NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F014179

Metagenome / Metatranscriptome Family F014179

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F014179
Family Type Metagenome / Metatranscriptome
Number of Sequences 265
Average Sequence Length 44 residues
Representative Sequence AVELAEIFYPKAADEVRRRGWRRVPFEVLGINPPRDLAFKVLAG
Number of Associated Samples 211
Number of Associated Scaffolds 265

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 1.54 %
% of genes near scaffold ends (potentially truncated) 96.23 %
% of genes from short scaffolds (< 2000 bps) 92.08 %
Associated GOLD sequencing projects 201
AlphaFold2 3D model prediction Yes
3D model pTM-score0.45

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (94.717 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(31.698 % of family members)
Environment Ontology (ENVO) Unclassified
(32.453 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(37.358 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 29.17%    β-sheet: 5.56%    Coil/Unstructured: 65.28%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.45
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 265 Family Scaffolds
PF13439Glyco_transf_4 70.57
PF13579Glyco_trans_4_4 14.72
PF00106adh_short 6.42
PF14759Reductase_C 1.89
PF09126NaeI 0.38
PF08241Methyltransf_11 0.38
PF16912Glu_dehyd_C 0.38
PF03747ADP_ribosyl_GH 0.38
PF00271Helicase_C 0.38
PF13271DUF4062 0.38
PF07859Abhydrolase_3 0.38
PF06271RDD 0.38
PF13649Methyltransf_25 0.38

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 265 Family Scaffolds
COG0657Acetyl esterase/lipaseLipid transport and metabolism [I] 0.38
COG1397ADP-ribosylglycohydrolasePosttranslational modification, protein turnover, chaperones [O] 0.38
COG1714Uncharacterized membrane protein YckC, RDD familyFunction unknown [S] 0.38


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms94.72 %
UnclassifiedrootN/A5.28 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2166559006|FI_contig30983All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales513Open in IMG/M
2189573002|GZIGXIF01BAK3ZAll Organisms → cellular organisms → Bacteria → Terrabacteria group502Open in IMG/M
3300000364|INPhiseqgaiiFebDRAFT_104707622All Organisms → cellular organisms → Bacteria → Terrabacteria group647Open in IMG/M
3300000956|JGI10216J12902_115836475All Organisms → cellular organisms → Bacteria → Terrabacteria group628Open in IMG/M
3300001333|A21PFW6_1041196All Organisms → cellular organisms → Bacteria → Terrabacteria group541Open in IMG/M
3300001454|JGI20204J15135_1024953All Organisms → cellular organisms → Bacteria → Terrabacteria group560Open in IMG/M
3300004082|Ga0062384_100389428All Organisms → cellular organisms → Bacteria → Terrabacteria group894Open in IMG/M
3300004479|Ga0062595_101235884All Organisms → cellular organisms → Bacteria → Terrabacteria group666Open in IMG/M
3300004635|Ga0062388_102585659All Organisms → cellular organisms → Bacteria → Terrabacteria group533Open in IMG/M
3300005332|Ga0066388_102467213All Organisms → cellular organisms → Bacteria → Terrabacteria group944Open in IMG/M
3300005338|Ga0068868_101700833All Organisms → cellular organisms → Bacteria → Terrabacteria group594Open in IMG/M
3300005338|Ga0068868_101813595All Organisms → cellular organisms → Bacteria → Terrabacteria group576Open in IMG/M
3300005434|Ga0070709_11392463All Organisms → cellular organisms → Bacteria → Terrabacteria group567Open in IMG/M
3300005435|Ga0070714_102399237All Organisms → cellular organisms → Bacteria → Terrabacteria group512Open in IMG/M
3300005435|Ga0070714_102478705All Organisms → cellular organisms → Bacteria → Terrabacteria group503Open in IMG/M
3300005436|Ga0070713_102260015All Organisms → cellular organisms → Bacteria → Terrabacteria group527Open in IMG/M
3300005440|Ga0070705_100856758All Organisms → cellular organisms → Bacteria → Terrabacteria group727Open in IMG/M
3300005445|Ga0070708_100464622All Organisms → cellular organisms → Bacteria → Terrabacteria group1194Open in IMG/M
3300005451|Ga0066681_10094064All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria1706Open in IMG/M
3300005467|Ga0070706_100066575All Organisms → cellular organisms → Bacteria3332Open in IMG/M
3300005545|Ga0070695_100078059All Organisms → cellular organisms → Bacteria → Terrabacteria group2182Open in IMG/M
3300005548|Ga0070665_101939841All Organisms → cellular organisms → Bacteria → Terrabacteria group594Open in IMG/M
3300005574|Ga0066694_10289961All Organisms → cellular organisms → Bacteria → Terrabacteria group779Open in IMG/M
3300005602|Ga0070762_10859405All Organisms → cellular organisms → Bacteria → Terrabacteria group616Open in IMG/M
3300005610|Ga0070763_10807414All Organisms → cellular organisms → Bacteria → Terrabacteria group554Open in IMG/M
3300005614|Ga0068856_100537393All Organisms → cellular organisms → Bacteria → Terrabacteria group1190Open in IMG/M
3300005614|Ga0068856_101332049All Organisms → cellular organisms → Bacteria → Terrabacteria group733Open in IMG/M
3300005618|Ga0068864_102606090All Organisms → cellular organisms → Bacteria → Terrabacteria group511Open in IMG/M
3300005921|Ga0070766_10919669All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium599Open in IMG/M
3300006059|Ga0075017_100627944All Organisms → cellular organisms → Bacteria → Terrabacteria group823Open in IMG/M
3300006086|Ga0075019_11077545All Organisms → cellular organisms → Bacteria → Terrabacteria group521Open in IMG/M
3300006102|Ga0075015_100787851All Organisms → cellular organisms → Bacteria → Terrabacteria group570Open in IMG/M
3300006173|Ga0070716_101661309All Organisms → cellular organisms → Bacteria → Terrabacteria group526Open in IMG/M
3300006791|Ga0066653_10569060All Organisms → cellular organisms → Bacteria → Terrabacteria group574Open in IMG/M
3300006791|Ga0066653_10759351All Organisms → cellular organisms → Bacteria → Terrabacteria group507Open in IMG/M
3300006796|Ga0066665_10892311All Organisms → cellular organisms → Bacteria → Terrabacteria group690Open in IMG/M
3300006847|Ga0075431_100802584All Organisms → cellular organisms → Bacteria → Terrabacteria group914Open in IMG/M
3300006871|Ga0075434_100310807All Organisms → cellular organisms → Bacteria1596Open in IMG/M
3300007255|Ga0099791_10642291All Organisms → cellular organisms → Bacteria → Terrabacteria group520Open in IMG/M
3300007788|Ga0099795_10501523All Organisms → cellular organisms → Bacteria → Terrabacteria group566Open in IMG/M
3300009038|Ga0099829_11255846All Organisms → cellular organisms → Bacteria → Terrabacteria group613Open in IMG/M
3300009088|Ga0099830_11299304All Organisms → cellular organisms → Bacteria → Terrabacteria group605Open in IMG/M
3300009098|Ga0105245_11055747All Organisms → cellular organisms → Bacteria → Terrabacteria group858Open in IMG/M
3300009148|Ga0105243_11266680All Organisms → cellular organisms → Bacteria → Terrabacteria group753Open in IMG/M
3300009174|Ga0105241_11191600All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia721Open in IMG/M
3300009177|Ga0105248_12575195All Organisms → cellular organisms → Bacteria → Terrabacteria group580Open in IMG/M
3300009523|Ga0116221_1523735All Organisms → cellular organisms → Bacteria → Terrabacteria group520Open in IMG/M
3300009698|Ga0116216_10099981All Organisms → cellular organisms → Bacteria1785Open in IMG/M
3300009792|Ga0126374_11740278All Organisms → cellular organisms → Bacteria → Terrabacteria group519Open in IMG/M
3300009826|Ga0123355_11797209All Organisms → cellular organisms → Bacteria → Terrabacteria group578Open in IMG/M
3300010043|Ga0126380_12015593All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium528Open in IMG/M
3300010048|Ga0126373_11731807All Organisms → cellular organisms → Bacteria → Terrabacteria group689Open in IMG/M
3300010048|Ga0126373_12391796All Organisms → cellular organisms → Bacteria → Terrabacteria group588Open in IMG/M
3300010335|Ga0134063_10296200All Organisms → cellular organisms → Bacteria → Terrabacteria group777Open in IMG/M
3300010360|Ga0126372_10048644All Organisms → cellular organisms → Bacteria2850Open in IMG/M
3300010361|Ga0126378_11942168All Organisms → cellular organisms → Bacteria → Terrabacteria group670Open in IMG/M
3300010366|Ga0126379_10395086All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae1429Open in IMG/M
3300010373|Ga0134128_10966689All Organisms → cellular organisms → Bacteria → Terrabacteria group942Open in IMG/M
3300010373|Ga0134128_11181782All Organisms → cellular organisms → Bacteria → Terrabacteria group844Open in IMG/M
3300010373|Ga0134128_12912746All Organisms → cellular organisms → Bacteria → Terrabacteria group527Open in IMG/M
3300011119|Ga0105246_10574825All Organisms → cellular organisms → Bacteria → Terrabacteria group970Open in IMG/M
3300011271|Ga0137393_11656366All Organisms → cellular organisms → Bacteria → Terrabacteria group529Open in IMG/M
