| Basic Information | |
|---|---|
| Family ID | F014046 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 266 |
| Average Sequence Length | 45 residues |
| Representative Sequence | YDLLGPLAARRVRQIITRYSPELAGRAAYHSSELKLSAAPDPG |
| Number of Associated Samples | 199 |
| Number of Associated Scaffolds | 266 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 99.25 % |
| % of genes from short scaffolds (< 2000 bps) | 88.72 % |
| Associated GOLD sequencing projects | 188 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.44 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (79.323 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (31.203 % of family members) |
| Environment Ontology (ENVO) | Unclassified (21.805 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (47.368 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 45.07% β-sheet: 0.00% Coil/Unstructured: 54.93% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.44 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 266 Family Scaffolds |
|---|---|---|
| PF08240 | ADH_N | 15.04 |
| PF04672 | Methyltransf_19 | 5.64 |
| PF04149 | DUF397 | 4.51 |
| PF00005 | ABC_tran | 3.38 |
| PF02604 | PhdYeFM_antitox | 2.63 |
| PF00226 | DnaJ | 2.26 |
| PF13556 | HTH_30 | 1.88 |
| PF08028 | Acyl-CoA_dh_2 | 1.50 |
| PF12704 | MacB_PCD | 1.50 |
| PF13560 | HTH_31 | 1.50 |
| PF02585 | PIG-L | 1.50 |
| PF14062 | DUF4253 | 1.13 |
| PF08402 | TOBE_2 | 1.13 |
| PF02687 | FtsX | 1.13 |
| PF13581 | HATPase_c_2 | 0.75 |
| PF03793 | PASTA | 0.75 |
| PF03984 | DUF346 | 0.75 |
| PF02518 | HATPase_c | 0.75 |
| PF01933 | CofD | 0.75 |
| PF13549 | ATP-grasp_5 | 0.75 |
| PF01170 | UPF0020 | 0.38 |
| PF05685 | Uma2 | 0.38 |
| PF00753 | Lactamase_B | 0.38 |
| PF05345 | He_PIG | 0.38 |
| PF03008 | DUF234 | 0.38 |
| PF02786 | CPSase_L_D2 | 0.38 |
| PF01799 | Fer2_2 | 0.38 |
| PF00553 | CBM_2 | 0.38 |
| PF01381 | HTH_3 | 0.38 |
| PF14078 | DUF4259 | 0.38 |
| PF00289 | Biotin_carb_N | 0.38 |
| PF00725 | 3HCDH | 0.38 |
| PF13360 | PQQ_2 | 0.38 |
| PF05199 | GMC_oxred_C | 0.38 |
| PF02371 | Transposase_20 | 0.38 |
| PF00982 | Glyco_transf_20 | 0.38 |
| PF00471 | Ribosomal_L33 | 0.38 |
| PF01828 | Peptidase_A4 | 0.38 |
| PF02720 | DUF222 | 0.38 |
| PF01243 | Putative_PNPOx | 0.38 |
| PF09278 | MerR-DNA-bind | 0.38 |
| PF08223 | PaaX_C | 0.38 |
| PF02426 | MIase | 0.38 |
| COG ID | Name | Functional Category | % Frequency in 266 Family Scaffolds |
|---|---|---|---|
| COG4118 | Antitoxin component of toxin-antitoxin stability system, DNA-binding transcriptional repressor | Defense mechanisms [V] | 2.63 |
| COG2161 | Antitoxin component YafN of the YafNO toxin-antitoxin module, PHD/YefM family | Defense mechanisms [V] | 2.63 |
| COG1960 | Acyl-CoA dehydrogenase related to the alkylation response protein AidB | Lipid transport and metabolism [I] | 1.50 |
| COG2120 | N-acetylglucosaminyl deacetylase, LmbE family | Carbohydrate transport and metabolism [G] | 1.50 |
| COG0391 | Archaeal 2-phospho-L-lactate transferase/Bacterial gluconeogenesis factor, CofD/UPF0052 family | Carbohydrate transport and metabolism [G] | 0.75 |
| COG2226 | Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenG | Coenzyme transport and metabolism [H] | 0.38 |
| COG5297 | Cellulase/cellobiase CelA1 | Carbohydrate transport and metabolism [G] | 0.38 |
| COG4829 | Muconolactone delta-isomerase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.38 |
| COG4636 | Endonuclease, Uma2 family (restriction endonuclease fold) | General function prediction only [R] | 0.38 |
| COG4123 | tRNA1(Val) A37 N6-methylase TrmN6 | Translation, ribosomal structure and biogenesis [J] | 0.38 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.38 |
| COG3327 | DNA-binding transcriptional regulator PaaX (phenylacetic acid degradation) | Transcription [K] | 0.38 |
| COG2890 | Methylase of polypeptide chain release factors | Translation, ribosomal structure and biogenesis [J] | 0.38 |
| COG2813 | 16S rRNA G1207 or 23S rRNA G1835 methylase RsmC/RlmG | Translation, ribosomal structure and biogenesis [J] | 0.38 |
| COG2303 | Choline dehydrogenase or related flavoprotein | Lipid transport and metabolism [I] | 0.38 |
