| Basic Information | |
|---|---|
| Family ID | F014279 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 264 |
| Average Sequence Length | 49 residues |
| Representative Sequence | MDHRIVFIAAGVALVVVIGYLLVMRVFFKESKELDKKIDYSKMKEWKDED |
| Number of Associated Samples | 210 |
| Number of Associated Scaffolds | 264 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 75.19 % |
| % of genes near scaffold ends (potentially truncated) | 23.48 % |
| % of genes from short scaffolds (< 2000 bps) | 89.77 % |
| Associated GOLD sequencing projects | 187 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.50 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (66.667 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (8.712 % of family members) |
| Environment Ontology (ENVO) | Unclassified (38.258 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (45.833 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 47.44% β-sheet: 0.00% Coil/Unstructured: 52.56% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.50 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 264 Family Scaffolds |
|---|---|---|
| PF01717 | Meth_synt_2 | 33.33 |
| PF02801 | Ketoacyl-synt_C | 14.77 |
| PF00691 | OmpA | 4.92 |
| PF13378 | MR_MLE_C | 2.65 |
| PF00593 | TonB_dep_Rec | 2.27 |
| PF02492 | cobW | 1.89 |
| PF01070 | FMN_dh | 1.89 |
| PF05359 | DUF748 | 1.52 |
| PF06808 | DctM | 0.76 |
| PF00768 | Peptidase_S11 | 0.76 |
| PF03480 | DctP | 0.76 |
| PF01464 | SLT | 0.38 |
| PF03466 | LysR_substrate | 0.38 |
| PF00015 | MCPsignal | 0.38 |
| PF01098 | FTSW_RODA_SPOVE | 0.38 |
| PF13231 | PMT_2 | 0.38 |
| PF12006 | DUF3500 | 0.38 |
| PF13181 | TPR_8 | 0.38 |
| PF03334 | PhaG_MnhG_YufB | 0.38 |
| PF04290 | DctQ | 0.38 |
| PF01494 | FAD_binding_3 | 0.38 |
| PF01095 | Pectinesterase | 0.38 |
| PF01487 | DHquinase_I | 0.38 |
| PF04475 | DUF555 | 0.38 |
| PF02754 | CCG | 0.38 |
| PF01041 | DegT_DnrJ_EryC1 | 0.38 |
| PF01979 | Amidohydro_1 | 0.38 |
| PF00550 | PP-binding | 0.38 |
| COG ID | Name | Functional Category | % Frequency in 264 Family Scaffolds |
|---|---|---|---|
| COG0620 | Methionine synthase II (cobalamin-independent) | Amino acid transport and metabolism [E] | 33.33 |
| COG1304 | FMN-dependent dehydrogenase, includes L-lactate dehydrogenase and type II isopentenyl diphosphate isomerase | Energy production and conversion [C] | 1.89 |
| COG0069 | Glutamate synthase domain 2 | Amino acid transport and metabolism [E] | 1.89 |
| COG2982 | Uncharacterized conserved protein AsmA involved in outer membrane biogenesis | Cell wall/membrane/envelope biogenesis [M] | 1.52 |
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.76 |
| COG0654 | 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases | Energy production and conversion [C] | 0.76 |
| COG0840 | Methyl-accepting chemotaxis protein (MCP) | Signal transduction mechanisms [T] | 0.76 |
| COG0710 | 3-dehydroquinate dehydratase | Amino acid transport and metabolism [E] | 0.38 |
| COG4677 | Pectin methylesterase and related acyl-CoA thioesterases | Carbohydrate transport and metabolism [G] | 0.38 |
| COG2873 | O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependent | Amino acid transport and metabolism [E] | 0.38 |
| COG2048 | Heterodisulfide reductase, subunit B | Energy production and conversion [C] | 0.38 |
| COG1885 | Uncharacterized conserved protein, UPF0212 family | Function unknown [S] | 0.38 |
| COG1320 | Multisubunit Na+/H+ antiporter, MnhG subunit | Inorganic ion transport and metabolism [P] | 0.38 |
| COG1104 | Cysteine desulfurase/Cysteine sulfinate desulfinase IscS or related enzyme, NifS family | Amino acid transport and metabolism [E] | 0.38 |
| COG0772 | Peptodoglycan polymerase FtsW/RodA/SpoVE | Cell cycle control, cell division, chromosome partitioning [D] | 0.38 |
| COG0665 | Glycine/D-amino acid oxidase (deaminating) | Amino acid transport and metabolism [E] | 0.38 |
| COG0644 | Dehydrogenase (flavoprotein) | Energy production and conversion [C] | 0.38 |
| COG0626 | Cystathionine beta-lyase/cystathionine gamma-synthase | Amino acid transport and metabolism [E] | 0.38 |
| COG0578 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 0.38 |
| COG0520 | Selenocysteine lyase/Cysteine desulfurase | Amino acid transport and metabolism [E] | 0.38 |
| COG0436 | Aspartate/methionine/tyrosine aminotransferase | Amino acid transport and metabolism [E] | 0.38 |
| COG0399 | dTDP-4-amino-4,6-dideoxygalactose transaminase | Cell wall/membrane/envelope biogenesis [M] | 0.38 |
| COG0247 | Fe-S cluster-containing oxidoreductase, includes glycolate oxidase subunit GlcF | Energy production and conversion [C] | 0.38 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 67.05 % |
| Unclassified | root | N/A | 32.95 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2067725003|GPWSG_F5G3JLY01A3WSI | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Rubritepida → unclassified Rubritepida → Rubritepida sp. | 517 | Open in IMG/M |
| 2170459015|G14TP7Y02FV6BT | Not Available | 650 | Open in IMG/M |
| 2228664022|INPgaii200_c0610604 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 863 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_105868750 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3863 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_105869276 | Not Available | 705 | Open in IMG/M |
| 3300000956|JGI10216J12902_100000647 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 611 | Open in IMG/M |
| 3300002907|JGI25613J43889_10052348 | Not Available | 1141 | Open in IMG/M |
| 3300002907|JGI25613J43889_10172157 | Not Available | 571 | Open in IMG/M |
| 3300004114|Ga0062593_100653773 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1015 | Open in IMG/M |
| 3300004114|Ga0062593_101029665 | All Organisms → cellular organisms → Bacteria | 847 | Open in IMG/M |
| 3300004157|Ga0062590_100622296 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 954 | Open in IMG/M |
| 3300004463|Ga0063356_103887435 | Not Available | 643 | Open in IMG/M |
| 3300004463|Ga0063356_104259684 | Not Available | 616 | Open in IMG/M |
| 3300004463|Ga0063356_104312838 | Not Available | 612 | Open in IMG/M |
| 3300004463|Ga0063356_105376344 | Not Available | 550 | Open in IMG/M |
| 3300004480|Ga0062592_100708666 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 877 | Open in IMG/M |
| 3300004480|Ga0062592_101602813 | Not Available | 629 | Open in IMG/M |
| 3300005093|Ga0062594_101993454 | Not Available | 620 | Open in IMG/M |
| 3300005175|Ga0066673_10156909 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1271 | Open in IMG/M |
| 3300005184|Ga0066671_10801489 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 602 | Open in IMG/M |
| 3300005327|Ga0070658_10005526 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 10263 | Open in IMG/M |
| 3300005327|Ga0070658_11903257 | Not Available | 514 | Open in IMG/M |
| 3300005330|Ga0070690_100185351 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1440 | Open in IMG/M |
| 3300005330|Ga0070690_100767038 | All Organisms → cellular organisms → Bacteria | 746 | Open in IMG/M |
| 3300005333|Ga0070677_10323832 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 790 | Open in IMG/M |
| 3300005333|Ga0070677_10616300 | Not Available | 603 | Open in IMG/M |
| 3300005333|Ga0070677_10707519 | Not Available | 568 | Open in IMG/M |
| 3300005335|Ga0070666_11029713 | Not Available | 611 | Open in IMG/M |
| 3300005336|Ga0070680_100414686 | Not Available | 1149 | Open in IMG/M |
| 3300005336|Ga0070680_101069476 | All Organisms → cellular organisms → Bacteria | 697 | Open in IMG/M |
| 3300005336|Ga0070680_101622425 | Not Available | 560 | Open in IMG/M |
| 3300005344|Ga0070661_100249823 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1368 | Open in IMG/M |
| 3300005345|Ga0070692_10807836 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 641 | Open in IMG/M |
| 3300005366|Ga0070659_101234577 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 662 | Open in IMG/M |
| 3300005434|Ga0070709_10039891 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2884 | Open in IMG/M |
| 3300005435|Ga0070714_101612268 | Not Available | 634 | Open in IMG/M |
| 3300005440|Ga0070705_100111466 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1749 | Open in IMG/M |
| 3300005444|Ga0070694_101273156 | All Organisms → cellular organisms → Bacteria | 618 | Open in IMG/M |
| 3300005458|Ga0070681_11464599 | Not Available | 607 | Open in IMG/M |
| 3300005458|Ga0070681_11779670 | Not Available | 543 | Open in IMG/M |
| 3300005459|Ga0068867_101033050 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 747 | Open in IMG/M |
| 3300005537|Ga0070730_10061575 | All Organisms → cellular organisms → Bacteria | 2672 | Open in IMG/M |
| 3300005538|Ga0070731_10043386 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 3008 | Open in IMG/M |
| 3300005547|Ga0070693_100014033 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4093 | Open in IMG/M |
| 3300005547|Ga0070693_101102504 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 605 | Open in IMG/M |