3300012189|Ga0137388_10607901All Organisms → cellular organisms → Bacteria → Terrabacteria group1016Open in IMG/M
3300012199|Ga0137383_11253377All Organisms → cellular organisms → Bacteria → Terrabacteria group531Open in IMG/M
3300012206|Ga0137380_10173019All Organisms → cellular organisms → Bacteria1965Open in IMG/M
3300012206|Ga0137380_10481014All Organisms → cellular organisms → Bacteria → Terrabacteria group1096Open in IMG/M
3300012211|Ga0137377_11962292All Organisms → cellular organisms → Bacteria → Terrabacteria group501Open in IMG/M
3300012354|Ga0137366_11106902All Organisms → cellular organisms → Bacteria → Terrabacteria group544Open in IMG/M
3300012355|Ga0137369_11100377All Organisms → cellular organisms → Bacteria → Terrabacteria group519Open in IMG/M
3300012357|Ga0137384_10509988All Organisms → cellular organisms → Bacteria → Terrabacteria group987Open in IMG/M
3300012362|Ga0137361_10287953All Organisms → cellular organisms → Bacteria1502Open in IMG/M
3300012500|Ga0157314_1023346All Organisms → cellular organisms → Bacteria → Terrabacteria group647Open in IMG/M
3300012683|Ga0137398_10092820All Organisms → cellular organisms → Bacteria1885Open in IMG/M
3300012915|Ga0157302_10098850All Organisms → cellular organisms → Bacteria917Open in IMG/M
3300012958|Ga0164299_11154744All Organisms → cellular organisms → Bacteria → Terrabacteria group583Open in IMG/M
3300012984|Ga0164309_10771509All Organisms → cellular organisms → Bacteria → Terrabacteria group771Open in IMG/M
3300012988|Ga0164306_10118475All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → Ktedonobacter racemifer1759Open in IMG/M
3300012988|Ga0164306_10153510All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1572Open in IMG/M
3300012989|Ga0164305_11442318All Organisms → cellular organisms → Bacteria → Terrabacteria group608Open in IMG/M
3300013105|Ga0157369_11160092All Organisms → cellular organisms → Bacteria → Terrabacteria group789Open in IMG/M
3300013307|Ga0157372_11781601All Organisms → cellular organisms → Bacteria → Terrabacteria group708Open in IMG/M
3300013758|Ga0120147_1006198All Organisms → cellular organisms → Bacteria2707Open in IMG/M
3300013763|Ga0120179_1089936All Organisms → cellular organisms → Bacteria680Open in IMG/M
3300014827|Ga0120171_1130096All Organisms → cellular organisms → Bacteria → Terrabacteria group598Open in IMG/M
3300015242|Ga0137412_11258557All Organisms → cellular organisms → Bacteria → Terrabacteria group517Open in IMG/M
3300016270|Ga0182036_10473263All Organisms → cellular organisms → Bacteria → Terrabacteria group988Open in IMG/M
3300016341|Ga0182035_10170448All Organisms → cellular organisms → Bacteria1694Open in IMG/M
3300016341|Ga0182035_11002311All Organisms → cellular organisms → Bacteria → Terrabacteria group740Open in IMG/M
3300016341|Ga0182035_11668234All Organisms → cellular organisms → Bacteria → Terrabacteria group576Open in IMG/M
3300016387|Ga0182040_11751530All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium531Open in IMG/M
3300016422|Ga0182039_10729731All Organisms → cellular organisms → Bacteria → Terrabacteria group875Open in IMG/M
3300016422|Ga0182039_10984692All Organisms → cellular organisms → Bacteria → Terrabacteria group756Open in IMG/M
3300017926|Ga0187807_1069198All Organisms → cellular organisms → Bacteria → Terrabacteria group1099Open in IMG/M
3300017933|Ga0187801_10169188All Organisms → cellular organisms → Bacteria → Terrabacteria group857Open in IMG/M
3300017942|Ga0187808_10308659All Organisms → cellular organisms → Bacteria → Terrabacteria group714Open in IMG/M
3300017942|Ga0187808_10597782All Organisms → cellular organisms → Bacteria → Terrabacteria group512Open in IMG/M
3300017943|Ga0187819_10139604All Organisms → cellular organisms → Bacteria1444Open in IMG/M
3300017955|Ga0187817_10322506All Organisms → cellular organisms → Bacteria → Terrabacteria group985Open in IMG/M
3300017955|Ga0187817_10633951All Organisms → cellular organisms → Bacteria → Terrabacteria group682Open in IMG/M
3300017970|Ga0187783_10905548All Organisms → cellular organisms → Bacteria → Terrabacteria group636Open in IMG/M
3300017974|Ga0187777_10339191Not Available1032Open in IMG/M
3300017999|Ga0187767_10199554All Organisms → cellular organisms → Bacteria → Terrabacteria group631Open in IMG/M
3300018058|Ga0187766_11202184All Organisms → cellular organisms → Bacteria → Terrabacteria group549Open in IMG/M
3300018060|Ga0187765_10914636All Organisms → cellular organisms → Bacteria → Terrabacteria group595Open in IMG/M
3300019888|Ga0193751_1197263All Organisms → cellular organisms → Bacteria → Terrabacteria group677Open in IMG/M
3300020580|Ga0210403_11202732All Organisms → cellular organisms → Bacteria → Terrabacteria group584Open in IMG/M
3300020582|Ga0210395_10296011All Organisms → cellular organisms → Bacteria → Terrabacteria group1217Open in IMG/M
3300021168|Ga0210406_10674631All Organisms → cellular organisms → Bacteria → Terrabacteria group799Open in IMG/M
3300021171|Ga0210405_10039056All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3779Open in IMG/M
3300021178|Ga0210408_10222191All Organisms → cellular organisms → Bacteria1503Open in IMG/M
3300021363|Ga0193699_10162513All Organisms → cellular organisms → Bacteria → Terrabacteria group921Open in IMG/M
3300021401|Ga0210393_11584505All Organisms → cellular organisms → Bacteria → Terrabacteria group520Open in IMG/M
3300021401|Ga0210393_11674040All Organisms → cellular organisms → Bacteria → Terrabacteria group503Open in IMG/M
3300021406|Ga0210386_10237041All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1554Open in IMG/M
3300021406|Ga0210386_10854761All Organisms → cellular organisms → Bacteria → Terrabacteria group780Open in IMG/M
3300021406|Ga0210386_11771922All Organisms → cellular organisms → Bacteria → Terrabacteria group509Open in IMG/M
3300021406|Ga0210386_11821103All Organisms → cellular organisms → Bacteria → Terrabacteria group500Open in IMG/M
3300021407|Ga0210383_10772612All Organisms → cellular organisms → Bacteria → Terrabacteria group823Open in IMG/M
3300021407|Ga0210383_10984839All Organisms → cellular organisms → Bacteria → Terrabacteria group716Open in IMG/M
3300021479|Ga0210410_10667077All Organisms → cellular organisms → Bacteria → Terrabacteria group920Open in IMG/M
3300021479|Ga0210410_11289090All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium623Open in IMG/M
3300021560|Ga0126371_12264499All Organisms → cellular organisms → Bacteria → Terrabacteria group656Open in IMG/M
3300022714|Ga0242671_1073999All Organisms → cellular organisms → Bacteria → Terrabacteria group608Open in IMG/M
3300025899|Ga0207642_10049964All Organisms → cellular organisms → Bacteria → Terrabacteria group1883Open in IMG/M
3300025900|Ga0207710_10758965All Organisms → cellular organisms → Bacteria → Terrabacteria group510Open in IMG/M
3300025903|Ga0207680_11358073All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium505Open in IMG/M
3300025905|Ga0207685_10011339All Organisms → cellular organisms → Bacteria2676Open in IMG/M
3300025905|Ga0207685_10195326All Organisms → cellular organisms → Bacteria → Terrabacteria group947Open in IMG/M
3300025910|Ga0207684_10110918All Organisms → cellular organisms → Bacteria → Terrabacteria group2348Open in IMG/M
3300025916|Ga0207663_10527811All Organisms → cellular organisms → Bacteria → Terrabacteria group920Open in IMG/M
3300025917|Ga0207660_10349791All Organisms → cellular organisms → Bacteria → Terrabacteria group1184Open in IMG/M
3300025917|Ga0207660_11070758All Organisms → cellular organisms → Bacteria → Terrabacteria group657Open in IMG/M
3300025928|Ga0207700_10612048All Organisms → cellular organisms → Bacteria → Terrabacteria group970Open in IMG/M
3300025929|Ga0207664_11322166All Organisms → cellular organisms → Bacteria → Terrabacteria group641Open in IMG/M
3300025935|Ga0207709_11309498All Organisms → cellular organisms → Bacteria → Terrabacteria group599Open in IMG/M
3300025936|Ga0207670_11704302Not Available536Open in IMG/M
3300026035|Ga0207703_10691962All Organisms → cellular organisms → Bacteria → Terrabacteria group969Open in IMG/M
3300026075|Ga0207708_10605947All Organisms → cellular organisms → Bacteria → Terrabacteria group928Open in IMG/M
3300026078|Ga0207702_11678933All Organisms → cellular organisms → Bacteria → Terrabacteria group628Open in IMG/M
3300026089|Ga0207648_11304697All Organisms → cellular organisms → Bacteria → Terrabacteria group682Open in IMG/M
3300026116|Ga0207674_10083397All Organisms → cellular organisms → Bacteria3196Open in IMG/M
3300026551|Ga0209648_10098010All Organisms → cellular organisms → Bacteria2408Open in IMG/M
3300026551|Ga0209648_10214227All Organisms → cellular organisms → Bacteria1457Open in IMG/M
3300027334|Ga0209529_1065656All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium617Open in IMG/M