| COG2265 | tRNA/tmRNA/rRNA uracil-C5-methylase, TrmA/RlmC/RlmD family | Translation, ribosomal structure and biogenesis [J] | 0.38 |
| COG2264 | Ribosomal protein L11 methylase PrmA | Translation, ribosomal structure and biogenesis [J] | 0.38 |
| COG2263 | Predicted RNA methylase | General function prediction only [R] | 0.38 |
| COG0116 | 23S rRNA G2445 N2-methylase RlmL | Translation, ribosomal structure and biogenesis [J] | 0.38 |
| COG1672 | Predicted ATPase, archaeal AAA+ ATPase superfamily | General function prediction only [R] | 0.38 |
| COG1250 | 3-hydroxyacyl-CoA dehydrogenase | Lipid transport and metabolism [I] | 0.38 |
| COG1092 | 23S rRNA G2069 N7-methylase RlmK or C1962 C5-methylase RlmI | Translation, ribosomal structure and biogenesis [J] | 0.38 |
| COG1041 | tRNA G10 N-methylase Trm11 | Translation, ribosomal structure and biogenesis [J] | 0.38 |
| COG0789 | DNA-binding transcriptional regulator, MerR family | Transcription [K] | 0.38 |
| COG0380 | Trehalose-6-phosphate synthase, GT20 family | Carbohydrate transport and metabolism [G] | 0.38 |
| COG0286 | Type I restriction-modification system, DNA methylase subunit | Defense mechanisms [V] | 0.38 |
| COG0267 | Ribosomal protein L33 | Translation, ribosomal structure and biogenesis [J] | 0.38 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 79.32 % |
| Unclassified | root | N/A | 20.68 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300003505|JGIcombinedJ51221_10209706 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 791 | Open in IMG/M |
| 3300003505|JGIcombinedJ51221_10443078 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 526 | Open in IMG/M |
| 3300004080|Ga0062385_10531756 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 731 | Open in IMG/M |
| 3300004092|Ga0062389_103728232 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 572 | Open in IMG/M |
| 3300004092|Ga0062389_104649977 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → unclassified Nocardioides → Nocardioides sp. Iso805N | 517 | Open in IMG/M |
| 3300005176|Ga0066679_10172839 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1365 | Open in IMG/M |
| 3300005332|Ga0066388_108791183 | Not Available | 501 | Open in IMG/M |
| 3300005338|Ga0068868_100170511 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → unclassified Acidimicrobiaceae → Acidimicrobiaceae bacterium | 1801 | Open in IMG/M |
| 3300005435|Ga0070714_100004460 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 10544 | Open in IMG/M |
| 3300005435|Ga0070714_100585456 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1070 | Open in IMG/M |
| 3300005435|Ga0070714_102364122 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 517 | Open in IMG/M |
| 3300005455|Ga0070663_100599202 | Not Available | 926 | Open in IMG/M |
| 3300005457|Ga0070662_100618783 | Not Available | 912 | Open in IMG/M |
| 3300005533|Ga0070734_10329797 | All Organisms → cellular organisms → Bacteria | 872 | Open in IMG/M |
| 3300005536|Ga0070697_100046980 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 3500 | Open in IMG/M |
| 3300005537|Ga0070730_10117733 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1823 | Open in IMG/M |
| 3300005548|Ga0070665_100236729 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → unclassified Acidimicrobiaceae → Acidimicrobiaceae bacterium | 1826 | Open in IMG/M |
| 3300005591|Ga0070761_11051568 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 517 | Open in IMG/M |
| 3300005602|Ga0070762_10235156 | Not Available | 1134 | Open in IMG/M |
| 3300005764|Ga0066903_107132313 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → unclassified Acidimicrobiales → Acidimicrobiales bacterium | 579 | Open in IMG/M |
| 3300005764|Ga0066903_107763288 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
| 3300005764|Ga0066903_108097310 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
| 3300005764|Ga0066903_108206004 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300005843|Ga0068860_102348497 | Not Available | 554 | Open in IMG/M |
| 3300006028|Ga0070717_10348647 | Not Available | 1323 | Open in IMG/M |
| 3300006059|Ga0075017_100504846 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 918 | Open in IMG/M |