| 3300005547|Ga0070693_101445205 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 536 | Open in IMG/M |
| 3300005548|Ga0070665_100296259 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1620 | Open in IMG/M |
| 3300005556|Ga0066707_10605746 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 699 | Open in IMG/M |
| 3300005559|Ga0066700_10311239 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1111 | Open in IMG/M |
| 3300005559|Ga0066700_10331376 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1075 | Open in IMG/M |
| 3300005616|Ga0068852_102464199 | Not Available | 541 | Open in IMG/M |
| 3300005897|Ga0075281_1005719 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1521 | Open in IMG/M |
| 3300005985|Ga0081539_10182596 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 983 | Open in IMG/M |
| 3300006028|Ga0070717_11186214 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 695 | Open in IMG/M |
| 3300006028|Ga0070717_11759741 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 560 | Open in IMG/M |
| 3300006048|Ga0075363_101041994 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 505 | Open in IMG/M |
| 3300006177|Ga0075362_10531827 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 603 | Open in IMG/M |
| 3300006195|Ga0075366_11074665 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 503 | Open in IMG/M |
| 3300006237|Ga0097621_100201712 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1727 | Open in IMG/M |
| 3300006358|Ga0068871_101669656 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 604 | Open in IMG/M |
| 3300006638|Ga0075522_10405399 | Not Available | 644 | Open in IMG/M |
| 3300006794|Ga0066658_10941759 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 501 | Open in IMG/M |
| 3300006804|Ga0079221_10730783 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 696 | Open in IMG/M |
| 3300006844|Ga0075428_100018799 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae | 7641 | Open in IMG/M |
| 3300006844|Ga0075428_101986303 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 603 | Open in IMG/M |
| 3300006852|Ga0075433_11058258 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 706 | Open in IMG/M |
| 3300006852|Ga0075433_11243078 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 646 | Open in IMG/M |
| 3300006871|Ga0075434_101899756 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 601 | Open in IMG/M |
| 3300006876|Ga0079217_11128866 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 589 | Open in IMG/M |
| 3300006881|Ga0068865_101074920 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 708 | Open in IMG/M |
| 3300006914|Ga0075436_100812436 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 697 | Open in IMG/M |
| 3300006918|Ga0079216_10741764 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 709 | Open in IMG/M |
| 3300006969|Ga0075419_10525080 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 825 | Open in IMG/M |
| 3300007076|Ga0075435_101118918 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 689 | Open in IMG/M |
| 3300007076|Ga0075435_101983106 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Polaromonas | 511 | Open in IMG/M |
| 3300007255|Ga0099791_10100745 | Not Available | 1329 | Open in IMG/M |
| 3300009038|Ga0099829_10832294 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 766 | Open in IMG/M |
| 3300009083|Ga0105047_10458231 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1229 | Open in IMG/M |
| 3300009089|Ga0099828_10148010 | Not Available | 2073 | Open in IMG/M |
| 3300009093|Ga0105240_12424333 | Not Available | 543 | Open in IMG/M |
| 3300009094|Ga0111539_13180684 | Not Available | 529 | Open in IMG/M |
| 3300009098|Ga0105245_10379388 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1407 | Open in IMG/M |
| 3300009098|Ga0105245_11115416 | Not Available | 835 | Open in IMG/M |
| 3300009098|Ga0105245_12816485 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 539 | Open in IMG/M |
| 3300009100|Ga0075418_10165223 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2356 | Open in IMG/M |
| 3300009148|Ga0105243_10355888 | Not Available | 1346 | Open in IMG/M |
| 3300009162|Ga0075423_12751444 | All Organisms → cellular organisms → Eukaryota | 539 | Open in IMG/M |
| 3300009176|Ga0105242_10072479 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2861 | Open in IMG/M |
| 3300009545|Ga0105237_11113704 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 796 | Open in IMG/M |
| 3300009609|Ga0105347_1049032 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1512 | Open in IMG/M |
| 3300009650|Ga0105857_1124323 | Not Available | 708 | Open in IMG/M |
| 3300009650|Ga0105857_1142972 | All Organisms → cellular organisms → Bacteria | 666 | Open in IMG/M |
| 3300009789|Ga0126307_10787797 | Not Available | 767 | Open in IMG/M |
| 3300009873|Ga0131077_10155826 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae | 2549 | Open in IMG/M |
| 3300010040|Ga0126308_11316226 | Not Available | 513 | Open in IMG/M |
| 3300010371|Ga0134125_10995995 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 919 | Open in IMG/M |
| 3300010396|Ga0134126_11344530 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 790 | Open in IMG/M |
| 3300010396|Ga0134126_11727706 | Not Available | 687 | Open in IMG/M |
| 3300010396|Ga0134126_12271416 | Not Available | 591 | Open in IMG/M |
| 3300010398|Ga0126383_10103054 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2556 | Open in IMG/M |
| 3300010401|Ga0134121_13160290 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 508 | Open in IMG/M |
| 3300011270|Ga0137391_10490678 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1041 | Open in IMG/M |
| 3300011332|Ga0126317_10172053 | Not Available | 658 | Open in IMG/M |
| 3300011429|Ga0137455_1257207 | Not Available | 514 | Open in IMG/M |
| 3300011436|Ga0137458_1230227 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 564 | Open in IMG/M |
| 3300012096|Ga0137389_10600480 | All Organisms → cellular organisms → Bacteria | 946 | Open in IMG/M |
| 3300012212|Ga0150985_116801003 | Not Available | 685 | Open in IMG/M |
| 3300012351|Ga0137386_10712638 | Not Available | 721 | Open in IMG/M |
| 3300012469|Ga0150984_122928896 | Not Available | 654 | Open in IMG/M |
| 3300012668|Ga0157216_10011534 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 4794 | Open in IMG/M |
| 3300012906|Ga0157295_10099648 | Not Available | 795 | Open in IMG/M |
| 3300012915|Ga0157302_10523549 | Not Available | 517 | Open in IMG/M |
| 3300012958|Ga0164299_10764107 | Not Available | 684 | Open in IMG/M |
| 3300012986|Ga0164304_11442293 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 567 | Open in IMG/M |
| 3300012989|Ga0164305_10807421 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 779 | Open in IMG/M |
| 3300013306|Ga0163162_13445184 | Not Available | 504 | Open in IMG/M |
| 3300013307|Ga0157372_10559955 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1333 | Open in IMG/M |
| 3300013307|Ga0157372_12329930 | Not Available | 615 | Open in IMG/M |
| 3300013308|Ga0157375_10541612 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1326 | Open in IMG/M |
| 3300014166|Ga0134079_10692558 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 519 | Open in IMG/M |
| 3300014326|Ga0157380_11465507 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 735 | Open in IMG/M |
| 3300014326|Ga0157380_12028938 | All Organisms → cellular organisms → Bacteria | 637 | Open in IMG/M |
| 3300014326|Ga0157380_12844150 | Not Available | 550 | Open in IMG/M |
| 3300014326|Ga0157380_13069087 | Not Available | 532 | Open in IMG/M |
| 3300014877|Ga0180074_1105085 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 634 | Open in IMG/M |
| 3300015063|Ga0167649_116391 | All Organisms → cellular organisms → Bacteria | 619 | Open in IMG/M |
| 3300015078|Ga0167660_1009098 | All Organisms → cellular organisms → Bacteria | 1073 | Open in IMG/M |
| 3300015079|Ga0167657_1044681 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 502 | Open in IMG/M |
| 3300015197|Ga0167638_1017692 | All Organisms → cellular organisms → Bacteria | 1676 | Open in IMG/M |
| 3300015199|Ga0167647_1127787 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
| 3300015200|Ga0173480_11039409 | Not Available | 542 | Open in IMG/M |
| 3300015201|Ga0173478_10763685 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300015258|Ga0180093_1021466 | Not Available | 1334 | Open in IMG/M |
| 3300015371|Ga0132258_11584292 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1653 | Open in IMG/M |
| 3300015371|Ga0132258_12736541 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1230 | Open in IMG/M |
| 3300015374|Ga0132255_102781379 | Not Available | 748 | Open in IMG/M |
| 3300017965|Ga0190266_10214487 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 933 | Open in IMG/M |
| 3300017966|Ga0187776_10881982 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 648 | Open in IMG/M |
| 3300018063|Ga0184637_10244817 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium GR16-43 | 1093 | Open in IMG/M |