3300027648|Ga0209420_1010896All Organisms → cellular organisms → Bacteria → Terrabacteria group3238Open in IMG/M
3300027905|Ga0209415_10640749All Organisms → cellular organisms → Bacteria → Terrabacteria group776Open in IMG/M
3300027986|Ga0209168_10087389All Organisms → cellular organisms → Bacteria1619Open in IMG/M
3300027986|Ga0209168_10473826All Organisms → cellular organisms → Bacteria → Terrabacteria group606Open in IMG/M
3300028379|Ga0268266_12259997All Organisms → cellular organisms → Bacteria → Terrabacteria group515Open in IMG/M
3300028589|Ga0247818_10814339All Organisms → cellular organisms → Bacteria → Terrabacteria group653Open in IMG/M
3300028589|Ga0247818_11353877All Organisms → cellular organisms → Bacteria → Terrabacteria group512Open in IMG/M
3300028784|Ga0307282_10553609All Organisms → cellular organisms → Bacteria → Terrabacteria group558Open in IMG/M
3300028792|Ga0307504_10135988All Organisms → cellular organisms → Bacteria → Terrabacteria group821Open in IMG/M
3300028793|Ga0307299_10398519All Organisms → cellular organisms → Bacteria → Terrabacteria group516Open in IMG/M
3300028824|Ga0307310_10592835All Organisms → cellular organisms → Bacteria → Terrabacteria group564Open in IMG/M
3300028878|Ga0307278_10471786All Organisms → cellular organisms → Bacteria → Terrabacteria group549Open in IMG/M
3300028885|Ga0307304_10496884All Organisms → cellular organisms → Bacteria → Terrabacteria group559Open in IMG/M
3300029999|Ga0311339_10360531All Organisms → cellular organisms → Bacteria1533Open in IMG/M
3300030007|Ga0311338_10920188All Organisms → cellular organisms → Bacteria → Terrabacteria group857Open in IMG/M
3300030618|Ga0311354_10049054All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria4928Open in IMG/M
3300030618|Ga0311354_10876664All Organisms → cellular organisms → Bacteria → Terrabacteria group839Open in IMG/M
3300030730|Ga0307482_1193601All Organisms → cellular organisms → Bacteria → Terrabacteria group614Open in IMG/M
3300031231|Ga0170824_104880437All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium633Open in IMG/M
3300031231|Ga0170824_106304471All Organisms → cellular organisms → Bacteria → Terrabacteria group504Open in IMG/M
3300031446|Ga0170820_17750120All Organisms → cellular organisms → Bacteria → Terrabacteria group721Open in IMG/M
3300031525|Ga0302326_10191576All Organisms → cellular organisms → Bacteria3433Open in IMG/M
3300031544|Ga0318534_10640064All Organisms → cellular organisms → Bacteria → Terrabacteria group603Open in IMG/M
3300031549|Ga0318571_10110185All Organisms → cellular organisms → Bacteria → Terrabacteria group912Open in IMG/M
3300031564|Ga0318573_10111257All Organisms → cellular organisms → Bacteria1414Open in IMG/M
3300031564|Ga0318573_10196652All Organisms → cellular organisms → Bacteria → Terrabacteria group1068Open in IMG/M
3300031564|Ga0318573_10462997All Organisms → cellular organisms → Bacteria → Terrabacteria group682Open in IMG/M
3300031572|Ga0318515_10579628All Organisms → cellular organisms → Bacteria → Terrabacteria group597Open in IMG/M
3300031573|Ga0310915_10419337All Organisms → cellular organisms → Bacteria → Terrabacteria group951Open in IMG/M
3300031640|Ga0318555_10206629All Organisms → cellular organisms → Bacteria → Terrabacteria group1059Open in IMG/M
3300031668|Ga0318542_10260933All Organisms → cellular organisms → Bacteria → Terrabacteria group883Open in IMG/M
3300031668|Ga0318542_10537515All Organisms → cellular organisms → Bacteria → Terrabacteria group608Open in IMG/M
3300031680|Ga0318574_10910650All Organisms → cellular organisms → Bacteria → Terrabacteria group515Open in IMG/M
3300031716|Ga0310813_11877167All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium564Open in IMG/M
3300031719|Ga0306917_10641538All Organisms → cellular organisms → Bacteria → Terrabacteria group835Open in IMG/M
3300031719|Ga0306917_10667931All Organisms → cellular organisms → Bacteria → Terrabacteria group817Open in IMG/M
3300031720|Ga0307469_11217284All Organisms → cellular organisms → Bacteria → Terrabacteria group712Open in IMG/M
3300031724|Ga0318500_10671419All Organisms → cellular organisms → Bacteria → Terrabacteria group527Open in IMG/M
3300031744|Ga0306918_10498636All Organisms → cellular organisms → Bacteria → Terrabacteria group953Open in IMG/M
3300031747|Ga0318502_10004927All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria5622Open in IMG/M
3300031747|Ga0318502_10682271All Organisms → cellular organisms → Bacteria → Terrabacteria group620Open in IMG/M
3300031751|Ga0318494_10292635All Organisms → cellular organisms → Bacteria → Terrabacteria group938Open in IMG/M
3300031751|Ga0318494_10409427All Organisms → cellular organisms → Bacteria → Terrabacteria group787Open in IMG/M
3300031765|Ga0318554_10456043All Organisms → cellular organisms → Bacteria → Terrabacteria group724Open in IMG/M
3300031765|Ga0318554_10821013All Organisms → cellular organisms → Bacteria → Terrabacteria group519Open in IMG/M
3300031768|Ga0318509_10226926Not Available1041Open in IMG/M
3300031769|Ga0318526_10090076Not Available1217Open in IMG/M
3300031769|Ga0318526_10409977All Organisms → cellular organisms → Bacteria → Terrabacteria group554Open in IMG/M
3300031770|Ga0318521_10146071All Organisms → cellular organisms → Bacteria → Terrabacteria group1340Open in IMG/M
3300031771|Ga0318546_10796086All Organisms → cellular organisms → Bacteria → Terrabacteria group665Open in IMG/M
3300031779|Ga0318566_10648746All Organisms → cellular organisms → Bacteria → Terrabacteria group513Open in IMG/M
3300031792|Ga0318529_10036702All Organisms → cellular organisms → Bacteria2061Open in IMG/M
3300031793|Ga0318548_10265199All Organisms → cellular organisms → Bacteria → Terrabacteria group844Open in IMG/M
3300031795|Ga0318557_10434722All Organisms → cellular organisms → Bacteria → Terrabacteria group603Open in IMG/M
3300031796|Ga0318576_10246612All Organisms → cellular organisms → Bacteria → Terrabacteria group842Open in IMG/M
3300031796|Ga0318576_10334711All Organisms → cellular organisms → Bacteria → Terrabacteria group715Open in IMG/M
3300031796|Ga0318576_10537223All Organisms → cellular organisms → Bacteria → Terrabacteria group551Open in IMG/M
3300031799|Ga0318565_10457835All Organisms → cellular organisms → Bacteria → Terrabacteria group617Open in IMG/M
3300031805|Ga0318497_10186884All Organisms → cellular organisms → Bacteria → Terrabacteria group1142Open in IMG/M
3300031819|Ga0318568_10699752All Organisms → cellular organisms → Bacteria → Terrabacteria group630Open in IMG/M
3300031820|Ga0307473_10381030All Organisms → cellular organisms → Bacteria → Terrabacteria group918Open in IMG/M
3300031823|Ga0307478_11075531All Organisms → cellular organisms → Bacteria → Terrabacteria group671Open in IMG/M
3300031835|Ga0318517_10114143Not Available1192Open in IMG/M
3300031845|Ga0318511_10076258All Organisms → cellular organisms → Bacteria1393Open in IMG/M
3300031845|Ga0318511_10503102All Organisms → cellular organisms → Bacteria → Terrabacteria group561Open in IMG/M
3300031845|Ga0318511_10509887All Organisms → cellular organisms → Bacteria → Terrabacteria group557Open in IMG/M
3300031846|Ga0318512_10093203All Organisms → cellular organisms → Bacteria1407Open in IMG/M
3300031859|Ga0318527_10158253All Organisms → cellular organisms → Bacteria → Terrabacteria group952Open in IMG/M
3300031859|Ga0318527_10320103All Organisms → cellular organisms → Bacteria → Terrabacteria group661Open in IMG/M
3300031860|Ga0318495_10334778All Organisms → cellular organisms → Bacteria → Terrabacteria group671Open in IMG/M
3300031860|Ga0318495_10361789All Organisms → cellular organisms → Bacteria → Terrabacteria group642Open in IMG/M
3300031879|Ga0306919_10105736All Organisms → cellular organisms → Bacteria1989Open in IMG/M
3300031894|Ga0318522_10318852All Organisms → cellular organisms → Bacteria → Terrabacteria group589Open in IMG/M
3300031896|Ga0318551_10279311All Organisms → cellular organisms → Bacteria → Terrabacteria group937Open in IMG/M
3300031897|Ga0318520_10083027All Organisms → cellular organisms → Bacteria1765Open in IMG/M
3300031910|Ga0306923_10195457All Organisms → cellular organisms → Bacteria2312Open in IMG/M
3300031910|Ga0306923_12232961All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium548Open in IMG/M
3300031941|Ga0310912_11293577All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium553Open in IMG/M
3300031941|Ga0310912_11367388All Organisms → cellular organisms → Bacteria → Terrabacteria group535Open in IMG/M
3300031941|Ga0310912_11448715All Organisms → cellular organisms → Bacteria → Terrabacteria group518Open in IMG/M
3300031947|Ga0310909_11590946All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium518Open in IMG/M
3300031954|Ga0306926_10628141Not Available1309Open in IMG/M
3300031981|Ga0318531_10281863All Organisms → cellular organisms → Bacteria → Terrabacteria group751Open in IMG/M
