589_100695974 | 3300024288 | Vadose Zone Soil | TFSGLGGLWATIKSGLSTTYADADALEMLNEPVKPVHAFNPLIQIEASKTQMEETRA |
| Ga0247667_10387772 | 3300024290 | Soil | PDALALLNEPAKPVHAYNPLIQISKDKSQLEESRA |
| Ga0137417_11092413 | 3300024330 | Vadose Zone Soil | STKYNDSDALAMLNEPVKPVHSYNPLVQIQSDKGQLEETRA |
| Ga0137417_11891631 | 3300024330 | Vadose Zone Soil | KAELSTKYNDSDALAMLNEPVKPVHSYNPLVQIQSDKGQLEETRA |
| Ga0207710_103242702 | 3300025900 | Switchgrass Rhizosphere | FSTTYGDQGAFEMLNEPVRPVHSYNPLIQIETGKSQMEETRA |
| Ga0207685_103889641 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | KSGFSTTYADVDALEMLNEPVKPVHAFNPLVQIEASKSQLEETRA |
| Ga0207684_107720451 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | LGGLWATIKAGLTTTYRDPDALDMLNEPVKPVHAFNPLVQIEAGKTQMEETRA |
| Ga0207671_106189381 | 3300025914 | Corn Rhizosphere | ADQDALEMLNEPVRPVHSFNPLVQIETGKSQMEETRA |
| Ga0207646_108637901 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | TVKASLSAAYEDADALLLLNEPVKPVHSYNPLVQIDSGKTQMEETRA |
| Ga0207665_100493251 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | VDADALALLNEPSKPVHAYNPLVQIDSGNGQLTETRV |
| Ga0207676_122038882 | 3300026095 | Switchgrass Rhizosphere | YADQDALEMLNEPVRPVHSFNPLVQIETGKSQMEETRA |
| Ga0209890_100768111 | 3300026291 | Soil | TAKATFSGKYEDADALAMLNEPSKPVHAYNPLVQIDSSKGQLTETRA |
| Ga0209238_10121081 | 3300026301 | Grasslands Soil | AELSTKYNDSDALAMLNEPAMPVHSYNPLVQIQSGKSQLEETRA |
| Ga0209055_11543242 | 3300026309 | Soil | KYDDPDALAMLNEPVKPVHSYNPLVQIQADKSQLEETRA |
| Ga0209055_12964171 | 3300026309 | Soil | DPDALAMLNEPVKPVHSYNPLVQIQADKSQLEETHA |
| Ga0209239_13240811 | 3300026310 | Grasslands Soil | SDALAMLNEPAKPVHSYNPLVQIQADKSQLEETRA |
| Ga0209153_12011311 | 3300026312 | Soil | TRYQDSDALAMLNEPARPVHSYNPLVQIQADKSQPEETRA |
| Ga0209154_10295511 | 3300026317 | Soil | GGLWATVKAELSTKYNDSDALAMLNEPVKPVHSYNPLVQIQSDKSQIEETRA |
| Ga0209802_10680534 | 3300026328 | Soil | GFWATVKASLSAKYDDPGALAMLDEPVKPVHSYNPLVQINAAKGEFEETRA |
| Ga0209802_11196233 | 3300026328 | Soil | RGLLATIRAELSTKYEDSDALAMLNEPVKPVHSYNPLVQIQADKNQFEETRA |
| Ga0209375_11948481 | 3300026329 | Soil | DPDAFAMLDEPVKPVHSYNPLVQIETGKGQFEETHV |
| Ga0209057_10258447 | 3300026342 | Soil | STKYKDSDALAMLNEPAKPVHSYNPLVQIQADKSQLEETRA |
| Ga0209057_10742434 | 3300026342 | Soil | YSDPDALAMLHEPVKPVHSYNPLVQIEPGKGQLEETRA |
| Ga0257163_10600561 | 3300026359 | Soil | STKYNDADALAMLNEPVKPVHSYNPLVQIQSGKNQLEETRA |
| Ga0257153_10827981 | 3300026490 | Soil | GLSGLWATIKSGLSTTYADADALEMLDEPVKPVHAFNPLVQIEASKTQLEETRA |
| Ga0209577_103920812 | 3300026552 | Soil | LRGLWATVKAELSTKYDDPDALAMLNEPVKPVHSYNPLVQIQADKSQLEETHA |
| Ga0179587_103804511 | 3300026557 | Vadose Zone Soil | LGGLWATIKSGLSTTYADADALEMLNEPVKPVHAFNPLVQIEASKTQMEETRA |
| Ga0207819_10095621 | 3300027024 | Tropical Forest Soil | NEDDEALRMLSEPVAPVHSFNPLVQIDSTSKNYEETRA |
| Ga0207761_10116815 | 3300027516 | Tropical Forest Soil | TKNEDREALLMLSEPVKPVHSYNPLVQIDANPANMEETRA |