| 3300018081|Ga0184625_10113499 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1405 | Open in IMG/M |
| 3300018089|Ga0187774_10472439 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 782 | Open in IMG/M |
| 3300018476|Ga0190274_10852531 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 974 | Open in IMG/M |
| 3300018476|Ga0190274_11202096 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 842 | Open in IMG/M |
| 3300018476|Ga0190274_13251038 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Usitatibacteraceae → Usitatibacter → Usitatibacter rugosus | 547 | Open in IMG/M |
| 3300018476|Ga0190274_13861895 | Not Available | 507 | Open in IMG/M |
| 3300018481|Ga0190271_10211850 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1940 | Open in IMG/M |
| 3300018481|Ga0190271_11109248 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 915 | Open in IMG/M |
| 3300019356|Ga0173481_10425299 | All Organisms → cellular organisms → Bacteria | 657 | Open in IMG/M |
| 3300019361|Ga0173482_10051518 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium GR16-43 | 1339 | Open in IMG/M |
| 3300020027|Ga0193752_1196665 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 768 | Open in IMG/M |
| 3300020154|Ga0196965_1203188 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 512 | Open in IMG/M |
| 3300020186|Ga0163153_10002887 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 23929 | Open in IMG/M |
| 3300021066|Ga0196980_1089496 | Not Available | 541 | Open in IMG/M |
| 3300021339|Ga0193706_1158127 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 617 | Open in IMG/M |
| 3300021363|Ga0193699_10207333 | Not Available | 814 | Open in IMG/M |
| 3300021372|Ga0213877_10245906 | Not Available | 593 | Open in IMG/M |
| 3300021432|Ga0210384_10379049 | Not Available | 1274 | Open in IMG/M |
| 3300021953|Ga0213880_10029631 | Not Available | 1262 | Open in IMG/M |
| 3300023072|Ga0247799_1063902 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 627 | Open in IMG/M |
| 3300025504|Ga0208356_1013278 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1838 | Open in IMG/M |
| 3300025505|Ga0207929_1019413 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1289 | Open in IMG/M |
| 3300025893|Ga0207682_10154662 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1036 | Open in IMG/M |
| 3300025893|Ga0207682_10228640 | Not Available | 862 | Open in IMG/M |
| 3300025899|Ga0207642_10135971 | Not Available | 1289 | Open in IMG/M |
| 3300025903|Ga0207680_11190909 | Not Available | 543 | Open in IMG/M |
| 3300025906|Ga0207699_10100904 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium GR16-43 | 1831 | Open in IMG/M |
| 3300025909|Ga0207705_10004746 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 10236 | Open in IMG/M |
| 3300025909|Ga0207705_10716803 | Not Available | 777 | Open in IMG/M |
| 3300025911|Ga0207654_10362418 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium GR16-43 | 1000 | Open in IMG/M |
| 3300025911|Ga0207654_10595676 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 788 | Open in IMG/M |
| 3300025912|Ga0207707_10299408 | Not Available | 1391 | Open in IMG/M |
| 3300025913|Ga0207695_10209395 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1861 | Open in IMG/M |
| 3300025916|Ga0207663_10238987 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium GR16-43 | 1331 | Open in IMG/M |
| 3300025918|Ga0207662_10792209 | Not Available | 668 | Open in IMG/M |
| 3300025920|Ga0207649_10808512 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 732 | Open in IMG/M |
| 3300025922|Ga0207646_10985658 | Not Available | 745 | Open in IMG/M |
| 3300025927|Ga0207687_11307495 | All Organisms → cellular organisms → Bacteria | 623 | Open in IMG/M |
| 3300025932|Ga0207690_11360417 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium GR16-43 | 594 | Open in IMG/M |
| 3300025941|Ga0207711_10668932 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium GR16-43 | 969 | Open in IMG/M |
| 3300025941|Ga0207711_11737002 | Not Available | 567 | Open in IMG/M |
| 3300025949|Ga0207667_11818430 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
| 3300025949|Ga0207667_12142020 | Not Available | 517 | Open in IMG/M |
| 3300025981|Ga0207640_11340964 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 640 | Open in IMG/M |
| 3300026023|Ga0207677_12294809 | Not Available | 502 | Open in IMG/M |
| 3300026075|Ga0207708_11253503 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 649 | Open in IMG/M |
| 3300026075|Ga0207708_11325983 | Not Available | 631 | Open in IMG/M |
| 3300026078|Ga0207702_10295091 | Not Available | 1537 | Open in IMG/M |
| 3300026089|Ga0207648_10385087 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1268 | Open in IMG/M |
| 3300026095|Ga0207676_10377383 | Not Available | 1319 | Open in IMG/M |
| 3300026095|Ga0207676_12172651 | Not Available | 553 | Open in IMG/M |
| 3300026118|Ga0207675_100382760 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1384 | Open in IMG/M |
| 3300026118|Ga0207675_100993749 | Not Available | 857 | Open in IMG/M |
| 3300026295|Ga0209234_1234695 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 602 | Open in IMG/M |
| 3300026319|Ga0209647_1028255 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 3329 | Open in IMG/M |
| 3300026325|Ga0209152_10502886 | Not Available | 501 | Open in IMG/M |
| 3300027637|Ga0209818_1013434 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1690 | Open in IMG/M |
| 3300027674|Ga0209118_1219871 | Not Available | 507 | Open in IMG/M |
| 3300027691|Ga0209485_1011939 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1866 | Open in IMG/M |
| 3300027748|Ga0209689_1038772 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2760 | Open in IMG/M |
| 3300027748|Ga0209689_1161443 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1052 | Open in IMG/M |
| 3300027857|Ga0209166_10113231 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1504 | Open in IMG/M |
| 3300027866|Ga0209813_10378822 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 566 | Open in IMG/M |
| 3300027869|Ga0209579_10277181 | All Organisms → cellular organisms → Bacteria | 903 | Open in IMG/M |
| 3300027886|Ga0209486_10497405 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 757 | Open in IMG/M |
| 3300027907|Ga0207428_10002304 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium GR16-43 | 19123 | Open in IMG/M |
| 3300028379|Ga0268266_10232763 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1697 | Open in IMG/M |
| 3300028380|Ga0268265_10189711 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1774 | Open in IMG/M |
| 3300028596|Ga0247821_10915493 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 584 | Open in IMG/M |
| 3300028608|Ga0247819_10795837 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 585 | Open in IMG/M |
| 3300028790|Ga0307283_10224816 | Not Available | 544 | Open in IMG/M |
| 3300028800|Ga0265338_10869910 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 615 | Open in IMG/M |
| 3300028809|Ga0247824_10321386 | Not Available | 876 | Open in IMG/M |
| 3300028812|Ga0247825_10152033 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1587 | Open in IMG/M |
| 3300028812|Ga0247825_11131056 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 571 | Open in IMG/M |
| 3300029636|Ga0222749_10836268 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 503 | Open in IMG/M |
| 3300030294|Ga0311349_11553304 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
| 3300031170|Ga0307498_10211714 | Not Available | 682 | Open in IMG/M |
| (restricted) 3300031197|Ga0255310_10016958 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1870 | Open in IMG/M |
| 3300031226|Ga0307497_10443399 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 629 | Open in IMG/M |
| 3300031231|Ga0170824_111725925 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1513 | Open in IMG/M |
| 3300031232|Ga0302323_102157124 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
| 3300031235|Ga0265330_10419623 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 567 | Open in IMG/M |
| 3300031446|Ga0170820_11828161 | Not Available | 984 | Open in IMG/M |
| 3300031455|Ga0307505_10003196 | Not Available | 10454 | Open in IMG/M |
| 3300031474|Ga0170818_104223627 | All Organisms → cellular organisms → Bacteria | 1863 | Open in IMG/M |
| 3300031538|Ga0310888_10491035 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 733 | Open in IMG/M |
| 3300031538|Ga0310888_10503410 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 725 | Open in IMG/M |
| 3300031538|Ga0310888_10916331 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 548 | Open in IMG/M |
| 3300031548|Ga0307408_100484480 | Not Available | 1080 | Open in IMG/M |
| 3300031720|Ga0307469_10096829 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2058 | Open in IMG/M |
| 3300031720|Ga0307469_12103794 | Not Available | 549 | Open in IMG/M |
| 3300031731|Ga0307405_10360447 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1125 | Open in IMG/M |