3300032001|Ga0306922_10409937All Organisms → cellular organisms → Bacteria1451Open in IMG/M
3300032001|Ga0306922_10655210All Organisms → cellular organisms → Bacteria → Terrabacteria group1109Open in IMG/M
3300032008|Ga0318562_10396880All Organisms → cellular organisms → Bacteria → Terrabacteria group802Open in IMG/M
3300032009|Ga0318563_10150265Not Available1249Open in IMG/M
3300032010|Ga0318569_10576523All Organisms → cellular organisms → Bacteria → Terrabacteria group524Open in IMG/M
3300032025|Ga0318507_10527259All Organisms → cellular organisms → Bacteria → Terrabacteria group514Open in IMG/M
3300032035|Ga0310911_10828157All Organisms → cellular organisms → Bacteria → Terrabacteria group535Open in IMG/M
3300032064|Ga0318510_10410644All Organisms → cellular organisms → Bacteria → Terrabacteria group578Open in IMG/M
3300032067|Ga0318524_10216666All Organisms → cellular organisms → Bacteria → Terrabacteria group981Open in IMG/M
3300032067|Ga0318524_10744297All Organisms → cellular organisms → Bacteria → Terrabacteria group518Open in IMG/M
3300032068|Ga0318553_10120057All Organisms → cellular organisms → Bacteria1351Open in IMG/M
3300032076|Ga0306924_11987116All Organisms → cellular organisms → Bacteria → Terrabacteria group600Open in IMG/M
3300032089|Ga0318525_10232981All Organisms → cellular organisms → Bacteria → Terrabacteria group947Open in IMG/M
3300032091|Ga0318577_10317191All Organisms → cellular organisms → Bacteria → Terrabacteria group746Open in IMG/M
3300032091|Ga0318577_10551921All Organisms → cellular organisms → Bacteria → Terrabacteria group548Open in IMG/M
3300032180|Ga0307471_100627260Not Available1236Open in IMG/M
3300032180|Ga0307471_101166995All Organisms → cellular organisms → Bacteria → Terrabacteria group935Open in IMG/M
3300032261|Ga0306920_102266769All Organisms → cellular organisms → Bacteria → Terrabacteria group753Open in IMG/M
3300032261|Ga0306920_104186088All Organisms → cellular organisms → Bacteria → Terrabacteria group520Open in IMG/M
3300032829|Ga0335070_11348662All Organisms → cellular organisms → Bacteria → Terrabacteria group652Open in IMG/M
3300032895|Ga0335074_11401327All Organisms → cellular organisms → Bacteria → Terrabacteria group566Open in IMG/M
3300032896|Ga0335075_10685810All Organisms → cellular organisms → Bacteria → Terrabacteria group989Open in IMG/M
3300032896|Ga0335075_11039690All Organisms → cellular organisms → Bacteria → Terrabacteria group730Open in IMG/M
3300032896|Ga0335075_11550569All Organisms → cellular organisms → Bacteria → Terrabacteria group548Open in IMG/M
3300032955|Ga0335076_11599688All Organisms → cellular organisms → Bacteria → Terrabacteria group539Open in IMG/M
3300033134|Ga0335073_10241893All Organisms → cellular organisms → Bacteria2206Open in IMG/M
3300033158|Ga0335077_10739847Not Available1008Open in IMG/M
3300033289|Ga0310914_10888538All Organisms → cellular organisms → Bacteria → Terrabacteria group790Open in IMG/M
3300033289|Ga0310914_11235128All Organisms → cellular organisms → Bacteria → Terrabacteria group649Open in IMG/M
3300033290|Ga0318519_10131194All Organisms → cellular organisms → Bacteria → Terrabacteria group1383Open in IMG/M
3300033290|Ga0318519_10441078All Organisms → cellular organisms → Bacteria → Terrabacteria group779Open in IMG/M
3300033550|Ga0247829_11334323All Organisms → cellular organisms → Bacteria → Terrabacteria group593Open in IMG/M
3300033803|Ga0314862_0168240All Organisms → cellular organisms → Bacteria → Terrabacteria group537Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil31.70%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil7.17%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil6.04%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil5.66%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere5.66%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil3.02%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil3.02%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment2.64%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil2.64%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil2.26%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland1.89%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa1.89%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.89%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost1.51%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.51%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.51%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds1.13%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.13%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil1.13%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil1.13%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil1.13%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil1.13%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil1.13%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere1.13%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil0.75%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.75%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.75%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.75%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.75%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.75%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.75%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.75%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.75%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.38%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil0.38%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.38%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil0.38%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil0.38%
PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland0.38%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.38%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.38%
Termite GutHost-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut0.38%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere0.38%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.38%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2166559006Grass soil microbial communities from Rothamsted Park, UK - FI (heavy metals 2g/kg) assembledEnvironmentalOpen in IMG/M
2189573002Grass soil microbial communities from Rothamsted Park, UK - FE1 (NaCl 30g/L 5ml)EnvironmentalOpen in IMG/M
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300001333Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A21-PF)- 6 month illuminaEnvironmentalOpen in IMG/M
3300001454Arctic peat soil from Barrow, Alaska - NGEE Surface sample F53-1 shallow-092012EnvironmentalOpen in IMG/M
3300004082Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3EnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300004635Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005338Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2Host-AssociatedOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005440Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaGEnvironmentalOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005451Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130EnvironmentalOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005536Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaGEnvironmentalOpen in IMG/M
3300005545Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaGEnvironmentalOpen in IMG/M
3300005548Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaGHost-AssociatedOpen in IMG/M
3300005574Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143EnvironmentalOpen in IMG/M
3300005602Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2EnvironmentalOpen in IMG/M
3300005610Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3EnvironmentalOpen in IMG/M
3300005614Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2Host-AssociatedOpen in IMG/M
3300005618Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2Host-AssociatedOpen in IMG/M
3300005921Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6EnvironmentalOpen in IMG/M
3300006059Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012EnvironmentalOpen in IMG/M
3300006086Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013EnvironmentalOpen in IMG/M
3300006102Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013EnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006791Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102EnvironmentalOpen in IMG/M
3300006796Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114EnvironmentalOpen in IMG/M
3300006847Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5Host-AssociatedOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300007255Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1EnvironmentalOpen in IMG/M
3300007788Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2EnvironmentalOpen in IMG/M