| 3300006162|Ga0075030_100853275 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 719 | Open in IMG/M |
| 3300006175|Ga0070712_100450004 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1072 | Open in IMG/M |
| 3300006175|Ga0070712_100619243 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 917 | Open in IMG/M |
| 3300006175|Ga0070712_101126238 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 681 | Open in IMG/M |
| 3300006175|Ga0070712_101428707 | Not Available | 604 | Open in IMG/M |
| 3300006175|Ga0070712_102052442 | Not Available | 501 | Open in IMG/M |
| 3300006176|Ga0070765_101312427 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 682 | Open in IMG/M |
| 3300006605|Ga0074057_10000542 | Not Available | 1342 | Open in IMG/M |
| 3300006804|Ga0079221_10621406 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 734 | Open in IMG/M |
| 3300006954|Ga0079219_11379502 | Not Available | 628 | Open in IMG/M |
| 3300009090|Ga0099827_10011995 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 5656 | Open in IMG/M |
| 3300009093|Ga0105240_11837365 | Not Available | 631 | Open in IMG/M |
| 3300009522|Ga0116218_1159883 | All Organisms → cellular organisms → Bacteria | 1022 | Open in IMG/M |
| 3300009545|Ga0105237_10983990 | Not Available | 850 | Open in IMG/M |
| 3300009545|Ga0105237_12330122 | Not Available | 545 | Open in IMG/M |
| 3300009672|Ga0116215_1240381 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 793 | Open in IMG/M |
| 3300009672|Ga0116215_1246518 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 782 | Open in IMG/M |
| 3300009792|Ga0126374_11024637 | Not Available | 649 | Open in IMG/M |
| 3300009824|Ga0116219_10812085 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 510 | Open in IMG/M |
| 3300010043|Ga0126380_11650420 | Not Available | 574 | Open in IMG/M |
| 3300010048|Ga0126373_11403207 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae → Frondihabitans → unclassified Frondihabitans → Frondihabitans sp. PAMC 28766 | 764 | Open in IMG/M |
| 3300010048|Ga0126373_11443503 | Not Available | 753 | Open in IMG/M |
| 3300010339|Ga0074046_10382366 | All Organisms → cellular organisms → Bacteria | 853 | Open in IMG/M |
| 3300010360|Ga0126372_11026130 | Not Available | 838 | Open in IMG/M |
| 3300010360|Ga0126372_12738037 | Not Available | 545 | Open in IMG/M |
| 3300010361|Ga0126378_11689549 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 719 | Open in IMG/M |
| 3300010361|Ga0126378_13006495 | Not Available | 537 | Open in IMG/M |
| 3300010379|Ga0136449_100614901 | All Organisms → cellular organisms → Bacteria | 1848 | Open in IMG/M |
| 3300010379|Ga0136449_101208440 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1190 | Open in IMG/M |
| 3300010379|Ga0136449_102033525 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 847 | Open in IMG/M |
| 3300010379|Ga0136449_102248179 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 793 | Open in IMG/M |
| 3300010379|Ga0136449_102445590 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 751 | Open in IMG/M |
| 3300010396|Ga0134126_11883390 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 655 | Open in IMG/M |
| 3300010396|Ga0134126_12561722 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 554 | Open in IMG/M |
| 3300010397|Ga0134124_11568320 | Not Available | 688 | Open in IMG/M |
| 3300010397|Ga0134124_13021320 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 514 | Open in IMG/M |
| 3300011119|Ga0105246_10482172 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → unclassified Acidimicrobiaceae → Acidimicrobiaceae bacterium | 1049 | Open in IMG/M |
| 3300011120|Ga0150983_11932135 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 553 | Open in IMG/M |
| 3300011120|Ga0150983_16163781 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 577 | Open in IMG/M |
| 3300012683|Ga0137398_10821291 | All Organisms → cellular organisms → Bacteria | 650 | Open in IMG/M |
| 3300012951|Ga0164300_10719530 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 607 | Open in IMG/M |
| 3300012971|Ga0126369_10030706 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4419 | Open in IMG/M |