| 3300031731|Ga0307405_12027667 | Not Available | 515 | Open in IMG/M |
| 3300031736|Ga0318501_10751304 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
| 3300031740|Ga0307468_100301152 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1164 | Open in IMG/M |
| 3300031740|Ga0307468_102283574 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 525 | Open in IMG/M |
| 3300031771|Ga0318546_11011240 | Not Available | 585 | Open in IMG/M |
| 3300031824|Ga0307413_10166346 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1556 | Open in IMG/M |
| 3300031824|Ga0307413_11721579 | Not Available | 559 | Open in IMG/M |
| 3300031903|Ga0307407_11458740 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Betaproteobacteria incertae sedis → Candidatus Accumulibacter | 540 | Open in IMG/M |
| 3300031918|Ga0311367_12297637 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300031938|Ga0308175_103291442 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 500 | Open in IMG/M |
| 3300031939|Ga0308174_10821443 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 782 | Open in IMG/M |
| 3300031996|Ga0308176_11226580 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 796 | Open in IMG/M |
| 3300032002|Ga0307416_103316286 | Not Available | 539 | Open in IMG/M |
| 3300032122|Ga0310895_10777226 | Not Available | 503 | Open in IMG/M |
| 3300032126|Ga0307415_102243221 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 535 | Open in IMG/M |
| 3300032174|Ga0307470_10424697 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 948 | Open in IMG/M |
| 3300032179|Ga0310889_10634827 | Not Available | 553 | Open in IMG/M |
| 3300032180|Ga0307471_102618990 | Not Available | 639 | Open in IMG/M |
| 3300032770|Ga0335085_10143377 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 3009 | Open in IMG/M |
| 3300032782|Ga0335082_10003244 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 17688 | Open in IMG/M |
| 3300032782|Ga0335082_10011886 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium GR16-43 | 9455 | Open in IMG/M |
| 3300032828|Ga0335080_10083416 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium GR16-43 | 3545 | Open in IMG/M |
| 3300032828|Ga0335080_12055975 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 552 | Open in IMG/M |
| 3300032829|Ga0335070_10056900 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium GR16-43 | 4269 | Open in IMG/M |
| 3300033480|Ga0316620_10262205 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1488 | Open in IMG/M |
| 3300033486|Ga0316624_10340613 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1232 | Open in IMG/M |
| 3300033551|Ga0247830_11000694 | All Organisms → cellular organisms → Bacteria | 667 | Open in IMG/M |
| 3300034268|Ga0372943_0907798 | Not Available | 586 | Open in IMG/M |
| 3300034354|Ga0364943_0175865 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 780 | Open in IMG/M |
| 3300034384|Ga0372946_0361868 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 704 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 8.71% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 5.30% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.30% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.92% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 4.92% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.03% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 3.03% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 3.03% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 2.27% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 2.27% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.27% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.27% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.27% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.27% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 2.27% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.27% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.27% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 1.89% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.89% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.89% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.89% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.89% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.89% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.52% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.52% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 1.52% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 1.52% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.52% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.52% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 1.14% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.14% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.14% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 1.14% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.14% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.76% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.76% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.76% |
| Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 0.76% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.76% |
| Soil | Environmental → Terrestrial → Soil → Sand → Desert → Soil | 0.76% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.76% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.76% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.76% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.76% |
| Freshwater Microbial Mat | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Microbial Mat | 0.38% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.38% |
| Freshwater | Environmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater | 0.38% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.38% |
| Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil | 0.38% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.38% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.38% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.38% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.38% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.38% |
| Sandy Soil | Environmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil | 0.38% |
| Exposed Rock | Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock | 0.38% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.38% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.38% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.38% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.38% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.38% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.38% |
| Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 0.38% |
| Wastewater | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Wastewater | 0.38% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2067725003 | Soil microbial communities from Great Prairies - Wisconsin, Switchgrass soil | Environmental | Open in IMG/M |
| 2170459015 | Litter degradation PV4 | Engineered | Open in IMG/M |
| 2228664022 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300002907 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
| 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
| 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
| 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
| 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
| 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
| 3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300005897 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_80N_103 | Environmental | Open in IMG/M |
| 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Host-Associated | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006048 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Host-Associated | Open in IMG/M |
| 3300006177 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Host-Associated | Open in IMG/M |
| 3300006195 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Host-Associated | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006638 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostL2-A | Environmental | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006876 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 | Environmental | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300006918 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 | Environmental | Open in IMG/M |
| 3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009083 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-04 (megahit assembly) | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009609 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT890 | Environmental | Open in IMG/M |
| 3300009650 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-061 | Environmental | Open in IMG/M |
| 3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
| 3300009873 | Activated sludge microbial diversity in wastewater treatment plant from Taiwan - Wenshan plant | Engineered | Open in IMG/M |