3300009038Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaGEnvironmentalOpen in IMG/M
3300009088Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaGEnvironmentalOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300009523Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaGEnvironmentalOpen in IMG/M
3300009698Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaGEnvironmentalOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300009826Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1Host-AssociatedOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010335Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300011119Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaGHost-AssociatedOpen in IMG/M
3300011271Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaGEnvironmentalOpen in IMG/M
3300012189Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaGEnvironmentalOpen in IMG/M
3300012199Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012206Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012354Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012355Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaGEnvironmentalOpen in IMG/M
3300012357Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012362Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaGEnvironmentalOpen in IMG/M
3300012500Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610Host-AssociatedOpen in IMG/M
3300012683Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaGEnvironmentalOpen in IMG/M
3300012915Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2EnvironmentalOpen in IMG/M
3300012958Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MGEnvironmentalOpen in IMG/M
3300012984Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MGEnvironmentalOpen in IMG/M
3300012988Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300013105Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaGHost-AssociatedOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300013758Permafrost microbial communities from Nunavut, Canada - A24_65cm_12MEnvironmentalOpen in IMG/M
3300013763Permafrost microbial communities from Nunavut, Canada - A15_65cm_0MEnvironmentalOpen in IMG/M
3300014827Permafrost microbial communities from Nunavut, Canada - A3_80cm_18MEnvironmentalOpen in IMG/M
3300015242Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300016270Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080EnvironmentalOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300016387Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176EnvironmentalOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300017926Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2EnvironmentalOpen in IMG/M
3300017933Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1EnvironmentalOpen in IMG/M
3300017942Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3EnvironmentalOpen in IMG/M
3300017943Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4EnvironmentalOpen in IMG/M
3300017955Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2EnvironmentalOpen in IMG/M
3300017970Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300017974Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MGEnvironmentalOpen in IMG/M
3300017999Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_10_MGEnvironmentalOpen in IMG/M
3300018058Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MGEnvironmentalOpen in IMG/M
3300018060Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MGEnvironmentalOpen in IMG/M
3300019888Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2EnvironmentalOpen in IMG/M
3300020580Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-MEnvironmentalOpen in IMG/M
3300020582Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-OEnvironmentalOpen in IMG/M
3300021168Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-MEnvironmentalOpen in IMG/M
3300021171Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-MEnvironmentalOpen in IMG/M
3300021178Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-MEnvironmentalOpen in IMG/M
3300021363Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c2EnvironmentalOpen in IMG/M
3300021401Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-OEnvironmentalOpen in IMG/M
3300021406Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-OEnvironmentalOpen in IMG/M
3300021407Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-OEnvironmentalOpen in IMG/M
3300021479Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-MEnvironmentalOpen in IMG/M
3300021559Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300022714Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300025899Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025900Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025903Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025905Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025917Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025935Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025936Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026035Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026075Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026078Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026089Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026116Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026551Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes)EnvironmentalOpen in IMG/M
3300027334Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300027648Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300027905Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes)EnvironmentalOpen in IMG/M
3300027986Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300028379Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300028589Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day1EnvironmentalOpen in IMG/M
3300028784Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121EnvironmentalOpen in IMG/M
3300028792Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_SEnvironmentalOpen in IMG/M
3300028793Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159EnvironmentalOpen in IMG/M
3300028824Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197EnvironmentalOpen in IMG/M
3300028878Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117EnvironmentalOpen in IMG/M
3300028885Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185EnvironmentalOpen in IMG/M
3300029999I_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030007I_Palsa_E1 coassemblyEnvironmentalOpen in IMG/M
3300030618II_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030730Metatranscriptome of hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031446Fir Summer Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031525Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3EnvironmentalOpen in IMG/M
3300031544Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26EnvironmentalOpen in IMG/M
3300031549Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24EnvironmentalOpen in IMG/M
3300031564Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21EnvironmentalOpen in IMG/M
3300031572Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19EnvironmentalOpen in IMG/M
3300031573Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111EnvironmentalOpen in IMG/M
3300031640Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23EnvironmentalOpen in IMG/M
3300031668Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23EnvironmentalOpen in IMG/M
3300031680Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22EnvironmentalOpen in IMG/M
3300031716Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3EnvironmentalOpen in IMG/M
3300031719Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2)EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031724Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20EnvironmentalOpen in IMG/M
3300031744Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)EnvironmentalOpen in IMG/M
3300031747Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22EnvironmentalOpen in IMG/M
3300031751Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24EnvironmentalOpen in IMG/M
3300031765Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22EnvironmentalOpen in IMG/M
3300031768Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22EnvironmentalOpen in IMG/M
3300031769Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24EnvironmentalOpen in IMG/M
3300031770Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17EnvironmentalOpen in IMG/M
3300031771Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19EnvironmentalOpen in IMG/M
3300031779Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22EnvironmentalOpen in IMG/M
3300031792Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23EnvironmentalOpen in IMG/M