| 3300012971|Ga0126369_10759178 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1050 | Open in IMG/M |
| 3300013100|Ga0157373_11036273 | Not Available | 613 | Open in IMG/M |
| 3300013105|Ga0157369_10905034 | Not Available | 905 | Open in IMG/M |
| 3300013105|Ga0157369_11323057 | Not Available | 734 | Open in IMG/M |
| 3300013307|Ga0157372_11163483 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 892 | Open in IMG/M |
| 3300013308|Ga0157375_11448866 | Not Available | 810 | Open in IMG/M |
| 3300014169|Ga0181531_10465251 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 780 | Open in IMG/M |
| 3300014325|Ga0163163_12628421 | Not Available | 561 | Open in IMG/M |
| 3300014968|Ga0157379_10564857 | Not Available | 1059 | Open in IMG/M |
| 3300015371|Ga0132258_13388291 | Not Available | 1095 | Open in IMG/M |
| 3300016294|Ga0182041_10210516 | All Organisms → cellular organisms → Bacteria | 1555 | Open in IMG/M |
| 3300016357|Ga0182032_12048056 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 502 | Open in IMG/M |
| 3300016387|Ga0182040_10375991 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1108 | Open in IMG/M |
| 3300016404|Ga0182037_11451088 | Not Available | 608 | Open in IMG/M |
| 3300017656|Ga0134112_10358521 | Not Available | 596 | Open in IMG/M |
| 3300017823|Ga0187818_10022950 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2670 | Open in IMG/M |
| 3300017926|Ga0187807_1005456 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3896 | Open in IMG/M |
| 3300017928|Ga0187806_1177525 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 713 | Open in IMG/M |
| 3300017932|Ga0187814_10032261 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1948 | Open in IMG/M |
| 3300017932|Ga0187814_10202895 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 745 | Open in IMG/M |
| 3300017932|Ga0187814_10278538 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 637 | Open in IMG/M |
| 3300017942|Ga0187808_10268041 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 766 | Open in IMG/M |
| 3300017947|Ga0187785_10081810 | All Organisms → cellular organisms → Bacteria | 1263 | Open in IMG/M |
| 3300017955|Ga0187817_11106182 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300017959|Ga0187779_11218492 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 530 | Open in IMG/M |
| 3300017975|Ga0187782_10041930 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3332 | Open in IMG/M |
| 3300017975|Ga0187782_10341873 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1132 | Open in IMG/M |
| 3300018001|Ga0187815_10303708 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 677 | Open in IMG/M |
| 3300018007|Ga0187805_10393303 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 643 | Open in IMG/M |
| 3300018012|Ga0187810_10050845 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1563 | Open in IMG/M |
| 3300018012|Ga0187810_10077764 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1282 | Open in IMG/M |
| 3300018090|Ga0187770_10593709 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → unclassified Acidimicrobiales → Acidimicrobiales bacterium | 880 | Open in IMG/M |
| 3300020081|Ga0206354_10405098 | All Organisms → cellular organisms → Bacteria | 925 | Open in IMG/M |
| 3300020580|Ga0210403_10488770 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium | 1001 | Open in IMG/M |
| 3300020581|Ga0210399_11212924 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 598 | Open in IMG/M |
| 3300020582|Ga0210395_10887685 | All Organisms → cellular organisms → Bacteria | 663 | Open in IMG/M |
| 3300020582|Ga0210395_11215622 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
| 3300021088|Ga0210404_10404794 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 763 | Open in IMG/M |
| 3300021178|Ga0210408_10469274 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1001 | Open in IMG/M |
| 3300021180|Ga0210396_10417305 | All Organisms → cellular organisms → Bacteria | 1179 | Open in IMG/M |
| 3300021180|Ga0210396_11271524 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 613 | Open in IMG/M |