| 3300010040 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011332 | Soil microbial communities from California, USA to study soil gas exchange rates - SR-CA-SC2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011429 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT600_2 | Environmental | Open in IMG/M |
| 3300011436 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT642_2 | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012668 | Arctic soils microbial communities. Combined Assembly of 23 SPs | Environmental | Open in IMG/M |
| 3300012906 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S212-509R-1 | Environmental | Open in IMG/M |
| 3300012915 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2 | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014877 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT366_16_10D | Environmental | Open in IMG/M |
| 3300015063 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-3b, vegetated patch on medial moraine) | Environmental | Open in IMG/M |
| 3300015078 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-11a, vegetated hydrological feature) | Environmental | Open in IMG/M |
| 3300015079 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-6b, vegetation/snow interface) | Environmental | Open in IMG/M |
| 3300015197 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G6B, Proglacial plain, adjacent to northern proglacial tributary) | Environmental | Open in IMG/M |
| 3300015199 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-2c, rock/snow interface) | Environmental | Open in IMG/M |
| 3300015200 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2) | Environmental | Open in IMG/M |
| 3300015201 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1 (version 2) | Environmental | Open in IMG/M |
| 3300015258 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT45_16_1Da | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300017965 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 T | Environmental | Open in IMG/M |
| 3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
| 3300018063 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2 | Environmental | Open in IMG/M |
| 3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
| 3300018089 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
| 3300019356 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2) | Environmental | Open in IMG/M |
| 3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
| 3300020027 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1c1 | Environmental | Open in IMG/M |
| 3300020154 | Soil microbial communities from Anza Borrego desert, Southern California, United States - S1_20 | Environmental | Open in IMG/M |
| 3300020186 | Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.MP6.IB-1 | Environmental | Open in IMG/M |
| 3300021066 | Soil microbial communities from Anza Borrego desert, Southern California, United States - S3_10-13C | Environmental | Open in IMG/M |
| 3300021339 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3c1 | Environmental | Open in IMG/M |
| 3300021363 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c2 | Environmental | Open in IMG/M |
| 3300021372 | Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R01 | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021953 | Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R07 | Environmental | Open in IMG/M |
| 3300023072 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S151-409C-6 | Environmental | Open in IMG/M |
| 3300025504 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-1 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025505 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-1 deep-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026295 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026319 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes) | Environmental | Open in IMG/M |
| 3300027637 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 (SPAdes) | Environmental | Open in IMG/M |
| 3300027645 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027674 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027691 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 (SPAdes) | Environmental | Open in IMG/M |
| 3300027748 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes) | Environmental | Open in IMG/M |
| 3300027857 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027866 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027886 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes) | Environmental | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028596 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glycerol_Day14 | Environmental | Open in IMG/M |
| 3300028608 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Xylose_Day6 | Environmental | Open in IMG/M |
| 3300028790 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_122 | Environmental | Open in IMG/M |
| 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Host-Associated | Open in IMG/M |
| 3300028809 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_PalmiticAcid_Day48 | Environmental | Open in IMG/M |
| 3300028812 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Vanillin_Day48 | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030294 | II_Fen_E3 coassembly | Environmental | Open in IMG/M |
| 3300031170 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_S | Environmental | Open in IMG/M |
| 3300031197 (restricted) | Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH1_T0_E1 | Environmental | Open in IMG/M |
| 3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031232 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3 | Environmental | Open in IMG/M |
| 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Host-Associated | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031455 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 23_S | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031538 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1 | Environmental | Open in IMG/M |
| 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Host-Associated | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Host-Associated | Open in IMG/M |
| 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Host-Associated | Open in IMG/M |
| 3300031918 | III_Fen_N3 coassembly | Environmental | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| 3300031939 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2 | Environmental | Open in IMG/M |
| 3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
| 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
| 3300032122 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D4 | Environmental | Open in IMG/M |
| 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Host-Associated | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032179 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D2 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
| 3300033480 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D5_B | Environmental | Open in IMG/M |
| 3300033486 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_N3_C1_D5_A | Environmental | Open in IMG/M |
| 3300033551 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5 | Environmental | Open in IMG/M |
| 3300034268 | Forest soil microbial communities from Eldorado National Forest, California, USA - SNFC_MG_FRD_1.2 | Environmental | Open in IMG/M |
| 3300034354 | Sediment microbial communities from East River floodplain, Colorado, United States - 23_s17 | Environmental | Open in IMG/M |
| 3300034384 | Forest soil microbial communities from Eldorado National Forest, California, USA - SNFC_MG_KNG_2.2 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| GPWSG_02311910 | 2067725003 | Soil | VDHRIVLISVVVAIIAVIGYLLVMRVFFRESKELDKKIDYSK |
| 4PV_03441410 | 2170459015 | Switchgrass, Maize And Mischanthus Litter | MNHHIAMIALVVGILVVAGYLLVMRVFFRDSKALDKNIDYSKMKEWKDDED |
| INPgaii200_06106042 | 2228664022 | Soil | MDNPILIVIAIGVVLVVGYLLVMRVFFRESKELDKKVDLSKMKPWKDDED |
| INPhiseqgaiiFebDRAFT_1058687503 | 3300000364 | Soil | MNHQIVMIAVVVGLLVVAGYLLVMRVFFRESQELDKKIDPSKMKKWKDDED* |
| INPhiseqgaiiFebDRAFT_1058692762 | 3300000364 | Soil | MDNPILIVIAIGVVLVVGYLLVMRVFFRESKELDKKVDLSKMKPWKDDED* |
| JGI10216J12902_1000006472 | 3300000956 | Soil | VDHRIVFISVAVAVVAVVGYLIVMRIFYRESSELDKKIDFSKMKEWKDDED* |
| JGI25613J43889_100523482 | 3300002907 | Grasslands Soil | MDPLVMFGVVAAILVVGYLLVMRVFFKDSKELDKKIDYSKMKEWKDED* |
| JGI25613J43889_101721571 | 3300002907 | Grasslands Soil | MNHQIVMIAVVVGLLVVAGYLLVMRVFFRESKELDKKIDYSKMKE |
| Ga0062593_1006537732 | 3300004114 | Soil | MNHHIAMIALVVGVLVVAGYLLVMRVFFRDSKALDKNIDYSKMKEWKDDED* |
| Ga0062593_1010296652 | 3300004114 | Soil | MDHRIALIALGVAVAAVAIYLLVMRVFFRESKELDRKIDYSKMKEWKDED* |
| Ga0062590_1006222962 | 3300004157 | Soil | MNHHIAMIALVVGVLVVAGYLLVMRVFFRDSKALDKTIDYSKMKEWKDDED* |
| Ga0063356_1038874351 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MDHRIVFIAVGIALVAVIGYLLVMRIFYRESAQLDKTIDYSKMKEWKDED* |