3300031793Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21EnvironmentalOpen in IMG/M
3300031795Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19EnvironmentalOpen in IMG/M
3300031796Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24EnvironmentalOpen in IMG/M
3300031799Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21EnvironmentalOpen in IMG/M
3300031805Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23EnvironmentalOpen in IMG/M
3300031819Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21EnvironmentalOpen in IMG/M
3300031820Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515EnvironmentalOpen in IMG/M
3300031823Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05EnvironmentalOpen in IMG/M
3300031835Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21EnvironmentalOpen in IMG/M
3300031845Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18EnvironmentalOpen in IMG/M
3300031846Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19EnvironmentalOpen in IMG/M
3300031859Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25EnvironmentalOpen in IMG/M
3300031860Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25EnvironmentalOpen in IMG/M
3300031879Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2)EnvironmentalOpen in IMG/M
3300031894Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18EnvironmentalOpen in IMG/M
3300031896Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19EnvironmentalOpen in IMG/M
3300031897Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031941Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080EnvironmentalOpen in IMG/M
3300031947Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000HEnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300031981Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032008Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18EnvironmentalOpen in IMG/M
3300032009Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19EnvironmentalOpen in IMG/M
3300032010Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22EnvironmentalOpen in IMG/M
3300032025Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20EnvironmentalOpen in IMG/M
3300032035Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170EnvironmentalOpen in IMG/M
3300032060Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18EnvironmentalOpen in IMG/M
3300032064Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17EnvironmentalOpen in IMG/M
3300032067Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22EnvironmentalOpen in IMG/M
3300032068Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032089Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23EnvironmentalOpen in IMG/M
3300032091Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300032829Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3EnvironmentalOpen in IMG/M
3300032895Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3EnvironmentalOpen in IMG/M
3300032896Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4EnvironmentalOpen in IMG/M
3300032955Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5EnvironmentalOpen in IMG/M
3300033134Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2EnvironmentalOpen in IMG/M
3300033158Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1EnvironmentalOpen in IMG/M
3300033289Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108EnvironmentalOpen in IMG/M
3300033290Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15EnvironmentalOpen in IMG/M
3300033550Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4EnvironmentalOpen in IMG/M
3300033803Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_0_10EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
FI_006493102166559006Grass SoilVEEAAELTEIFYPPAAPEVRRERWRRVPFRALGTEPPRDLAYKVMPQVAE
FE1_070288402189573002Grass SoilMAVEFSSHEEAVELAQVFYPSALEQIRRHGWRRVPFEAVGINPPRDLAFKMLER
INPhiseqgaiiFebDRAFT_10470762223300000364SoilASPEEAAELAGIFYPRAAAEVRRRAQRRVPYDVLGINPPRDLAFKRVRP*
JGI10216J12902_11583647523300000956SoilEAAELTEVFYPSAVAEVRRRGGRQIPYEVLGTNPPRDLAFKVMAR*
A21PFW6_104119623300001333PermafrostLTEIFYPSGIEEVRRRGSRQVPYEVLGINPPCDLAFKMIAQ*
JGI20204J15135_102495323300001454Arctic Peat SoilFASHREAVELAGIFYPHAVSQVRRRGSRRVPYEVLGSNPPRDLAFKVIG*
Ga0062384_10038942813300004082Bog Forest SoilMAMEFASHREAVELAEIFYPHAVTEIRRRGSRRVPYEVLGINPPCDLAFKVITR*
Ga0062595_10123588423300004479SoilSHQEAAELTEIFYPRGGEEVRRQGWRRVPYEVLGVNPPRDLAYKVIGR*
Ga0062388_10258565923300004635Bog Forest SoilFASREEAVELIEIFYPGAVGEVRRRGWRRVPYEVLGINPPRDLAFKVMTG*
Ga0066388_10246721323300005332Tropical Forest SoilEAVELTEIFFPKAAGEVRRRGQRSVPFDVLGINPPRDLAVKVLAG*
Ga0068868_10170083313300005338Miscanthus RhizosphereFFPRAAEDVARRGLRQVPFEVLRINPPRDLAFKLLAPSE*
Ga0068868_10181359523300005338Miscanthus RhizosphereEEAVELAGIFFPRAAEDVARRGLRQVPFEVLRINPPRDLAFKVLAQ*
Ga0070709_1139246313300005434Corn, Switchgrass And Miscanthus RhizosphereSHEEAVELAGIFFPRAAEDVARRGLRQVPFEVLRINPPRDLAFKVLAP*
Ga0070714_10239923713300005435Agricultural SoilAVELAGIFFPRAAEDVARRGLRQVPFEVLRINPPRDLAFKLLAPSE*
Ga0070714_10247870523300005435Agricultural SoilLAGIFFPRAAEDVARRGLRQVPFEVLRINPPRDLAFKVLAP*
Ga0070713_10226001523300005436Corn, Switchgrass And Miscanthus RhizosphereEIFYPQAAEEVRRQGWRRIPFDVLGINPPRDLAYKVLAP*
Ga0070705_10085675813300005440Corn, Switchgrass And Miscanthus RhizosphereSHEEAVELAGIFFPRAAEDVARRGLRQVPFEVLRINPPRDLAFKLLAPSE*
Ga0070708_10046462223300005445Corn, Switchgrass And Miscanthus RhizosphereAELAEIFYPQAAEEVRRQGWRRIPFDVLGINPPRDLAYKVLAP*
Ga0066681_1009406413300005451SoilAAELASIFYPRAAAEVRRRARRRVPYDVLGINPPRDLAFKRVPR*
Ga0070706_10006657513300005467Corn, Switchgrass And Miscanthus RhizosphereEFGSYADAVELAEIFYPKGADSVRRRGERTVPFDVLGINPPRDLAFKVLPG*
Ga0070697_10173725413300005536Corn, Switchgrass And Miscanthus RhizosphereSAEEASELIEIFYPDAIWEVRRGGSRRVPYDVLGTNPPRDLAFKMIAR*
Ga0070695_10007805913300005545Corn, Switchgrass And Miscanthus RhizosphereSSHEEAVELAGIFFPRAAEDVARRGLRQVPFEVLRINPPRDLAFKVLAP*
Ga0070665_10193984123300005548Switchgrass RhizosphereLAGIFFPRAAEDVARRGLRQVPFEVLRINPPRDLAFKLLAPSE*
Ga0066694_1028996123300005574SoilAVELTQIFFPRAAEDVARRGLRQVPFEVLRINPPRDLAFKVLAQ*
Ga0070762_1085940523300005602SoilSYREAVELAGIFYPRAAEEVRRRGQRTVPFEVLGINPPRDLAFKVLAQ*
Ga0070763_1080741423300005610SoilAGIFYPRAAEEVRRRGRRTVPFEVLGINPPRDLAFKVLGQ*
Ga0068856_10053739313300005614Corn RhizosphereIFFPGAADKVRRLGKRSVPFEVLGINPPRDLAFKVLAR*
Ga0068856_10133204913300005614Corn RhizosphereGAADKVRRLGRREVPFEVLGINPPRDVAFKVLAA*
Ga0068864_10260609023300005618Switchgrass RhizosphereHEEAVELAGIFFPRAAEDVARRGLRQVPFEVLRINPPRDLAFKLLAPSE*
Ga0070766_1091966913300005921SoilREAVELAGIFYPRAAEEVRRRGQRTVPFEVLGINPPRDLAFKVLAQ*
Ga0075017_10062794413300006059WatershedsVELAEIFYPKGADEVRRLGRRSVPFEVLGINPPRDLAFKVLAG*
Ga0075019_1107754513300006086WatershedsREAVEMAGIFYPHAVTEVRRRGRRKVPYEVLGINPPRDLAFKVLAG*
Ga0075015_10078785123300006102WatershedsMSVEFGSYADAVELAEIFYPKGAGEVRRLGRRSVPFEVLGINPPRDLAFKVLAG*
Ga0070716_10166130913300006173Corn, Switchgrass And Miscanthus RhizosphereFASHQEAVELTEIFYPRGGQEVRRQGWRRVPYDVLGVNPPRDLAYKLIA*
Ga0066653_1056906023300006791SoilEEAAELAGIFYPRAAAEVRRRAQRRVPYDVLGINPPRDLAFKRVPR*
Ga0066653_1075935113300006791SoilLDEAVELTGVFYPSAVAEVGRRGARRVPYEVLGVNPPRDLAFKVMAQ*
Ga0066665_1089231123300006796SoilLIGIFDPSAIGEVRRRGRRRVPYDVLGTNPPRDLAFKVIAR*
Ga0075431_10080258423300006847Populus RhizosphereAVELTEIFYPGCAEEVRRQGWRRVPYHALGVNPPRDLAYKVIDR*
Ga0075434_10031080733300006871Populus RhizosphereLAGIFFPRAAEDVARRGLRQVPFEVLRINPPRDLAFKVLAQ*
Ga0099791_1064229113300007255Vadose Zone SoilIFYPNAIEEVRRRGRRQVPFEVLGINPPRDLAFKMLA*
Ga0099795_1050152323300007788Vadose Zone SoilAEIFYPKAAGEVRRRGRRDVPFEVLGINPPRDLACKVLSR*
Ga0099829_1125584613300009038Vadose Zone SoilPMTVDFASHREAVQLTEIFYPHAIREVRRRGSPRVPYEVLGINPPRDLAFKVVAR*
Ga0099830_1129930423300009088Vadose Zone SoilTVDFASHPEAVELAEIFYPEALPEIRRRGCRQVPYELLGINPPRDVAFKVMAV*
Ga0105245_1105574723300009098Miscanthus RhizospherePRAAEDVARRGLRQVPFEVLRINPPRDLAFKLLAPSE*
Ga0105243_1126668023300009148Miscanthus RhizosphereELTEIFYPGCGVEVRRHGWRRVPYDALGVNPPRDLAYKVIDR*
Ga0105241_1119160013300009174Corn RhizosphereMSIEFGSYADAVEMARIFFPGAADKVRRLGRREVPFEVLGINPP
Ga0105242_1132565623300009176Miscanthus RhizosphereMSVEFARAQEAAELIEVFYPRAIGKLSRGGWRHVPYDVLGTNPPRDLAFKLIAR*
Ga0105248_1257519513300009177Switchgrass RhizosphereHEEAVELAGIFFPRAAEDVARRGLRQVPFEVLRINPPRDLAFKVLAP*
Ga0116221_152373513300009523Peatlands SoilPKAADAVRRRGEQSVPFEVLGLNPPRDLAFRVMAG*
Ga0116216_1009998113300009698Peatlands SoilEFGSYADAVELAEIFFPRAAGEVRRLGRRTVPFDVLGINPPRDLAFKVPAL*
Ga0126374_1174027823300009792Tropical Forest SoilELAEIFYPKAAGEVRRLGSRTVSFEVLGMNPPRDLAFKVLAR*
Ga0123355_1179720913300009826Termite GutTEIFYPKAADEVRQRGWHRVPFEVLGINPPRDLAFKVLAQ*
Ga0126380_1201559323300010043Tropical Forest SoilELAKIFFPGAVDAILEYGLRRVPFEVLGINPPRDLAFKTLT*
Ga0126373_1173180723300010048Tropical Forest SoilSDEKAVELSEIFYPRAADEVRVRHLRRVPFELVGINPPRDLAYKLLPL*
Ga0126373_1239179623300010048Tropical Forest SoilFYPKAAGEVRRRGSRKVSFDVLGINPPRDLAVKVLPE*