| 3300021181|Ga0210388_10058818 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3219 | Open in IMG/M |
| 3300021181|Ga0210388_10964767 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 732 | Open in IMG/M |
| 3300021181|Ga0210388_11559154 | Not Available | 550 | Open in IMG/M |
| 3300021401|Ga0210393_10784100 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 776 | Open in IMG/M |
| 3300021401|Ga0210393_10854535 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 739 | Open in IMG/M |
| 3300021402|Ga0210385_10057114 | All Organisms → cellular organisms → Bacteria | 2624 | Open in IMG/M |
| 3300021402|Ga0210385_10912904 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 674 | Open in IMG/M |
| 3300021402|Ga0210385_11069820 | Not Available | 620 | Open in IMG/M |
| 3300021403|Ga0210397_11067643 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 627 | Open in IMG/M |
| 3300021404|Ga0210389_10215611 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales | 1498 | Open in IMG/M |
| 3300021404|Ga0210389_10595171 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 869 | Open in IMG/M |
| 3300021407|Ga0210383_10679537 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 885 | Open in IMG/M |
| 3300021407|Ga0210383_10947512 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 732 | Open in IMG/M |
| 3300021407|Ga0210383_11529778 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 551 | Open in IMG/M |
| 3300021420|Ga0210394_11578365 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 553 | Open in IMG/M |
| 3300021432|Ga0210384_11232757 | All Organisms → cellular organisms → Bacteria | 652 | Open in IMG/M |
| 3300021432|Ga0210384_11768630 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 524 | Open in IMG/M |
| 3300021433|Ga0210391_10056993 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3103 | Open in IMG/M |
| 3300021445|Ga0182009_10831163 | Not Available | 507 | Open in IMG/M |
| 3300021559|Ga0210409_11613270 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 525 | Open in IMG/M |
| 3300022521|Ga0224541_1021525 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 693 | Open in IMG/M |
| 3300022522|Ga0242659_1129180 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 522 | Open in IMG/M |
| 3300022523|Ga0242663_1145024 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 507 | Open in IMG/M |
| 3300022528|Ga0242669_1005491 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1453 | Open in IMG/M |
| 3300022711|Ga0242674_1062114 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 533 | Open in IMG/M |
| 3300022718|Ga0242675_1135247 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 505 | Open in IMG/M |
| 3300024222|Ga0247691_1030488 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 828 | Open in IMG/M |
| 3300024288|Ga0179589_10618913 | Not Available | 508 | Open in IMG/M |
| 3300025906|Ga0207699_10943216 | Not Available | 637 | Open in IMG/M |
| 3300025906|Ga0207699_11219451 | Not Available | 557 | Open in IMG/M |
| 3300025910|Ga0207684_11096393 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 663 | Open in IMG/M |
| 3300025915|Ga0207693_10025685 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4668 | Open in IMG/M |
| 3300025915|Ga0207693_10053438 | All Organisms → cellular organisms → Bacteria | 3169 | Open in IMG/M |
| 3300025915|Ga0207693_11127509 | Not Available | 595 | Open in IMG/M |
| 3300025916|Ga0207663_10068555 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 2278 | Open in IMG/M |
| 3300025916|Ga0207663_10592665 | Not Available | 870 | Open in IMG/M |
| 3300025928|Ga0207700_10277509 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 1440 | Open in IMG/M |
| 3300025928|Ga0207700_10911273 | Not Available | 787 | Open in IMG/M |
| 3300025929|Ga0207664_10018367 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 5146 | Open in IMG/M |
| 3300025929|Ga0207664_10404473 | Not Available | 1215 | Open in IMG/M |
| 3300025939|Ga0207665_11030986 | Not Available | 655 | Open in IMG/M |
| 3300025941|Ga0207711_10075877 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → unclassified Acidimicrobiaceae → Acidimicrobiaceae bacterium | 2926 | Open in IMG/M |