| Ga0063356_1042596842 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MDHRIVLISVIVAVIAVLGYVLVMRVFFRESKELDKKIDYSKIKEWKDDE* |
| Ga0063356_1043128381 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MDHQIAMIALVVGVLVVAGYLLVMRVFFRDSKALDKNIDYSKMKEWKDDED* |
| Ga0063356_1053763442 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MDHRIVFIAVGVALLAVVGYMLVMRVFYRESKELDKSIDYSKMKEWKDDE* |
| Ga0062592_1007086662 | 3300004480 | Soil | MDHHIVFIAVGVALLVVVGYVVVMRVFYRESTELDKTIDYTKMKEWKDED* |
| Ga0062592_1016028131 | 3300004480 | Soil | MDHRIVFIAVGVAIFAVVGYLIVMRIFYRESAELDKTIDHSKMKEWKDDD* |
| Ga0062594_1019934541 | 3300005093 | Soil | MDHHIAMIALVVGVLVVAGYLLVMRVFFRDSKALDKNIDYSKMKEWKDDED* |
| Ga0066673_101569092 | 3300005175 | Soil | MNHHVAIIALAVGALVVLRYVLVMRVFFKESRQLDKKIDFTKMKKWKDED* |
| Ga0066671_108014892 | 3300005184 | Soil | MNHNIAIIALVVGLLVVAGYLLVMRVFFRDSKALDKNIDYSKMKEWKDDD* |
| Ga0070658_100055262 | 3300005327 | Corn Rhizosphere | MDPKIVWIVAIAAGLAIGYLVVMRVFFRESKDLDKKIDYAKMKEWKDED* |
| Ga0070658_119032572 | 3300005327 | Corn Rhizosphere | MNHHIAMIALVVGLLVVAGYLLVMRVFFRESKALDKNIDLSKMKEWKDED* |
| Ga0070690_1001853513 | 3300005330 | Switchgrass Rhizosphere | MNHHVVMIALAVGALVVIGYVIVMRVFFRESAELDKHIDFTKMKQWHDEDEG* |
| Ga0070690_1007670382 | 3300005330 | Switchgrass Rhizosphere | MNHQIVMIAVVVGLLVVAGYLLVMRVFFRESEQLDKKIDYSKMKEWKDDED* |
| Ga0070677_103238322 | 3300005333 | Miscanthus Rhizosphere | MDHNIVFIALGVAVVAVIGYLLVMRVFFRESAEADKHIDYAKMKKWKDEED* |
| Ga0070677_106163002 | 3300005333 | Miscanthus Rhizosphere | MNHHIAMIALVVGVLVVAGYLLVMRVFFRDSKALDKNIDYSKMKEWKD |
| Ga0070677_107075192 | 3300005333 | Miscanthus Rhizosphere | MNHHIAMIALVVGLIVVAGYLLVMRVFFRESKALDKNIDYSKMKEWKDEED* |
| Ga0070666_110297132 | 3300005335 | Switchgrass Rhizosphere | DGGSVDHRIVLISVVVAVIAVIGYLLVMRVFFRESKELDKKIDYAKMKKWEDDPE* |
| Ga0070680_1004146862 | 3300005336 | Corn Rhizosphere | MDRAVLVALAVGVAVVAAYLLVMRVFFKDSKDLDKKIDYSKVKEWKDDED* |
| Ga0070680_1010694761 | 3300005336 | Corn Rhizosphere | ALLVGLAVVLGYVVVMRVFFRESDSLDKKIDFSKMREWKDED* |
| Ga0070680_1016224251 | 3300005336 | Corn Rhizosphere | MDNAVVVALLVGLAVVLGYVVVMRVFFRESESLDRKIDFGKMRKWEDED* |
| Ga0070661_1002498232 | 3300005344 | Corn Rhizosphere | VDQHTIAIFVAIALGLVVLYFLVMRVFFRDSKALDKKIDYTKMKEWKDED* |
| Ga0070692_108078362 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | MNHHIAMIALVVGLIVVAGYLLVMRVFFRESKALDKNIDYSKMKEWKDDED* |
| Ga0070659_1012345772 | 3300005366 | Corn Rhizosphere | MDPAIVWIVAIAAGLAIGYFIVMRVFFKESKDLDKKIDYSKMKEWKDDE* |
| Ga0070709_100398911 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MTPNVIWITLVAAVVVVGGYLLVMRVFFRDSKELDKKIDYSKMKPWKDDED* |
| Ga0070714_1016122682 | 3300005435 | Agricultural Soil | MTPNVIWITLVAAVVVVGGYLLVMRVFFRDSKELDKKIDYSKMKEWKD |
| Ga0070705_1001114662 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | MDHHIVAIAAVVGVLVVAGYLLVMRVFFKESKELDKKIDYGKMKEWKDED* |
| Ga0070694_1012731562 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | MDHRIVMIAAGVAVFAVIAYVLVMRIFFKESKELDKKIDYGKMKEWKDDD* |
| Ga0070681_114645991 | 3300005458 | Corn Rhizosphere | MDRAVVVALLVGIGVVIAYVVVMRVFFRESRSLDRKIDFDKMRDWKDED* |
| Ga0070681_117796701 | 3300005458 | Corn Rhizosphere | MDRAVLVALAVGLAVVIGYLVVMRVFFRDSKDLDKKIDYSKMKEWKDEE* |
| Ga0068867_1010330502 | 3300005459 | Miscanthus Rhizosphere | VDHRIVLISVVVAVIAVIGYLLVMRVFFRESKELDKKIDYAKMKKWEDDPE* |
| Ga0070730_100615753 | 3300005537 | Surface Soil | MNHQAAIIALAVGVLVVLGYILVMRVFFRDSKELDKQVDLTKMKKWQDED* |
| Ga0070731_100433863 | 3300005538 | Surface Soil | MNNVVFIALGVGLVVVVGYVLVIRVFFKDSQALDKNVDLAKMKKWKDED* |
| Ga0070693_1000140332 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | VDHRIVWISVVVAIFAVIGYLLVMRVFFRESKELDKKIDYTKMKKWEDDPE* |
| Ga0070693_1011025042 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | VDQHTIAIFVAIALGLVVLYFLVMRVFFRDSKALDKKIDYTKMKEWKDEDE* |
| Ga0070693_1014452051 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | VWIVAIAAGLAIGYLVVMRVFFRESKDLDKKIDYAKMKEWKDED* |
| Ga0070665_1002962592 | 3300005548 | Switchgrass Rhizosphere | MDHRIVFISVAVAVLAVVGYLLVMRVFFRESKELDKHVDLSKMKTWEDDDK* |
| Ga0066707_106057462 | 3300005556 | Soil | MDQHVVMISLVVGILVVVGYLLVMRVFFKESKELDKKIDLSKMKAWKDED* |
| Ga0066700_103112392 | 3300005559 | Soil | MNQHVVMIALAVGVLVVLGYLLVMRVFFKESEELDKHIDYTKMKKWQDEE* |
| Ga0066700_103313762 | 3300005559 | Soil | MDQHVVMISLVVGVLVVVGYLLVMRVFFKESKELDKKIDLSKMKAWKDED* |
| Ga0068852_1024641991 | 3300005616 | Corn Rhizosphere | HHIAMIALVVGLLVVAGYLLVMRVFFRESKALDKNIDLSKMKEWKDED* |
| Ga0075281_10057192 | 3300005897 | Rice Paddy Soil | MDRAVGVALLVGLVVVVAYIVVMRVFFRESRDLDKKIDYGKMRRWKDED* |
| Ga0081539_101825962 | 3300005985 | Tabebuia Heterophylla Rhizosphere | MNGHVALIALAVGALVVLGYILVMRVFFKESEELDKHIDYTKMKKWQDED* |
| Ga0070717_111862142 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MDRAVLVALAVGLAVVIGYLVVMRVFFRDSKDLDKKIDYSKMKEWKDED* |
| Ga0070717_117597412 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MDAHTLTIFAAAVAGVVVLYFLVMRVFFRDSKALDKKIDYAKMKEWKDED* |
| Ga0075363_1010419942 | 3300006048 | Populus Endosphere | MDHNIVFIALGVAVVAVIGYLLVMRVFFRESAEADKHIDYAKMKKWKDEE |
| Ga0075362_105318272 | 3300006177 | Populus Endosphere | MDHRIVLISVVVAVVAVLGYLLVMRVFFRESKELDKKIDFSKMKEWKDDPE* |
| Ga0075366_110746651 | 3300006195 | Populus Endosphere | MDHNIVFIALGVAVVAVIGYLLVMRVFFRESAEADKHIDYAKMKKWKDED* |
| Ga0097621_1002017122 | 3300006237 | Miscanthus Rhizosphere | VDHRIVLISVVVAVIAVIGYLLVMRVFFRESKELDKKIDYSKVKEWKDED* |
| Ga0068871_1016696562 | 3300006358 | Miscanthus Rhizosphere | VDHRIVLISVVVAVIAVIGYLLVMRVFFRESKELDKKIDYTKMKKWEDDPE* |
| Ga0075522_104053992 | 3300006638 | Arctic Peat Soil | MDRVVWVSLLIGLAVVVGYVIVMRVFFKDSKALDRKIDYGKM |
| Ga0066658_109417591 | 3300006794 | Soil | MDHRIVFIAATVGILVVLGYLLVMRVFFKESKELDKKIDYGKMKEWKDDED* |
| Ga0079221_107307832 | 3300006804 | Agricultural Soil | VVALLVGIAVVIAYVVVMRVFFRESQSLDRKIDFGKMREWKDED* |
| Ga0075428_1000187992 | 3300006844 | Populus Rhizosphere | MDHHIVFIAVGVALLVVVGYVVVMRVFYRESTELDKTIDYSKMKEWKDED* |
| Ga0075428_1019863032 | 3300006844 | Populus Rhizosphere | MDHQIVFIAVGVALVAVIAYVVVMRVFYRESAELDKTIDYGKMKEWKDDD* |
| Ga0075433_110582582 | 3300006852 | Populus Rhizosphere | MNQVVIIAVVVGLLVVGGYLLVMRVFFKESKELDKKIDYSKMKEWKDDED* |
| Ga0075433_112430782 | 3300006852 | Populus Rhizosphere | MNGHVALIALAVGALVVLGYILVMRVFFKESEELDKHIDFTKMKKWKDDED* |
| Ga0075434_1018997561 | 3300006871 | Populus Rhizosphere | MNHQIVMIAVVVGLLVVAGYLLVMRVFFRESEQLDKKIDYSKMKEWKDD |
| Ga0079217_111288662 | 3300006876 | Agricultural Soil | MDHRIVFIAVGVALVAVIAYVLVMRIFYRESAELDKTIDYGKMKEWKDDD* |
| Ga0068865_1010749201 | 3300006881 | Miscanthus Rhizosphere | MNHQIVMIAVVVGLLVVAGYLLVMRVFFRESEQLDKKIDYSKMKEWKDED* |
| Ga0075436_1008124362 | 3300006914 | Populus Rhizosphere | MNQHIVAIALGVGLLVVAGYLIVMRVFFRESKELDKKIDYSKMKEWKDDED* |
| Ga0079216_107417642 | 3300006918 | Agricultural Soil | MDHQIVFIAVGVALVAVIAYVVVMRVFYRESAELDKHIDYGKMKEWKDDD* |
| Ga0075419_105250802 | 3300006969 | Populus Rhizosphere | VFIAVGVALLVVVGYVVVMRVFYRESTELDKTIDYSKMKEWKDED* |
| Ga0075435_1011189181 | 3300007076 | Populus Rhizosphere | MDPKLVWIVAIAAGLAIGYFVVMRVFFRESKELDKKIDYSKMKEWKD |
| Ga0075435_1019831062 | 3300007076 | Populus Rhizosphere | MDHRIVFIAAGVALVAVIAYLLVMRVFYRESAEADKHVDLSKMKKWQDDDDK* |
| Ga0099791_101007452 | 3300007255 | Vadose Zone Soil | MDPLVMFGVVAAILVVGYLLVMRVFFKDSKELDKKIDYSKMKKWKDED* |
| Ga0099829_108322942 | 3300009038 | Vadose Zone Soil | MDHRVVIIALAVGVLVVLGYLLVMRVFFKESEELDKKIDYTKMKKWQDDE* |
| Ga0105047_104582312 | 3300009083 | Freshwater | MDHRIVLISVVVAVLAVVGYLLVMRVFFRDSKELDKHVDLSKMKEWKDDD* |
| Ga0099828_101480102 | 3300009089 | Vadose Zone Soil | MDHRVVIIALAVGVLVVLGYLLVMRVFFKESEELDKKIDYGKMKEWKDED* |
| Ga0105240_109899891 | 3300009093 | Corn Rhizosphere | VDQHTIAIFVAIALGLVVLYFLVMRVFFRDSKALDKKSDYTKMKEWKDEDE* |
| Ga0105240_124243332 | 3300009093 | Corn Rhizosphere | MPMDRAVLVALAVGLAVVIGYLVVMRVFFRDSKDLDKKIDYSKMKEWKDDED* |
| Ga0111539_131806842 | 3300009094 | Populus Rhizosphere | MDHRIVFIAVGVALVAVIGYLLVMRIFYRESAAIDKTIDYSKVKEWKDED* |
| Ga0105245_103793882 | 3300009098 | Miscanthus Rhizosphere | MNQVVMIAVGVAVLVVAGYLLVMRVFFKDSKELDRKIDYSKMKEWKDED* |
| Ga0105245_111154161 | 3300009098 | Miscanthus Rhizosphere | MIALVVGVLVVAGYLLVMRVFFRDSKALDKNIDYSKMKEWKDDED* |
| Ga0105245_128164852 | 3300009098 | Miscanthus Rhizosphere | MDHRIVFIAAGVALVVVIGYLLVMRVFYRESAEADKHVDLSKMKKWQDDDDK* |
| Ga0075418_101652233 | 3300009100 | Populus Rhizosphere | MDHHIVFIAVGVALLVVVGYVVVMRVFYRESTEPDKTIDYSKMKEWKDED* |
| Ga0105243_103558881 | 3300009148 | Miscanthus Rhizosphere | VDHRIVFISVVVAVVAVIGYLLVMRIFYRESSELDKKIDLSKMKEWKDDQD* |
| Ga0075423_127514441 | 3300009162 | Populus Rhizosphere | LGACPRGMNGHVALIALAVGALVVLGYILVMRVFFKESEELDKHIDFTKMKKWKDDED* |
| Ga0105242_100724792 | 3300009176 | Miscanthus Rhizosphere | VDHRIVLISVVVAIIAVIGYLLVMRVFFRESKELDKKIDYSKMTEWKDDE* |
| Ga0105237_111137042 | 3300009545 | Corn Rhizosphere | MNHQIVMIAVVVGLLVVAGYLLVMRVFFRESEQLDKKIDYSKMKEWKDDQD* |
| Ga0105347_10490322 | 3300009609 | Soil | MDHRIVFIALGVALLVVIGYVLVMRIFYRESTELDKTIDHSKMKEWKDED* |
| Ga0105857_11243232 | 3300009650 | Permafrost Soil | MNETVMIVVAVAVAIVVGYLLVMRVFFKDSKELDKKIDYSKM |