Ga0134063_1029620023300010335Grasslands SoilPSAIGEVRRRGRRRVPYDVLGTNPPRDLAFKVIAR*
Ga0126372_1004864413300010360Tropical Forest SoilSEAVELAEIFYPGAVEAIRQHRLRRVPFELLGINPPRDLAFKTLAS*
Ga0126378_1194216823300010361Tropical Forest SoilLEFASVEEAVQMAGIFYPRAAGDVRRRHQRRVPFEVLGVNPPRDLAFKVLPG*
Ga0126379_1039508613300010366Tropical Forest SoilPGAADKVRRLGRRDVPFEVLGINPPRDLAFKVLAA*
Ga0134128_1096668923300010373Terrestrial SoilIFFPRAAEDVARRGLRQVPFEVLRINPPRDLAFKVLAQ*
Ga0134128_1118178223300010373Terrestrial SoilELAEIFYPKAAAEVRRRGRASVPFEVLGINPPRDLACKVLSQ*
Ga0134128_1291274623300010373Terrestrial SoilSSHEEAVELAGIFFPRAAEDVARRGLRQVPFEVLRINPPRDLAFKLLAPSE*
Ga0105246_1057482513300011119Miscanthus RhizosphereELAGIFFPRAAEDVARRGLRQVPFEVLRINPPRDLAFKLLAPSE*
Ga0137393_1165636623300011271Vadose Zone SoilFASHREAVELAEIFYPHALREIRRRGSPRVPYEVLGINPPRDVAFKVMAG*
Ga0137388_1060790123300012189Vadose Zone SoilVELAEIFYPKAADEVRRRGWRRVPFEVLDINPPRDLAFKVLAG*
Ga0137383_1125337713300012199Vadose Zone SoilVEFPNHSQAVEMSEIFYPRAAEEVRRRRLRQVPFEVLGINPPRDVAFKLLPR*
Ga0137380_1017301933300012206Vadose Zone SoilYPGAAEQISRRGLRRVPFELLGINPPRDVAFKILAG*
Ga0137380_1048101413300012206Vadose Zone SoilSYADVVELAEIFYPNGADSVRRRGERTVPFDVLGINPPRDLAFKVLPG*
Ga0137377_1196229213300012211Vadose Zone SoilPEEAAELAEVFYPTAVAEVRRLGGRRVPYEVLGINPPRDLAFKVMAR*
Ga0137366_1110690223300012354Vadose Zone SoilYPKAADEVRRRGSQSVPFAALGINPPRDLAFKVLAG*
Ga0137369_1110037723300012355Vadose Zone SoilVEFASHEEAVELAEIFYPHAVAEVRRRGRRRVPYEVLGINPPRDLAFKVMAR*
Ga0137384_1050998813300012357Vadose Zone SoilAIFYPRAAREVRRLGRRRVAFEVLGINPPRDVAFKILAG*
Ga0137361_1028795333300012362Vadose Zone SoilSVEFPSHKEAVELAEIFYPNAIEEVRRRGRRQVPFEVLGINPPRDLAFKMLA*
Ga0157314_102334613300012500Arabidopsis RhizosphereAVELAGIFFPRAAEDVARRGLRQVPFEVLRINPPRDLAFKVLAP*
Ga0137398_1009282033300012683Vadose Zone SoilVELAEIFYPKAAGEVRRRGSRRVPFEVLGINPPRDLAFKVLAG*
Ga0157302_1009885033300012915SoilMCVEFSSHEEAVELAGIFFPRAAEEVAQRGLRQVPFEVLRINPPRDLAFKVLAQ*
Ga0164299_1115474413300012958SoilMSVEFASVHEAVELAGIFYPQAAGEIQRRGSRKVPFEVIGINPPRDLAFKVLAG*
Ga0164309_1077150913300012984SoilFASLEEAVELTEVFYPSAVTEVRRRGRREVPFEVLGINPPRDLAFKAMAR*
Ga0164306_1011847533300012988SoilASHEEAAELTEIFYPSAVAEVRRLGERQVPYELLGINPPRDLAFKVMT*
Ga0164306_1015351013300012988SoilLAGIFFPRAAEDVARRGLRQVPFEVLRINPPRDLAFKVLAPSE*
Ga0164305_1144231823300012989SoilFFPRAADDVARRGLRQVPFEVLRINPPRDLAFKVLAQ*
Ga0157369_1116009213300013105Corn RhizosphereVELAGIFFPRAAEDVARRGLRQVPFEVLRINPPRDLAFKLLAPSE*
Ga0157372_1178160123300013307Corn RhizosphereFPRAAEDVARRGLRQVPFEVLRINPPRDLAFKVLAQ*
Ga0120147_100619813300013758PermafrostMELVGIFYPQAAGEVRRRGGASVPYSLLGVNPPRDLAYKVIAA*
Ga0120179_108993613300013763PermafrostHVYAAIGERVRRRGSRQVPYEVLGINPPRDLAFKVITG*
Ga0120171_113009613300014827PermafrostFYPSGIEEVRRRGSRQVPYEVLGINPPCDLAFKMIAQ*
Ga0137412_1125855723300015242Vadose Zone SoilTFASPREAAELAEIFYPRAAAEVRRRDCAVVPYEVLGVNPPRDLAFKDVPS*
Ga0182036_1047326313300016270SoilVELAEIFYPKAADQVRRRRWRKVPFEVLGINPPRDLAFKVLAG
Ga0182035_1017044813300016341SoilAVELAGIFFPRAADEVRRLGRRSVPFEVLGINPPRDVAFKVLAA
Ga0182035_1100231113300016341SoilELAEIFYPRAAREVRRRGSASVPFEILDINPPRDLAFKVLPG
Ga0182035_1166823423300016341SoilEAVELAEIFYPGAADAVRRRGERCVPFEVLGINPPRDLAFKVMPA
Ga0182040_1175153013300016387SoilIFYPQAAGEVRRHGWRRIPFEVLGINPPRDLAYKVLAP
Ga0182039_1072973113300016422SoilHEEAVELAEIFYPKAAGEIRRRGWRKVPFEALGINPPRDLAFKVLAG
Ga0182039_1098469213300016422SoilAVELSEIFYPKAADKVRRRRWRKVPFEVLGINPPRDLAFKVLPE
Ga0187807_106919813300017926Freshwater SedimentEAVELTGIFYPRAAGEVRRRGLRTVPFEVLGINPPCDLAFKVLPR
Ga0187801_1016918813300017933Freshwater SedimentIFYPKAAGEVRRLGKRTVPFEVLGINPPRDLAFKVLAG
Ga0187808_1030865913300017942Freshwater SedimentMSVEFSSHREAAELAEIFYPQAADEVRRRGGRRIPFEVLGVNPPRDLAYKVLAP
Ga0187808_1059778223300017942Freshwater SedimentLAGIFYPRAAEEVRRRGRRTVPFEVLGINPPRDLAFKVLGQ
Ga0187819_1013960413300017943Freshwater SedimentIFYPHAITEIRRRRSRRVPYQVLGINPPRDLAFKVMAC
Ga0187817_1032250623300017955Freshwater SedimentGIFYPQAACEVRQRGLRTVPFEMLGINPPRDLAFKVVPR
Ga0187817_1063395113300017955Freshwater SedimentLAEIFYPKAADAVRRRGEQSVPFEVLGLNPPRDLAFRVMAG
Ga0187783_1090554813300017970Tropical PeatlandEFASCGEAVELAEIFYPGAVEEVRRRGLRRVPFEVLGINPPRDLAFKVLAR
Ga0187777_1033919123300017974Tropical PeatlandSHQEAVELATIFYPGAAAEVRRRGRRRVPYEVLGINPPRDLAFKTVGV
Ga0187767_1019955423300017999Tropical PeatlandGAEFGSYHEALELAEIFYPEAAEAVRRRGERSVPFEVLGINPPRDLAFKVLPG
Ga0187766_1120218423300018058Tropical PeatlandAQIFYPQAADEIRRRGSPTVPFEVLGINPPRDLAFKVLPG
Ga0187765_1091463613300018060Tropical PeatlandAEFTSQQEAAELAGIFYPGAAAEVRRRGGRRVPYEVLGINPPRDLAFKTVTR
Ga0193751_119726323300019888SoilLAEIFYPKAIEEVRRRGRRQVPFEILGINPPRDLAFKMLAR
Ga0210403_1120273213300020580SoilREAAELAEIFYPQAADEVRRHGWRRIPFEVLGVNPPRDLVYKVLAP
Ga0210395_1029601113300020582SoilPMTVDFASNREAVELAEIFYPHALAEIRRRGSPRVPYEVLGINPPRDVAFKIVPR
Ga0210406_1067463123300021168SoilELAEIFYPKAAGEVRRRGRPSVPFEVLGINPPRDLAFKVLAQ
Ga0210405_1003905653300021171SoilPHAAEEVRLRGVRRVPFETLGINPPRDLAFKVLAQ
Ga0210408_1022219113300021178SoilVELAGIFYPGAAEEVRRRGRRTVPFEVLGINPPRDLAFKVLASEADTVRLAQ
Ga0193699_1016251323300021363SoilAEIFYSEAADEVRRLGRRTVPFDVLGINPPRDLAFKVLAA
Ga0210393_1158450513300021401SoilEAVELAEIFYPRAADEIRRRGWRTVPFDVLGINPPRDVAFKVLAG
Ga0210393_1167404023300021401SoilFYPQAADEVRRHGWRRIPFEVLGVNPPRDLAYKVLAP
Ga0210386_1023704113300021406SoilFFPDAIREVRRRGSPRVPYDVLGYNPPRDLAFKVIAA
Ga0210386_1085476123300021406SoilAVELAEVFFPHAAEEVRLRGVRRVPFETLGINPPRDLAFKVLAQ
Ga0210386_1177192223300021406SoilELAGIFYPDAVSQVRRRGSRRVPYEVLGINPPRDLAFKVIAG
Ga0210386_1182110313300021406SoilYREAVELAGIFYPRAAEEVRRRGRRTVPFEVLGINPPRDLAFKVLAQ
Ga0210383_1077261223300021407SoilSVEFGSYREAVELAGIFYPRAAEEVRRRGERTVPFEVLGINPPRDLAFKVLAP
Ga0210383_1098483923300021407SoilGFASRREAVELAEIFYPHAVAQVRARGSARVPFAVLGINPPRDVAFKVITP
Ga0210410_1066707723300021479SoilLAGIFYPRAAEEVRRRGRRTVPFEVLGINPPRDLAFKVLAQ
Ga0210410_1128909013300021479SoilVEFASHREAVELAEIFYPHAVSQVRRRGSRRVPYEVLGINPPRDLAFKVIG
Ga0210409_1069432523300021559SoilEEAAELIEIFYPSAIGEVCRHGWRRVPYDLLGTNPPRDLAFKVIAR
Ga0126371_1226449923300021560Tropical Forest SoilEAVELAGIFFPRAADKVRRLGRRDVPFEVLGINPPRDLAFKVLAA
Ga0242671_107399923300022714SoilFGSYREAVELAGIFYPRAAEEVRRRGRRTVPFEVLGINPPRDLAFKVLAQ
Ga0207642_1004996413300025899Miscanthus RhizosphereELAGIFFPRAAEDVARRGLRQVPFEVLRINPPRDLAFKVLAQ
Ga0207710_1075896513300025900Switchgrass RhizosphereSHEEAVELAGIFFPRAAEDVARRGLRQVPFEVLRINPPRDLAFKVLAP
Ga0207680_1135807323300025903Switchgrass RhizosphereMCIEFPSYEEAVELAGIFFPRAAGEVARRGLRQVPFEVLRINPPRD
Ga0207685_1001133913300025905Corn, Switchgrass And Miscanthus RhizosphereEAVELAEVFYPHAVPQVRRLGRRRVPYEVLGINPPRDLAFKVIAG
Ga0207685_1019532623300025905Corn, Switchgrass And Miscanthus RhizosphereHREAAELAEIFYPQAADEVRRHGGRRIPFDVLGINPPRDLAYKVLAP
Ga0207684_1011091813300025910Corn, Switchgrass And Miscanthus RhizosphereFSSREEAVELAGIFFPRAAEEVRRRGQRRVPFDVLGINPPRDLAFKVLAE
Ga0207663_1052781113300025916Corn, Switchgrass And Miscanthus RhizosphereAVELAGIFFPRAAEDVARRGLRQVPFEVLRINPPRDLAFKLLAPSE
Ga0207660_1034979113300025917Corn RhizosphereSVEFGSYADAVEMVRIFFPGAADKVRRLGRREVPFEVLGINPPRDVAFKVLAA
Ga0207660_1107075823300025917Corn RhizosphereMCVEFSSHEEAVELAGIFFPRAAEDVARRGLRQVPFEVLRINPPRDLAFKVLAP
Ga0207700_1061204823300025928Corn, Switchgrass And Miscanthus RhizosphereMYVEFSSHREAAELAEIFYPQAAEEVRRQGWRRIPFDVLGINPPRDLAYKVLAP
Ga0207700_1129661013300025928Corn, Switchgrass And Miscanthus RhizosphereAAADEVRRRRSRKVSFEVLGFNPPRDLAFKVLQPG
Ga0207664_1132216623300025929Agricultural SoilPKGLDAVRRRGSSTVPFEVLGINPPRDLAFKVLPG
Ga0207709_1130949813300025935Miscanthus RhizosphereEAVELAGIFFPRAAEDVARRGLRQVPFEVLRINPPRDLAFKLLAPSE
Ga0207670_1170430213300025936Switchgrass RhizosphereEAVELAGIFYPQAAGDIQRRGSRRVPFEVIGINPPRDLAFKVLAG
Ga0207703_1069196213300026035Switchgrass RhizosphereFSSHEEAVELAGIFFPRAAEDVARRGLRQVPFEVLRINPPRDLAFKVLAP
Ga0207708_1060594723300026075Corn, Switchgrass And Miscanthus RhizospherePRAAEDVARRGLRQVPFEVLRINPPRDLAFKVLAP
Ga0207702_1167893313300026078Corn RhizosphereYLEAVELAGIFFPGAADKVRRLGKRSVPFEVLGINPPRDLAFKVLAR
Ga0207648_1130469723300026089Miscanthus RhizosphereFASPEEAVELTAIFYPGALSAVRRHGGRRVPFDLLGVNPPRDLTYKVLPR
Ga0207674_1008339743300026116Corn RhizospherePGAADKVRRLGKRSVPFEVLGINPPRDLAFKVLAR
Ga0209648_1009801043300026551Grasslands SoilGSHREAVELAEIFYPQAADEVRRRGWRRVPFELLGVNPPRDLAFKVLTG
Ga0209648_1021422713300026551Grasslands SoilASHKEAVELAEIFYPKAAEEVRRRGRRQVPFEVLAINPPRDLAFKVLAR
Ga0209529_106565623300027334Forest SoilPHALPEIRRRGSSRIPYEVLGINPPRDIAFKIVAR
Ga0209420_101089613300027648Forest SoilPMTVDFASHREAVELAEIFYPHALPEIRRRGSSRVPYEVLGINPPRDVAFKTVPR
Ga0209415_1064074923300027905Peatlands SoilPMTVDFASHREAVELAEIFYPRALAEIRRRRRRSVPYELLGINPPRDVAFKVVAG
Ga0209168_1008738913300027986Surface SoilPMSVEFGSYREAVELAGIFYPRAAEEVRRLGQRTVPFEVLGINPPRDLAFKVLAP
Ga0209168_1047382613300027986Surface SoilGTENEAVELAEIFFPKAAGEVRRRGSRRVPFEVLGINPPRDLAFKVLAG
Ga0268266_1225999713300028379Switchgrass RhizosphereFFPRAAEDVARRGLRQVPFEVLRINPPRDLAFKLLAPSE
Ga0247818_1081433913300028589SoilFASREEAAELTEIFYPRGADEVRRHGWRRVPYQVLGVNPPRDLAYKLIP