| 3300026078|Ga0207702_10041524 | All Organisms → cellular organisms → Bacteria | 3857 | Open in IMG/M |
| 3300026095|Ga0207676_10587443 | Not Available | 1068 | Open in IMG/M |
| 3300026095|Ga0207676_12260638 | Not Available | 542 | Open in IMG/M |
| 3300026467|Ga0257154_1007084 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1486 | Open in IMG/M |
| 3300026555|Ga0179593_1189287 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 2153 | Open in IMG/M |
| 3300027037|Ga0209005_1025568 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 707 | Open in IMG/M |
| 3300027110|Ga0208488_1052719 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 701 | Open in IMG/M |
| 3300027110|Ga0208488_1070298 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 579 | Open in IMG/M |
| 3300027158|Ga0208725_1052159 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 614 | Open in IMG/M |
| 3300027604|Ga0208324_1009506 | All Organisms → cellular organisms → Bacteria | 3202 | Open in IMG/M |
| 3300027725|Ga0209178_1253042 | Not Available | 637 | Open in IMG/M |
| 3300027826|Ga0209060_10189847 | All Organisms → cellular organisms → Bacteria | 948 | Open in IMG/M |
| 3300027855|Ga0209693_10204999 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 970 | Open in IMG/M |
| 3300027874|Ga0209465_10480671 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 621 | Open in IMG/M |
| 3300027879|Ga0209169_10024124 | All Organisms → cellular organisms → Bacteria | 3261 | Open in IMG/M |
| 3300027882|Ga0209590_10045936 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2406 | Open in IMG/M |
| 3300027884|Ga0209275_10050233 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2002 | Open in IMG/M |
| 3300027895|Ga0209624_10224738 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1248 | Open in IMG/M |
| 3300027895|Ga0209624_10385710 | All Organisms → cellular organisms → Bacteria | 934 | Open in IMG/M |
| 3300027905|Ga0209415_10441502 | All Organisms → cellular organisms → Bacteria | 1029 | Open in IMG/M |
| 3300028023|Ga0265357_1012909 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → unclassified Mycobacterium → Mycobacterium sp. SM1 | 864 | Open in IMG/M |
| 3300028780|Ga0302225_10476497 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 583 | Open in IMG/M |
| 3300028782|Ga0307306_10082945 | Not Available | 837 | Open in IMG/M |
| 3300028877|Ga0302235_10379138 | Not Available | 606 | Open in IMG/M |
| 3300028877|Ga0302235_10427641 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 565 | Open in IMG/M |
| 3300029701|Ga0222748_1118466 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 532 | Open in IMG/M |
| 3300029882|Ga0311368_10320424 | Not Available | 1167 | Open in IMG/M |
| 3300029910|Ga0311369_11012975 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 655 | Open in IMG/M |
| 3300029951|Ga0311371_10961646 | Not Available | 1022 | Open in IMG/M |
| 3300029999|Ga0311339_11425854 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 621 | Open in IMG/M |
| 3300030490|Ga0302184_10053440 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1959 | Open in IMG/M |
| 3300030548|Ga0210252_11091721 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 582 | Open in IMG/M |
| 3300030677|Ga0302317_10060380 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1878 | Open in IMG/M |
| 3300030730|Ga0307482_1136034 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 705 | Open in IMG/M |
| 3300030740|Ga0265460_10348883 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → unclassified Actinomadura → Actinomadura sp. CNU-125 | 1035 | Open in IMG/M |
| 3300031027|Ga0302308_10148507 | Not Available | 1546 | Open in IMG/M |
| 3300031090|Ga0265760_10011155 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia | 2568 | Open in IMG/M |
| 3300031234|Ga0302325_10789497 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1344 | Open in IMG/M |
| 3300031544|Ga0318534_10083423 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1818 | Open in IMG/M |
| 3300031544|Ga0318534_10110121 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1579 | Open in IMG/M |
| 3300031544|Ga0318534_10479285 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 712 | Open in IMG/M |