| Ga0105857_11429722 | 3300009650 | Permafrost Soil | MNQAVMIGIAVAVALVVGYLLVMRVFFKDSKELDKKIDYAKMKEWKDED* |
| Ga0126307_107877972 | 3300009789 | Serpentine Soil | MNHHIAMIALVVGLLVVAGYLLVMRVFFRESKALDKDIDYSKMNEWKDDED* |
| Ga0131077_101558262 | 3300009873 | Wastewater | MDHRIVFIAVGVALVAVIGYLLVMRIFYRESAELDKHIDFSKMKKWQDEED* |
| Ga0126308_113162262 | 3300010040 | Serpentine Soil | MNHHIAMIALVVGLLVVAGYLLVMRVFFRESKALDKDIDYSKMKEWKDDED* |
| Ga0134125_109959952 | 3300010371 | Terrestrial Soil | MDNAVVVALLVGLAVVLGYVVVMRVFFRDSESLDRKIDFGKMRKWEDED* |
| Ga0134126_113445302 | 3300010396 | Terrestrial Soil | VVALLVGLAVVLGYVVVMRVFFRESESLDRKIDFGKMRKWEDED* |
| Ga0134126_117277061 | 3300010396 | Terrestrial Soil | MDNAVVVALLVGLAVVLGYVVVMRVFFRESESLDRKIDFGKMRKWE |
| Ga0134126_122714162 | 3300010396 | Terrestrial Soil | MPMDRAVLVALAVGLAVVIGYLVVMRVFFRDSKDLDKKIDYSKMKEWKDEE* |
| Ga0126383_101030542 | 3300010398 | Tropical Forest Soil | MDRAVLVALVVGLAVVVGYLVVMRVFFKESEDLDKKIDLSKMKDWKDDED* |
| Ga0134121_131602901 | 3300010401 | Terrestrial Soil | MDHRIVFIAAGVALVVVIGYLLVMRVFFKESKELDKKIDYSKMKEWKDED* |
| Ga0137391_104906782 | 3300011270 | Vadose Zone Soil | MDHRIVMIALAVGVLVVLGYLLVMRVFFKESEELDKKIDYTKMKKWQDDE* |
| Ga0126317_101720532 | 3300011332 | Soil | MNHHIAMIALVVGLLVVAGYLLVMRVFFRESKALDKNIDYSKMKEWKDDED* |
| Ga0137455_12572072 | 3300011429 | Soil | MDHRIVFIAVGVALVAVIGYLLVMRIFFRESAQLDKKIDYGKMKKWEEED* |
| Ga0137458_12302272 | 3300011436 | Soil | MDHRIVLIAAAVGLVAIVGYLLVMRVFYRDSKALDKKIDFSKMKEWKDDPE* |
| Ga0137389_106004803 | 3300012096 | Vadose Zone Soil | DHRIVMIALAVGVLVVLGYLLVMRVFFKESEELDKKIDYTKMKKWQDDE* |
| Ga0150985_1168010032 | 3300012212 | Avena Fatua Rhizosphere | MNQHIAMIALIVGILVVAGYLLVMRVFFRESKALDKNIDYSKMKEWKDEED* |
| Ga0137386_107126382 | 3300012351 | Vadose Zone Soil | MTKRGETMSQVVMIAVGVAVAVVAGYLLVMRVFFKDSKELDKKIDYSKMKEWKDED* |
| Ga0150984_1229288961 | 3300012469 | Avena Fatua Rhizosphere | NFPSGRCPTGMDHRIVFIALGVALVAVIGYLLVMRVFFRESAEADKHIDYSKMKKWKDED |
| Ga0157216_100115345 | 3300012668 | Glacier Forefield Soil | MDHRIVFIAVGVALVAVVAYMLVMRVFYRESAQLDKTIDYGKMKEWKDED* |
| Ga0157295_100996482 | 3300012906 | Soil | MNHHIAMIALVVGILVVAGYLLVMRVFFRDSKALDKNIDYSKMKEWKDEED* |
| Ga0157302_105235492 | 3300012915 | Soil | MNHHIAMIALVVGILVVAGYLLVMRVFFRDSKALDKTIDYSKMKEWKDDED* |
| Ga0164299_107641072 | 3300012958 | Soil | MNQVVVIAVVVGLLVVAGYLLVMRVFFKESKELDKNIDYSKMKEWKDED* |
| Ga0164304_114422932 | 3300012986 | Soil | MDPAIVWIVAIAAGLAIGYFIVMRVFFKESKDLDKKIDYAKMKEWKDED* |
| Ga0164305_108074212 | 3300012989 | Soil | MNQVVVIAVVVGLLVVAGYLLVMRVFFKESKELDKNIDYSKMKEWKDDED* |
| Ga0163162_134451842 | 3300013306 | Switchgrass Rhizosphere | MPMNQVVLIAVVVGLLVVAGYLLVMRVFFRESKELDRKIDYSKMKEWKD |
| Ga0157372_105599552 | 3300013307 | Corn Rhizosphere | VDHRIVLISVVVAIFAVIGYLLVMRVFFRESKELDKKIDYTKMKKWEDDPE* |
| Ga0157372_123299301 | 3300013307 | Corn Rhizosphere | MDPKIVWIVAIAAGLAIGYLVVMRVFFRESKDLDKKIDYAKMK |
| Ga0157375_105416122 | 3300013308 | Miscanthus Rhizosphere | MNHHIAMIALVVGVLVVAGYLLVMRVFFRDSKALDKNIDYSKMKEWKDEED* |
| Ga0134079_106925582 | 3300014166 | Grasslands Soil | VALVVVIGYALVMRLFYRESAALDKTIDYSNMKEWKDEE* |
| Ga0157380_114655072 | 3300014326 | Switchgrass Rhizosphere | MDHQIVFIAVGVAIFAVVGYLIVMRIFYRESAELDKTIDHSKMKEWKDDD* |
| Ga0157380_120289382 | 3300014326 | Switchgrass Rhizosphere | MDHQIVFIAVGVAIFAVVGYLIVMRIFYRESAEIDKSIDYSKMKEWKDED* |
| Ga0157380_128441502 | 3300014326 | Switchgrass Rhizosphere | MNHHIAMIALVVGVLVVAGYLLVMRVFFRDSKALDKDIDYSKM |
| Ga0157380_130690872 | 3300014326 | Switchgrass Rhizosphere | VGVALVAVIGYLLVMRIFYRESAAIDKTIDYSKVKEWKDED* |
| Ga0180074_11050852 | 3300014877 | Soil | MDHRIVYIALGVALVVVIGYAIVMRIFYRESAELDKTIDYSKMKEWKDD |
| Ga0167649_1163912 | 3300015063 | Glacier Forefield Soil | MDHRIVFIAVIVAVVAVIGYLLVMRVFFKDSKELDKNIDYSKMKEWKDED* |
| Ga0167660_10090982 | 3300015078 | Glacier Forefield Soil | MTQENSMNQAVMIGIAVAVALVVGYLLVMRVFFKDSKELDKKIDYAKMKEWKDED* |
| Ga0167657_10446811 | 3300015079 | Glacier Forefield Soil | MDQQIVWIIIGIAVVGAIGYFLVMRVFFRDSKELDKKIDLSKMKPWKDDD* |
| Ga0167638_10176922 | 3300015197 | Glacier Forefield Soil | MFAIAVAVAIVVGYLLVMRVFFKDSKELDKKIDYSKMKEWKDED* |
| Ga0167647_11277872 | 3300015199 | Glacier Forefield Soil | MDHRIVLISVAVAVVAVIGYLVVMRVFFKDSKALDKKIDYSKMKEWKDED* |
| Ga0173480_110394092 | 3300015200 | Soil | MDHRIVFIAVGVALVAVICYLLVMRIFYRESAEADKSIDYSKMKEWKDDD* |
| Ga0173478_107636852 | 3300015201 | Soil | MDHHIVFIAVGVALLVVVGYVVVMRVFYRESKELDKSIDYSKMKEWKDDE |
| Ga0180093_10214662 | 3300015258 | Soil | MDHRIVFIALGVALLVVIGYVVVMRIFYRESAELDKTIDHSKMKEWKDED* |
| Ga0132258_115842922 | 3300015371 | Arabidopsis Rhizosphere | MNHNVVMIALTVGLIVVAGYLLVMRVFFRESKALDKNIDYSKMKEWKDDD* |
| Ga0132258_127365412 | 3300015371 | Arabidopsis Rhizosphere | MDHNIVFIAVGVAIVAVIGYLLVMRVFFRESAELDKHIDFSKMKKWKDDED* |
| Ga0132255_1027813792 | 3300015374 | Arabidopsis Rhizosphere | MNHNIAMIALVVGLLVVAGYLLVMRVFFRDSKALDKNIDYSKMKEWKDDED* |
| Ga0190266_102144872 | 3300017965 | Soil | MDHRIVFIAVGVAIFAVVGYLIVMRIFYRESAELDKTIDHSKMKEWKDDD |
| Ga0187776_108819822 | 3300017966 | Tropical Peatland | DNAVVVALLVGLAVVLGYLVVMRVFFRESQELDRKIDFGKMRKWEDED |
| Ga0184637_102448172 | 3300018063 | Groundwater Sediment | VDHRIVFIAVAVALVAVIGYLLVMRIFYRESKELDKHIDYSKVKQWKDED |
| Ga0184625_101134991 | 3300018081 | Groundwater Sediment | MDHRIVFIALGVALVAVVGYLLVMRIFYRESAELDKHVDLSKMKKWKDED |
| Ga0187774_104724392 | 3300018089 | Tropical Peatland | MDNAVVVALLVGLAVVLGYVLVMRVFFRESETLDRKIDLAKMRKWEDED |
| Ga0190274_108525311 | 3300018476 | Soil | IVFIAVGVALLVVVGYLVVMRVFYKDSAALDKNIDYSKMKEWKDDD |
| Ga0190274_112020962 | 3300018476 | Soil | MDHRIVFIAVGVALVAVIGYLLVMRIFYRESAALDKTIDHSKMKEWKDDD |
| Ga0190274_132510381 | 3300018476 | Soil | MDHQIVFIAVGVALFAVVGYVIVMRIFYRDSAELDKSIDHSKMKEWKDED |
| Ga0190274_138618952 | 3300018476 | Soil | MDHRIVFIAVGIALIAVIGYLLVMRIFYRESAQLDKTIDYGKMKEWKDED |
| Ga0190271_102118503 | 3300018481 | Soil | MDHRIVFIAVGVAVFAVVGYIIIMRIFYRDSAKLDKAIDHSKMKEWKDDD |
| Ga0190271_111092482 | 3300018481 | Soil | MDHRIVFIAVGVAIFAVIGYIIVMRIFYRDSAKLDKSIDYSKMKEWKDED |
| Ga0173481_104252992 | 3300019356 | Soil | MNHHIAMIALVVGVLVVAGYLLVMRVFFRDSKALDKTIDYSKMKEWKDDED |
| Ga0173482_100515182 | 3300019361 | Soil | MNHHIAMIALVVGVLVVAGYLLVMRVFFRDSKALDKNIDYSKMKEWKDDED |
| Ga0193752_11966652 | 3300020027 | Soil | MDHRIVLISVVVALVAVAGYLLVMRVFFRESKELDKHVDLSKMKEWKDDPD |
| Ga0196965_12031881 | 3300020154 | Soil | MDHRIVFIAVGVALVVVIGYAIVMRIFYRESSDLDKRIDYGKMREWKDED |
| Ga0163153_1000288724 | 3300020186 | Freshwater Microbial Mat | MDHRIVLISVVVAVLAVVGYLLVMRVFFRDSKELDKHVDLSKMKEWKDDD |
| Ga0196980_10894962 | 3300021066 | Soil | MDHRIVFIAVGVALIAVIGYVLVMRIFYRESAQLDKTIDYSKMKRWEDED |
| Ga0193706_11581272 | 3300021339 | Soil | MDHRIVFIAVGVALVAVIAYVLVMRVFYRESAELDKTIDYGKMKEWKDDD |
| Ga0193699_102073332 | 3300021363 | Soil | MNQVVMIAVVVGFLVVGGYLLVMRVFFKESKELDKKIDYSKMKEWKDED |
| Ga0213877_102459062 | 3300021372 | Bulk Soil | MSPIVMIAVAVAVFVVAGYLLVMRVFFKDSEQLDKKIDYSKMKEWKDED |
| Ga0210384_103790491 | 3300021432 | Soil | MNNVVFIALGVGLLVVVGYVLVIRVFFKDSEELDKKIDLGKMKK |
| Ga0213880_100296311 | 3300021953 | Exposed Rock | MSPIVMIAVAVAFFVVAGYLLVMRVFFKESKELDKKIDYSKMKEWKEED |
| Ga0247799_10639022 | 3300023072 | Soil | MDHRIALIALGVAVAAVAIYLLVMRVFFRESKELDRKIDYSKMKEWKDED |
| Ga0208356_10132783 | 3300025504 | Arctic Peat Soil | MDRVVWVALLIGLAVVIGYVIVMRVFFKDSKALDKKIDYDKMKAWKDED |
| Ga0207929_10194132 | 3300025505 | Arctic Peat Soil | MNQVVMIAVGVAVAVVVGYLLVMRVFFKDSEALDKKIDYSKVKEWKDED |
| Ga0207682_101546622 | 3300025893 | Miscanthus Rhizosphere | MNHHIAMIALVVGVLVVAGYLLVMRVFFRDSKALDKNIDYSKMKEWKDEED |
| Ga0207682_102286401 | 3300025893 | Miscanthus Rhizosphere | MDHNIVFIALGVAVVAVIGYLLVMRVFFRESAEADKHIDYAKMKKWKDE |
| Ga0207642_101359711 | 3300025899 | Miscanthus Rhizosphere | AGGRMNHQIVMIAVVVGLLVVAGYLLVMRVFFRESEQLDKKIDYSKMKEWKDDED |
| Ga0207680_111909092 | 3300025903 | Switchgrass Rhizosphere | AVPDGGSVDHRIVLISVVVAVIAVIGYLLVMRVFFRESKELDKKIDYAKMKKWEDDPE |
| Ga0207699_101009042 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MTPNVIWITLVAAVVVVGGYLLVMRVFFRDSKELDKKIDYSKMKPWKDDED |
| Ga0207705_100047463 | 3300025909 | Corn Rhizosphere | MDPKIVWIVAIAAGLAIGYLVVMRVFFRESKDLDKKIDYAKMKEWKDED |
| Ga0207705_107168032 | 3300025909 | Corn Rhizosphere | MNHHIAMIALVVGLLVVAGYLLVMRVFFRESKALDKNIDLSKMKEWKDED |
| Ga0207654_103624182 | 3300025911 | Corn Rhizosphere | MDRAVLVALAVGVAVVAAYLLVMRVFFKDSKDLDKKIDYSKVKEWKDDED |
| Ga0207654_105956762 | 3300025911 | Corn Rhizosphere | VDHRIVWISVVVAIFAVIGYLLVMRVFFRESKELDKKIDYTKMKKWEDDPE |
| Ga0207707_102994082 | 3300025912 | Corn Rhizosphere | MDRAVVVALLVGIGVVIAYVVVMRVFFRESRSLDRKIDFDKMRDWKDED |
| Ga0207695_102093952 | 3300025913 | Corn Rhizosphere | MDNAVVVALLVGLAVVLGYVVVMRVFFRESESLDRKIDFGKMRKWEDED |
| Ga0207663_102389872 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | ALAVGLAVVIGYLVVMRVFFRDSKDLDKKIDYSKMKEWKDED |
| Ga0207662_107922092 | 3300025918 | Switchgrass Rhizosphere | MNQHVVMIALAVGALVVVGYIVVMRVFFKESAELDKHIDLTKMKKWRDEDED |
| Ga0207649_108085122 | 3300025920 | Corn Rhizosphere | VDQHTIAIFVAIALGLVVLYFLVMRVFFRDSKALDKKIDYTKMKEWKDED |
| Ga0207646_109856582 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MDHHIVAIAAVVGVLVVAGYLLVMRVFFKESKELDKKIDYSKMKEWKDED |