| Ga0208985_10975512 | 3300027528 | Forest Soil | NFTTKYEDPDALALLHDPVKPVHAFNPLVQISTSDNAQMEETRA |
| Ga0209527_11034182 | 3300027583 | Forest Soil | NYADRDALALLNEPAKPVHSYNPLVQIEAPSRQAEESRV |
| Ga0209220_11762351 | 3300027587 | Forest Soil | WATVKAELSTKYNDSDALAMLNEPVKPVHSYNPLVQIQSDKGQLEETRA |
| Ga0209331_10746031 | 3300027603 | Forest Soil | KYEDSDALAMLNEPAKPVHAFNPLVQINSSKTQLEETRA |
| Ga0209217_10167481 | 3300027651 | Forest Soil | ATFSGSYNDPEALTLLNETATPVHAFNPLVQINASGKTQLEETRA |
| Ga0209588_10402644 | 3300027671 | Vadose Zone Soil | WATVKAELSTKYNDSDALAMLNEPTQPVHSYNPLVQIQSDKSQLEETRA |
| Ga0209588_11066001 | 3300027671 | Vadose Zone Soil | GLRGLWATVKAELSTDYNDSDALAMLNEPAKPVHSYNPLVQIQSDKSQLEETRA |
| Ga0209118_10596101 | 3300027674 | Forest Soil | LSTKYDDPDALAMLNEPVKPVHSYNPLVQIDAGKSQLEETRA |
| Ga0209011_10492651 | 3300027678 | Forest Soil | AKQFHEDADALALLNEPSKPVHAYNPLVQIDSSNGQLTETRV |
| Ga0209073_103326602 | 3300027765 | Agricultural Soil | GDPDALAMLNEPVKPVHSYNPLVQIEPGKGQFEETRA |
| Ga0209177_104809121 | 3300027775 | Agricultural Soil | DPDALAMLNEPVKPVHSYNPLVQIEPGKGQFEETRA |
| Ga0209180_100761911 | 3300027846 | Vadose Zone Soil | LSTRYNDSDALAMLNEPVKPVHSYNPLVQIQSDKSQLEETRA |
| Ga0209701_106247492 | 3300027862 | Vadose Zone Soil | KAELSTKYNDSDALAMLNEPVKPIHSYNPLVQIQSDKGQLEETRA |
| Ga0209283_102734671 | 3300027875 | Vadose Zone Soil | SDALSMLNEPAKPVHSYNPLVQIHADKSQLEETRA |
| Ga0209068_105990141 | 3300027894 | Watersheds | SDALAMLNEPAKPVHSYNPLVQIQSDKNQLEETRA |
| Ga0209488_102210364 | 3300027903 | Vadose Zone Soil | AELSTKYDDADALAMLNEPVKPVHSYNPLVQIQSDKNQLEETRA |
| Ga0209526_103720212 | 3300028047 | Forest Soil | EDPDALAMLNEPAKPVHAYNPLVQINSSKTQLEETRA |
| Ga0209526_108323941 | 3300028047 | Forest Soil | LSGKYEDADALALLNEPSKPVHAYNPLVQIDSSNGQLTETRV |
| Ga0137415_105529381 | 3300028536 | Vadose Zone Soil | VKAGFSTTYADSDALELLNEPVKPVYSYNPLVQIDSSETQLEETRA |
| Ga0137415_114586132 | 3300028536 | Vadose Zone Soil | TVKATFSGAYADADALAMLNEPTKPVHAYNPLVQIEANKSQLEETRA |
| Ga0302224_100734683 | 3300028759 | Palsa | EASAVDYTLSLRGLWAAAKAGLSGGYQDPDALALLNEPVKPVHAFNPLVQIQSPGAQMEETRA |
| Ga0307504_102107461 | 3300028792 | Soil | AALSTKYDDPDALAMLNEPVKPVHSYNPLVQIDAGKSQLEETRA |
| Ga0302227_102658411 | 3300028795 | Palsa | GGYQDPDALALLNEPVKPVHAFNPLVQIQSPGAQMEETRA |
| Ga0302222_100375044 | 3300028798 | Palsa | DYTLSLRGLWAAAKAGLSGGYQDPDALALLNEPVKPVHAFNPLVQIQSPGAQMEETRA |
| Ga0308309_110933121 | 3300028906 | Soil | LRGLFATIKATFSGNYADPDALALLNEPTKPVHSYNPLIQIDKGKSQLEETRA |
| Ga0308309_114635471 | 3300028906 | Soil | YEDADALQMLNEPVKPVHAFNPLVQISSTSSAMEETRA |
| Ga0222749_105196972 | 3300029636 | Soil | FSTKYADPDALAMLNEPVKPVHSYNPLVQIDSGESQMEETRA |
| Ga0310038_104170122 | 3300030707 | Peatlands Soil | STKYNDSDALAMLNEPAKPVHSYNPLVQIQADKNQLEETRA |
| Ga0075388_115753342 | 3300030848 | Soil | IKSGLSATYADADALEMLNEPVKPVHAFNPLVQIEAGKTQMEETRA |