Ga0247818_1135387713300028589SoilVMEFASHRDAVELTEIFYPRAAGAVRRGASRRVPYTTLAINPPRDLAFKVMPA
Ga0307282_1055360913300028784SoilCIEFPSYEEAVELAGIFFPRAAGEVARRGLRQVPFEVLRINPPRDLAFKVLAQ
Ga0307504_1013598813300028792SoilIFYPHAVGEVRCRGSRRVPYAVLGINPPRDLAFKVITR
Ga0307299_1039851913300028793SoilAAELAEVFYPSAVAEVRRRGARQVPYEVLGINPPRDLAFKVMSR
Ga0307310_1059283513300028824SoilEVFYPSAVAEVRRRGARQVPYEVLGINPPRDLAFKVMPR
Ga0307278_1047178623300028878SoilEFANQQEAAELAEVFYPSAVAEVRRRGARQVPYEVLGINAPRDLAFKVMPR
Ga0307304_1049688423300028885SoilPEEAAELAGIFYPRAAAEVRRRAQRRVPYDVLGINPPRDLAFKRVPR
Ga0311339_1036053133300029999PalsaLTGIFYPAAVDEVRRRGQRQVPYELLGVNPPCDLAFKVLAP
Ga0311338_1092018813300030007PalsaLEDAVDLAGIFHPAAVDEVRRGGQRQVPYELLGVNPPRDLAFKVLAP
Ga0311354_1004905413300030618PalsaELAQIFYPHAVTEIRGRGSRRVPYQVLGINPPRDLAFKVVAR
Ga0311354_1087666423300030618PalsaGLPVEFASVEDAVELTGIFYPAAVDEVRRRGQRQVPYELLGVNPPCDLAFKVLAP
Ga0307482_119360113300030730Hardwood Forest SoilCREAVKLGGIFYPRAAEEVRRRGRRTVPFAVRGINPPRVLAFKVMAQ
Ga0170824_10488043723300031231Forest SoilLAEIFYPQAAGEVRARGLRRVPFELIGINAPRDVAYKFLPR
Ga0170824_10630447113300031231Forest SoilYQKAVELAGIFYPRAADEVRRRGERRVPFDVLGINPPRDLAFKRLPR
Ga0170820_1775012023300031446Forest SoilELAEIFYPKAAGEVRRRGRPSVPFEVLGINPPRDLAFKVLAG
Ga0302326_1019157653300031525PalsaEAVELTEIFYPDGVAEVRRRGWRRVPFAALGINPPRDLAFKVIAR
Ga0318534_1064006423300031544SoilVELAEIFYPQAADEVRRRGWRRVPFEVLGINPPRDLAFKVLAG
Ga0318571_1011018513300031549SoilAGIFFPRAADEVRRLGRRSVPFEVLGINPPRDVAFKVLAA
Ga0318573_1011125733300031564SoilAEIFYPRGADAVRRRGSPTVPFEVLGINPPRDLAFKVLPQ
Ga0318573_1019665223300031564SoilYQEAVELAQIFYPGAAREVRRRGSPSVPFEILGINPPRDLAFKVLPG
Ga0318573_1046299723300031564SoilYPKAAGEVRRRGLRTVPFEVLGINPPCDLAFKVLGRPDPHAGAQ
Ga0318515_1057962823300031572SoilFYPKAVGEVRRRGWRRIPFEVLGINPPRDLAFKVLAG
Ga0310915_1041933713300031573SoilAVELSQIFYPKAAEQVRQGGSAKVSFEVLGINPPRDLAYKVLPE
Ga0318555_1020662923300031640SoilPGEAAELAQIFYPKAAGEVRRRGRRAVPFEVLGINPPRDLAFKVLAE
Ga0318542_1026093313300031668SoilEAVELAEIFYPKGADSVRRRGERRVPFEVLGINPPRDLAFKVMAE
Ga0318542_1053751523300031668SoilVEFGSYQEAVELAEIFYPRAADAVRRRGERCVPFEVLGINPPRDLAFKVMPA
Ga0318574_1091065013300031680SoilFYPKAASKVWRRGSPKVPFEVLGINPPRDLAYKVLSE
Ga0310813_1187716713300031716SoilEMARIFFPGAADKVRRLGRREVPFEVLGINPPRDVAFKVLAA
Ga0306917_1064153813300031719SoilPKAAGEIRRRGWRKVPFEALGINPPRDLAFKVLAG
Ga0306917_1066793113300031719SoilEFGSCHEAAELAEIFYPKAASEVWRRGSRKVPFEVLGINPPRDLAYKVLPE
Ga0307469_1121728423300031720Hardwood Forest SoilVHEAVELAGIFYPQAAGEIQRRGSRKVPFEVIGINPPRDLAFKVLAG
Ga0318500_1067141933300031724SoilAVELAEIFYPKAAGEIRRHGWRKVPFEVLGINPPRDLAYKVLAQ
Ga0306918_1049863613300031744SoilSYADAVELAEIFYPKGASEVRRLGRRSVPFEVLGINPPRDLAFKVLAA
Ga0318502_1000492713300031747SoilHHEAVELAEIFYPQAASEVRRRGSGKVPFEVLGINPPRDLAFKVLPE
Ga0318502_1068227113300031747SoilSYADAVELAGIFFPRAADEVRRLGRRSVPFEVLGINPPRDVAFKVLAA
Ga0318494_1029263513300031751SoilAVELAEIFYPKAADEVRRRGWRRVPFEVLGINPPRDLAFKVLAG
Ga0318494_1040942713300031751SoilIFYAKAAGEVRRLGRRTVPFEVLGLNPPRDLAFKVMAG
Ga0318554_1045604313300031765SoilGSHEEAVELAEIFYPKAAGEIRRHGWRKVPFEVLGINPPRDLAYKVLAQ
Ga0318554_1082101323300031765SoilMSVEFDSRREAVELAEIFYPKAADEVRRRGWRRVPFEVLGINPPRDLAFKVLAG
Ga0318509_1022692613300031768SoilFFPRAADEVRRLGRRSVPFEVLGINPPRDVAFKVLAA
Ga0318526_1009007613300031769SoilEAVELAEIFYPKGADAVRRRGSSTVPFEVLGINPPRDLAFKVLAQ
Ga0318526_1040997713300031769SoilSVEFGSYADAVELAEIFYPKAADEVRRLGSWTVPFEVLGINPPRDLAFKVLPG
Ga0318521_1014607123300031770SoilYADAVEMTRIFFPGAADKVRRLGRRGVPFEALGINPPRDVAFKVLAA
Ga0318546_1079608623300031771SoilEIFYPGAADAVRRRGERCVPFEVLGINPPRDLAFKVMPA
Ga0318566_1064874623300031779SoilEAVELAEIFYPKAASKVWRRGSPKVPFEVLGINPPRDLAYKVLSE
Ga0318529_1003670233300031792SoilVELAEIFYPQAASEVRRRGSGKVPFEVLGINPPRDLAFKVLPE
Ga0318548_1026519913300031793SoilQEAVELAQIFYPGAAREVRRRGSPSVPFEILGINPPRDLAFKVLPG
Ga0318557_1043472213300031795SoilHRDAVELAEIFYPKAADQVRRRRWRKVPFEVLGINPPRDLAFKVMPA
Ga0318576_1024661223300031796SoilSYQEAVELAEIFYPRAADAVRRRGERCVPFEVLGINPPRDLAFKVMPA
Ga0318576_1033471133300031796SoilVEFGSLEEAVELAEIFYPKAAGEIRRHGWRKVPFEVLGINPPRDLAYKVLAQ
Ga0318576_1053722323300031796SoilIFFPGAADKVRRLGRREVPFEALGINPPRDVAFKVLAA
Ga0318565_1045783523300031799SoilAVEVAEVFYPKAAGEVRRRGWRRIPFEVLDINPPRDLAFKVLAG
Ga0318497_1018688423300031805SoilSQIFYPKAAEQVRQGGSAKVSFEVLGINPPRDLAYKVLPE
Ga0318568_1069975223300031819SoilFPEAVELAGIFYPRAAGEVRRRGSRRVPFEVLGINPPRDLAFKVLAA
Ga0307473_1038103023300031820Hardwood Forest SoilPMCVEFSSHEEAVELAGIFFPRAAEDVARRGMRQVPFEVLRINPPRDLAFKVLAP
Ga0307478_1107553113300031823Hardwood Forest SoilFYPQAADEVRRRGRRAVPFELLGINPPRDVAFKVLS
Ga0318517_1011414313300031835SoilYVEFGSHHEAVELAGIFYPKAASEVWRRGSRKVPFEVLGINPPRDLAYKVLPE
Ga0318511_1007625833300031845SoilSVEFDSRREAVELAEIFYPKAADEVRRRGWRRVPFEVLGINPPRDLAFKVLAG
Ga0318511_1050310213300031845SoilVEVAEVFYPKAAGEVRRRGWRRIPFEVLDINPPRDLAFKVLAG
Ga0318511_1050988723300031845SoilAEIFYPKAAGEVRRRSSRKIPFEVLGINPPRDLAFKVLPG
Ga0318512_1009320313300031846SoilGSYAEAVELAEIFYPRGAGEVRRLGRRTVPFEVLGLNPPRDLSFKVMAE
Ga0318527_1015825313300031859SoilIFYPKAAGEVRRRGRRAVPFEVLGINPPRDLAFKVLAE
Ga0318527_1032010313300031859SoilCHEAVELAEIFYPKAASEVWRRGSRKVPFEVLGINPPRDLAYKVLPE
Ga0318495_1033477813300031860SoilPEEAVELAEIFYPKAAGEIRRHGWRKVPFEVLGINPPRDLAYKVLAL
Ga0318495_1036178923300031860SoilYPKAAGEVRRRGWRRIPFEVLDINPPRDLAFKVLAG
Ga0306919_1010573613300031879SoilFYPKAAGEVRRRGRRAVPFEVLGINPPRDLAFKVLAE
Ga0318522_1031885213300031894SoilHHEAVELAGIFYPKAASEVWRRGSRKVPFEVLGINPPRDLAFKVLAA
Ga0318551_1027931113300031896SoilPKAAGEIRRHGWRKVPFEVLGINPPRDLAYKVLAQ
Ga0318520_1008302713300031897SoilAQIFYPGAAREVRRRGSPSVPFEILGINPPRDLAFKVLPG
Ga0306923_1019545713300031910SoilPKAADEVRRRGWRRVPFEVLGINPPRDLAFKVLAG
Ga0306923_1223296113300031910SoilIFFPGAADKVRRLGRRDVPFQVLGINPPRDLAFKVLAA
Ga0310912_1129357723300031941SoilSIEFGSYPEAVELAGIFFPGAADKVRRLGRRDVPFQVLGINPPRDLAFKVLAA
Ga0310912_1136738823300031941SoilAEIFYPKAADQVRQRRWRKVPFEVLGINPPRDLAFKVLAA
Ga0310912_1144871513300031941SoilPRGADAVRRRGSPTVPFEVLGINPPRDLAFKVLPQ
Ga0310909_1159094623300031947SoilAELAQIFYPKAAGEVRRRGRRAVPFEVLGINPPRDLAFKVLAE
Ga0306926_1062814113300031954SoilDFGSHEEAVELADIFYPKAAGEIRRHGWRKVPFEVLGINPPRDLAYKVLAQ
Ga0318531_1028186323300031981SoilVFPKAAGEVRRLGSRTVPFEVLGINPPRDLAFKVLAG
Ga0306922_1040993733300032001SoilAGIFYPGAADRVRRLGKRSVPFAVLGINPPRDLAFKVLAE
Ga0306922_1065521013300032001SoilEIFFPRAAGEVRRLGSRTVPFEVLGINPPRDLAFKVLAE
Ga0318562_1039688013300032008SoilQEAAELAEIFYPKAAGEVRRRSSRKIPFEVLGINPPRDLAFKVLPG
Ga0318563_1015026523300032009SoilFYPKAACEVRRRGLRTVPFEVLGINPPCDLAFKVLGRPDPHAGAQ
Ga0318569_1057652323300032010SoilPKAAGEVRRLGSRTVPFEVLGINPPRDLAFKVLAG
Ga0318507_1052725913300032025SoilMYVEFGSHHEAVEMAEIFYPKAADEVRRRGWRKVPFDVLGINPPRDLAFKVLA
Ga0310911_1082815713300032035SoilFYPRAASEVWRRGSRKVPFEILGINPPRDLAYKVLPE
Ga0318505_1014640423300032060SoilFYPKAAEQVRQGGSAKVSFEVLGINPPRDLAYKVLPE
Ga0318510_1041064423300032064SoilFYPKAAGEVRRRGLRTVPFEVLGINPPCDLAFKVLGRPDPHAGAQ
Ga0318524_1021666613300032067SoilIFYPRGAGEVRRLGRRTVPFEVLGLNPPRDLAFKVMAE
Ga0318524_1074429713300032067SoilFYPGAADAVRRRGERCVPFEVLGINPPRDLAFKVMPA
Ga0318553_1012005733300032068SoilAEIFFPKAAGEVRRLGSRTVPFEVLGINPPRDLAFKVLAG
Ga0306924_1198711623300032076SoilYHEAAELAEIFYPKAASEVRRRGSRKVPFEVLGINPPRDLAYKVLPE
Ga0318525_1023298113300032089SoilSVEFGSYTEAVELAEIFYPKGADSVRRRGERRVPFEVLGINPPRDLAFKVMAE
Ga0318577_1031719113300032091SoilELAEIFYPKAADEVRRLGSRTVPFELLGINPPRDLAFKVLP
Ga0318577_1055192113300032091SoilFYPKAASEVWRRGSRKVPFEVLGINPPRDLAYKVLPE
Ga0307471_10062726023300032180Hardwood Forest SoilPRAADEVRRRGWHRVPFEVIGINPPRDLAFKVLAE
Ga0307471_10116699513300032180Hardwood Forest SoilIFYPDVEDEVRRRGWRRVPYRVLGVNPPCDLAFKAVGR
Ga0306920_10226676913300032261SoilIFYPKAAGEVRRRGWRRVPFEVLGINPPRDLAFKVLAG
Ga0306920_10418608813300032261SoilYPKGADSVRRRGERRVPFEVLGINPPRDLAFKVMAE
Ga0335070_1134866213300032829SoilEAVELAEIFYPRAAGEIRRHGWRKVPFEVLGINPPRDLAYRMLPR
Ga0335074_1140132713300032895SoilSHHEAAELTEIFYPMAADEVRRRGWRRVPFEVLGINPPRDLAFKVLVQ
Ga0335075_1068581023300032896SoilDFASHREAVDMAKIFYPHALPEIRRLGCRRIPYAVLGINPPRDVAFRVMR
Ga0335075_1103969013300032896SoilSRHEAAELTEIFYPQAAGEVRRQGWRRVPFEVLGVNPPCDLAYKVLAP
Ga0335075_1155056923300032896SoilREAVELAGIFYPRAADAVRQRGERRVPFEVLGINPPRDLAFKVCAA
Ga0335076_1159968823300032955SoilAAELAEIFYPQAADEVRRRGGRRIPFEVLGVNPPRDLAYKVLAP
Ga0335073_1024189343300033134SoilHREAAELAEIFYPQAADEVRRRGGRRIPFEVLGVNPPRDLAYKVLAP
Ga0335077_1073984713300033158SoilAEEAAELTEIFYPQAAPEVRRNRWTRVPFRALGHEPPRDLAYKVMAATHQPG
Ga0310914_1088853823300033289SoilFYPQAASEVRRRGSGKVPFEVLGINPPRDLAFKVLPE
Ga0310914_1123512823300033289SoilRREAVELAEIFYPKAADEVRRRGWRRVPFEVLGINPPRDLAFKVLAG
Ga0318519_1013119423300033290SoilMSVEFGSHEEAVELAEIFYPKAAGEIRRRGWRKVPFEALGINPPRDLAFKVLAG
Ga0318519_1044107823300033290SoilELAEIFYPKGASEVRRLGRRSVPFEVLGINPPRDLAFKVLAA
Ga0247829_1133432323300033550SoilFYPRAAPAVRRGASRRVPYTTLAINPPRDLAFKVMPA
Ga0314862_0168240_43_2073300033803PeatlandMAAEFTSAGEAAELAGIFYPRAAAEVRRLGQRRVPFEVLGINPPRDLAFKMAGP


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.