| Ga0207687_113074951 | 3300025927 | Miscanthus Rhizosphere | QPPTPGVSMNQVVMIAVGVAVLVVAGYLLVMRVFFKDSKELDRKIDYSKMKEWKDED |
| Ga0207690_113604172 | 3300025932 | Corn Rhizosphere | MDPAIVWIVAIAAGLAIGYFIVMRVFFKESKDLDKKIDYSKMKEWKDDE |
| Ga0207711_106689321 | 3300025941 | Switchgrass Rhizosphere | MNHQIVMIAVVVGLLVVAGYLLVMRVFFRESEQLDKKIDYSKMKEWKDDE |
| Ga0207711_117370021 | 3300025941 | Switchgrass Rhizosphere | MIAVVVGLLVVAGYLLVMRVFFRESKELDKKIDYSKMKEWKDDKD |
| Ga0207667_118184301 | 3300025949 | Corn Rhizosphere | LVALAVGLAVVIGYLVVMRVFFRDSKDLDKKIDYSKMKEWKDEE |
| Ga0207667_121420201 | 3300025949 | Corn Rhizosphere | MNHQIVMIAVVVGLLVVAGYLLVMRVFFRESEQLDKKIDYSKMK |
| Ga0207640_113409642 | 3300025981 | Corn Rhizosphere | MNHHVVMIALAVGALVVIGYVIVMRVFFRESAELDKHIDFTKMKQWHDEDDHNGASA |
| Ga0207677_122948092 | 3300026023 | Miscanthus Rhizosphere | VVVAIIAVIGYLLVMRVFFRESKELDKKIDYSKMKEWKDDE |
| Ga0207708_112535032 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | VDHRIVFISVVVAVVAVIGYLLVMRIFYRESSELDKKIDLSKMKEWKDDED |
| Ga0207708_113259831 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | MDPAIVWIVAIAAGLAIGYFIVMRVFFKESKDLDKKIDYSKMKEWKDD |
| Ga0207702_102950912 | 3300026078 | Corn Rhizosphere | MDRAVLVALAVGLAVVIGYLVVMRVFFRDSKDLDKKIDYSKMKEWKDDED |
| Ga0207648_103850872 | 3300026089 | Miscanthus Rhizosphere | VDHRIVLISVVVAVIAVIGYLLVMRVFFRESKELDKKIDYAKMKKWEDEPE |
| Ga0207676_103773832 | 3300026095 | Switchgrass Rhizosphere | MNHHIAMIALVVGVLVVAGYLLVMRVFFRNSKALDKNIDYSKMKEWKDDED |
| Ga0207676_121726512 | 3300026095 | Switchgrass Rhizosphere | MNHQIVMIAVVVGLLVVAGYLLVMRVFFRESEQLDK |
| Ga0207675_1003827602 | 3300026118 | Switchgrass Rhizosphere | MNHHVVMIALAVGALVVIGYVIVMRVFFRESAELDKHIDFTKMKQWHDEDEG |
| Ga0207675_1009937491 | 3300026118 | Switchgrass Rhizosphere | MDPKIVWIVAIAAGLVIGYLVVMRVFFRESKDLDKKIDYSKMKEWKDED |
| Ga0209234_12346953 | 3300026295 | Grasslands Soil | MNQVVTIALVVGLLVVGGYLLVMRVFFRDSKELDKKVDLTKMKPWKDED |
| Ga0209647_10282553 | 3300026319 | Grasslands Soil | MDPLVMFGVVAAILVVGYLLVMRVFFKDSKELDKKIDYSKMKEWKDED |
| Ga0209152_105028861 | 3300026325 | Soil | MDHRIVFIAATVGILVVLGYLLVMRVFFKESKELDKKIDYGKMKEWKDDED |
| Ga0209818_10134342 | 3300027637 | Agricultural Soil | MDHRIVFIAVGVALVAVIAYVLVMRIFYRESAELDKTIDYGKMKEWKDDD |
| Ga0209117_10152212 | 3300027645 | Forest Soil | MDRIILISIVVAIAVALGYVLVMRVFFRQSKELDKKIDYSKVKPWKDDD |
| Ga0209118_12198712 | 3300027674 | Forest Soil | MNQTVMIALAVGIAVVVGYLLVMRVFFKDSKELDKKIDYSKMKEWKDDE |
| Ga0209485_10119393 | 3300027691 | Agricultural Soil | MDHRIVFIAVGVALVAVIAYVLVMRIFYRESAELDKTIDY |
| Ga0209689_10387722 | 3300027748 | Soil | MNQHVVMIALAVGVLVVLGYLLVMRVFFKESEELDKHIDYTKMKKWQDEE |
| Ga0209689_11614432 | 3300027748 | Soil | MDQHVVMISLVVGVLVVVGYLLVMRVFFKESKELDKKIDLSKMKAWKDED |
| Ga0209166_101132312 | 3300027857 | Surface Soil | MNHQAAIIALAVGVLVVLGYILVMRVFFRDSKELDKQVDLTKMKKWQDED |
| Ga0209813_103788222 | 3300027866 | Populus Endosphere | MDHRIVLISVVVAVIAVLGYLLVMRVFFRESKELDKKIDFSKMKEWKDDPE |
| Ga0209579_102771812 | 3300027869 | Surface Soil | MNNVVFIALGVGLVVVVGYVLVIRVFFKDSQALDKNVDLAKMKKWKDED |
| Ga0209486_104974052 | 3300027886 | Agricultural Soil | TVFIAVGVALVAVIAYVLVMRIFYRESAELDKTIDYGKMKEWKDDD |
| Ga0207428_1000230416 | 3300027907 | Populus Rhizosphere | MDHHIVFIAVGVALLVVVGYVVVMRVFYRESTELDKTIDYTKMKEWKDED |
| Ga0268266_102327632 | 3300028379 | Switchgrass Rhizosphere | MDHRIVFISVAVAVLAVVGYLLVMRVFFRESKELDKHVDLSKMKTWEDDDK |
| Ga0268265_101897112 | 3300028380 | Switchgrass Rhizosphere | MDHHIAMIALVVGVLVVAGYLLVMRVFFRDSKALDKNIDYSKMKEWKDDED |
| Ga0247821_109154932 | 3300028596 | Soil | VDHQIVFISVAVAVIAVIGYLLVMRIFYRESSDLDKKIDLSKMKEWKDDED |
| Ga0247819_107958372 | 3300028608 | Soil | MDHRIVFIAVGVALVAVVGYLLVMRIFYRESAELDKSIDHSKMK |
| Ga0307283_102248162 | 3300028790 | Soil | MDHHIAMIALVVGILVVAGYLLVMRVFFRDSKALDKNIDYSKMKEWKDDED |
| Ga0265338_108699102 | 3300028800 | Rhizosphere | MDPVVMVALLVGIGIVVAYIVVMRVFFRESKDLDRKIDYSKIKEWKDED |
| Ga0247824_103213862 | 3300028809 | Soil | MDHRIVFIAVGVALVAVVGYLLVMRIFYRESAELDKSIDHSKMKEWK |
| Ga0247825_101520332 | 3300028812 | Soil | MDHRIVFIAVGVALVAVVGYLLVMRIFYRESAELDKSIDHSKMKEWKDED |
| Ga0247825_111310562 | 3300028812 | Soil | MDHRIVFIAVGVALFAVVGYIIVMRIFYRDSAELDKSIDYSKMKEWKDED |
| Ga0222749_108362682 | 3300029636 | Soil | MNNVVFIALGVGLLVVVGYVLVIRVFFKDSEELDKKIDLGKMKKWKDDD |
| Ga0311349_115533041 | 3300030294 | Fen | VSIFLGVALVIVVGYFLVMRVFFKDSKELDKKIDYAKMKEWKDED |
| Ga0307498_102117141 | 3300031170 | Soil | MDHRIVLIAAAVGIIAVIGYVLVMRVFYRDSKAMDAKIDYAKMKEWKDDD |
| (restricted) Ga0255310_100169582 | 3300031197 | Sandy Soil | MNQVVLIAVVVGLLVVAGYLLVMRVFFKESKELDKKIDYTKMKEWKDED |
| Ga0307497_104433992 | 3300031226 | Soil | MNHQIVMIAVIVGLLVVAGYLLVMRVFFRESQELDKKIDPSKMKKWKDDED |
| Ga0170824_1117259252 | 3300031231 | Forest Soil | MNNVVFIALGVGLLVVVGYVLVIRVFFKESQELDKKVDLGKMKKWKDDED |
| Ga0302323_1021571241 | 3300031232 | Fen | MNTTLWLVLAAVGVVAVYLLVMRVFYRDSREADKHIDYSKVREWKDDKD |
| Ga0265330_104196232 | 3300031235 | Rhizosphere | MNNVMLIALGVGVVVVVGYVLVVRVFFKDSEALDKKIDYSKIKEVKDDED |
| Ga0170820_118281612 | 3300031446 | Forest Soil | MNNVVFIALGVGLLVVVGYVLVIRVFFKESEELDKKVDLGKMKKWKDDED |
| Ga0307505_100031962 | 3300031455 | Soil | MDHRIVFIAVGVALVAVIAYVLVMRVFYRESTELDKTIDYGKMKEWKDED |
| Ga0170818_1042236272 | 3300031474 | Forest Soil | MNNVVFIALGVGLLVVVGYVLVIRVFFKESEELDKKVDLGKMKKWQDDD |
| Ga0310888_104910352 | 3300031538 | Soil | MDHRIVFIAVGVALVAVIGYLLVMRIFYRESAAIDKTIDYSKVKEWKDED |
| Ga0310888_105034102 | 3300031538 | Soil | VDHRIVLISVAVAVVAVVGYLLVMRIFYRESSELDKKIDLSKMKEWKDDED |
| Ga0310888_109163312 | 3300031538 | Soil | MDHRIVFIAVGVALLAVVGYMLVMRVFYRESKELDKSIDYSKMKEWKDED |
| Ga0307408_1004844801 | 3300031548 | Rhizosphere | MDHQIVFIAVGVALLAVIGYVIVMRVFYRESTELDKHIDYSKMKEWKDED |
| Ga0307469_100968293 | 3300031720 | Hardwood Forest Soil | MDHHIVAIAAVVGVLVVAGYLLVMRVFFKESKELDKKIDYSKMKEWKDDED |
| Ga0307469_121037942 | 3300031720 | Hardwood Forest Soil | PQEMNQHIVAIALGVGLLVVAGYLIVMRVFFRESKELDKKIDYSKMKEWRDDED |
| Ga0307405_103604472 | 3300031731 | Rhizosphere | MDHRIVFIAVGVALVAVIGYVIVMRIFYRESAEMDKHIDFSKMKQWKDED |
| Ga0307405_120276672 | 3300031731 | Rhizosphere | IVFIAVGVALVAVIGYVIVMRVFYRESTELDKHIDYSKMKEWKDED |
| Ga0318501_107513041 | 3300031736 | Soil | LEEGLLMDNAVLVALAVGVAVVVGYLLVMRVFFKDSKDLDKKIDYSKMKEWKDDED |
| Ga0307468_1003011522 | 3300031740 | Hardwood Forest Soil | MNAHVVMIALAVGALVVVGYVLVMRVFFKESAELDKKIDLTKMKKWQDDEE |
| Ga0307468_1022835741 | 3300031740 | Hardwood Forest Soil | MDHRIVFIALGVALVAVIGYLLVMRIFYRESAELDKHVDLSKMK |
| Ga0318546_110112402 | 3300031771 | Soil | MDNAVLVALAVGVAVVVGYLLVMRVFFKDSKDLDKKIDYSKMK |
| Ga0307413_101663462 | 3300031824 | Rhizosphere | MDHRIVFIAVGVALVVVIGYALVMRIFYRESGELDKRIDYGKMREWKDED |
| Ga0307413_117215792 | 3300031824 | Rhizosphere | MDHQIVFIAVGVALVAVIGYVIVMRVFYRESTELDKHIDYSKMKEWKDED |
| Ga0307407_114587402 | 3300031903 | Rhizosphere | MDHRIVFIAVGIALVAVIGYLLVMRIFYRESAQLDKTIDYSKVKEWKDED |
| Ga0311367_122976372 | 3300031918 | Fen | MDQAVMIGIAVAVALVVGYLLVMRVFFKDSKELDKKIDYAKMKEWKDED |
| Ga0308175_1032914422 | 3300031938 | Soil | MDQHTIAIFVAVALGLVVLYFLVMRVFFRDSKALDKKIDYTKMKKWKDEDE |
| Ga0308174_108214432 | 3300031939 | Soil | MDPKIVWIVAVAAGLVIGYFVVMRVFFRESKALDKKIDHSKMKEWKDED |
| Ga0308176_112265802 | 3300031996 | Soil | MDQHTLAIYVAVALGLVVLYFLVMRVFFRDSKALDKKIDYSKMKEWKDED |
| Ga0307416_1033162861 | 3300032002 | Rhizosphere | IAVGVALVAVIGYVIVMRVFYRESTELDKHIDYSKMKEWKDED |
| Ga0310895_107772261 | 3300032122 | Soil | NHHIAMIALVVGILVVAGYLLVMRVFFRDSKALDKNIDYSKMKEWKDDED |
| Ga0307415_1022432211 | 3300032126 | Rhizosphere | MDHRIVFIAVGVALVAVIAYVLVMRIFYRESAELDKTIDYGKMKEWKDED |
| Ga0307470_104246973 | 3300032174 | Hardwood Forest Soil | MNQHVAIIALAVGALVVLGYILVMRVFFKESKELDKKIDFTKMKQWKDED |
| Ga0310889_106348272 | 3300032179 | Soil | FISVAVAVIAVIGYLLVMRIFYRESSDLDKKIDLSKMKEWKDDED |
| Ga0307471_1026189902 | 3300032180 | Hardwood Forest Soil | AAAVGVLVVAGYLLVMRVFFKESKELDKKIDYSKMKEWKDDED |
| Ga0335085_101433773 | 3300032770 | Soil | MYNMVFIALGVGAVVVVFYVLVMRVFFRDSRELDKGIDLAKMKKWKDED |
| Ga0335082_1000324415 | 3300032782 | Soil | MSPTVTIAVAVAVFVVAGYLLVMRVFFKESQELDKKIDPAKMKKWKDDED |
| Ga0335082_100118867 | 3300032782 | Soil | MYNTVFIALGVGAVVVVFYVLVMRVFFRDSRELDKGIDLAKMKKWKDED |
| Ga0335080_100834165 | 3300032828 | Soil | MDRAVLVALAVGIAVVVGYLVVMRVFFKESKDLDKKIDLSKMKDWKDDED |
| Ga0335080_120559752 | 3300032828 | Soil | MSPIVMIAVAVALFVVAGYLLVMRVFFKESKELDRKIDYSRMKEWKDEE |
| Ga0335070_100569005 | 3300032829 | Soil | MSPIVTIAVAVALFVVAGYLLVMRVFFKESQELDKKIDHSRMKEWKDED |
| Ga0316620_102622052 | 3300033480 | Soil | MDRAVLVALLVGLVVVLGYGVVMRVFFRDSEALDRKIDYSKMKEWKDED |
| Ga0316624_103406132 | 3300033486 | Soil | MDSVVLIALLVGLGVVLVYVLVMRVFFRDSQALDKKIDYSKMKEWKDED |
| Ga0247830_110006941 | 3300033551 | Soil | MDHRIVFIAVGVALVAVVGYLLVMRIFYRESAELDKSIDHSFILE |
| Ga0372943_0907798_289_441 | 3300034268 | Soil | MDNNVVLTIVAIGVLVVVGYLLVMRVFFRDSKALDKNIDLAKMKKWKDED |
| Ga0364943_0175865_206_355 | 3300034354 | Sediment | MDQAIVWIFVALAAVLVYLLVMRVFFRDSKDLDKKIDHSKMKPWKDDDD |
| Ga0372946_0361868_522_671 | 3300034384 | Soil | MSQVVMIAVAVAVAVVAAYLLVMRVFFKESKALDKKIDYARMKEWKDED |
| ⦗Top⦘ |