| Ga0075386_107796421 | 3300030916 | Soil | ADALQMLNEPVKPVHAFNPLVQISSPDSAMEETRA |
| Ga0138296_11596921 | 3300030923 | Soil | GLGGLWATIKSGLSTTYADADALEMLNEAVKPVHAFNPLVQIEAGKTQMEETRA |
| Ga0138298_15429382 | 3300031015 | Soil | GLGGLWATIKSGLSTAYADADALEMLNEPVKPVHAFNPLVQIEASKTQMQETRA |
| Ga0138301_17568862 | 3300031022 | Soil | GGLWATIKSGLSTTYADTGALEMLNEPVKPVHAFNPLVQIEASKTQMEETRA |
| Ga0170823_157726561 | 3300031128 | Forest Soil | YADPDALEMLNEPVKPVHAFNPLVHIEASKTPMEETRA |
| Ga0170820_116534771 | 3300031446 | Forest Soil | GLWATIKSGMSRTYADADALEMLNEPVKPVHAFNPLVQIEAGKTQMEETRA |
| Ga0170819_128514711 | 3300031469 | Forest Soil | SGKYEDADALALLNEPSKPVHAYNPLVQIDSSNSQLTETRV |
| Ga0170818_1151869862 | 3300031474 | Forest Soil | SGLSTTYADADALEMLNEPVKPVHAFNPLVQIEASKTQMEETRA |
| Ga0302326_1000891221 | 3300031525 | Palsa | EDSEALSLLNEPAKPVHSYNPLVQIAESKAQLEETHA |
| Ga0306917_106857581 | 3300031719 | Soil | TRNEDDEALRMLNEPVKPVHSYNPLVQIDGNPSKFEETRA |
| Ga0306917_108867431 | 3300031719 | Soil | FTVNEDDEALRMLKEPVKPVHSYNPLVQIDRNPSKFEETRA |
| Ga0306917_113103682 | 3300031719 | Soil | FGSYLDSGAKALLEEPVKPVHSYNPLVQIETPNKLEETRA |
| Ga0307469_107994572 | 3300031720 | Hardwood Forest Soil | YEDSNALALLNEPAKPVHAFNPLIQIASNNNQMEETRA |
| Ga0307468_1012296561 | 3300031740 | Hardwood Forest Soil | WQTIKATFGGTYADPDAATLLNEPVHPVHAFNPLVQIESSKSQLEETRA |
| Ga0306918_109874961 | 3300031744 | Soil | LFTRNEDDEALRMLNEPVKPVHSYNPLVQIDGNPSKFEETRA |
| Ga0307475_111879181 | 3300031754 | Hardwood Forest Soil | ELKTKYSDADALEMLNEPVQPVHAFNPLVQIEAGKSQMEETRA |
| Ga0307478_113770162 | 3300031823 | Hardwood Forest Soil | RGLFATIKATFSGRYADQDALALLNEPVKPVHSYNPLIQIDTGKSQLEETRA |
| Ga0306919_110661431 | 3300031879 | Soil | YADHDALEMLNEPARPVHSFNPLIQIETGKTRMEETHA |
| Ga0307479_110343091 | 3300031962 | Hardwood Forest Soil | EDSDALALLNEPTQPVHAYNPLVQINSGKSQLEETRA |
| Ga0307479_113873512 | 3300031962 | Hardwood Forest Soil | FAGRYEDSDALAMLNEPTQPVHAYNPLVQINSNKTQLEETRA |
| Ga0307479_119923012 | 3300031962 | Hardwood Forest Soil | PKYEDPDALALLNEPVKPVHAFNPLVQISRTNNAQMEETRA |
| Ga0307479_120981141 | 3300031962 | Hardwood Forest Soil | LWATIKAGLTTTYTDADALEMLDEPAKPVHAFNPLVQIEANKSQMEETRA |
| Ga0318532_101765301 | 3300032051 | Soil | EDDEALRMLNEPVKPVHSYNPLVQIDGNPSKFEETRA |
| Ga0311301_120372181 | 3300032160 | Peatlands Soil | DADALDMLNEPVTPVHSYNPLVQIQSDKSQLEETRA |
| Ga0307470_107587422 | 3300032174 | Hardwood Forest Soil | KNEDDEAYRMLNEPVRPVHSYNPLVQIDTPSNNLEETRA |
| Ga0307472_1023504862 | 3300032205 | Hardwood Forest Soil | ATIKAGLSTTYADADALEMLNEPVKPVHAFNPLVQIEAGKTQMEETRA |
| Ga0335082_108069143 | 3300032782 | Soil | DDEALRIMNEPVTPVHSFNPLVQIDTNSKKYEETRA |
| Ga0335084_101180171 | 3300033004 | Soil | DPDAVTLLNEPVKPVHAFNPLVQIDSSKAQTEQTSV |
| Ga0310914_107426843 | 3300033289 | Soil | DDEALRLLNEPVKPVHSYNPLVQIDDNPSKLEETRA |
| ⦗Top⦘ |