| 3300031549|Ga0318571_10099631 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → unclassified Acidimicrobiales → Acidimicrobiales bacterium | 949 | Open in IMG/M |
| 3300031564|Ga0318573_10085133 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1603 | Open in IMG/M |
| 3300031572|Ga0318515_10642964 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
| 3300031573|Ga0310915_10101758 | All Organisms → cellular organisms → Bacteria | 1943 | Open in IMG/M |
| 3300031668|Ga0318542_10485901 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → unclassified Acidimicrobiales → Acidimicrobiales bacterium | 641 | Open in IMG/M |
| 3300031681|Ga0318572_10746253 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 582 | Open in IMG/M |
| 3300031682|Ga0318560_10347608 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 801 | Open in IMG/M |
| 3300031708|Ga0310686_104518154 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3765 | Open in IMG/M |
| 3300031708|Ga0310686_104521149 | All Organisms → cellular organisms → Bacteria | 733 | Open in IMG/M |
| 3300031715|Ga0307476_10146429 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis → unclassified Amycolatopsis → Amycolatopsis sp. M39 | 1694 | Open in IMG/M |
| 3300031718|Ga0307474_10454478 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1001 | Open in IMG/M |
| 3300031718|Ga0307474_11148891 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 614 | Open in IMG/M |
| 3300031718|Ga0307474_11582845 | Not Available | 515 | Open in IMG/M |
| 3300031719|Ga0306917_11252659 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 575 | Open in IMG/M |
| 3300031723|Ga0318493_10002940 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 6283 | Open in IMG/M |
| 3300031736|Ga0318501_10666923 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales | 573 | Open in IMG/M |
| 3300031740|Ga0307468_100227211 | Not Available | 1290 | Open in IMG/M |
| 3300031747|Ga0318502_10287427 | Not Available | 965 | Open in IMG/M |
| 3300031753|Ga0307477_10192450 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1420 | Open in IMG/M |
| 3300031754|Ga0307475_11423141 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 534 | Open in IMG/M |
| 3300031769|Ga0318526_10271107 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 694 | Open in IMG/M |
| 3300031770|Ga0318521_10404692 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → unclassified Acidimicrobiales → Acidimicrobiales bacterium | 813 | Open in IMG/M |
| 3300031771|Ga0318546_10043272 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2764 | Open in IMG/M |
| 3300031778|Ga0318498_10089259 | All Organisms → cellular organisms → Bacteria | 1393 | Open in IMG/M |
| 3300031778|Ga0318498_10549978 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 506 | Open in IMG/M |
| 3300031782|Ga0318552_10036991 | All Organisms → cellular organisms → Bacteria | 2267 | Open in IMG/M |
| 3300031782|Ga0318552_10115494 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1334 | Open in IMG/M |
| 3300031793|Ga0318548_10370633 | All Organisms → cellular organisms → Bacteria | 703 | Open in IMG/M |
| 3300031793|Ga0318548_10505913 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 590 | Open in IMG/M |
| 3300031794|Ga0318503_10253792 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 571 | Open in IMG/M |
| 3300031795|Ga0318557_10560094 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → unclassified Acidimicrobiales → Acidimicrobiales bacterium | 524 | Open in IMG/M |
| 3300031805|Ga0318497_10218216 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1055 | Open in IMG/M |
| 3300031805|Ga0318497_10427620 | All Organisms → cellular organisms → Bacteria | 741 | Open in IMG/M |
| 3300031819|Ga0318568_10900818 | Not Available | 547 | Open in IMG/M |
| 3300031819|Ga0318568_10902261 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
| 3300031823|Ga0307478_10225910 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1514 | Open in IMG/M |
| 3300031835|Ga0318517_10232583 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 831 | Open in IMG/M |
| 3300031879|Ga0306919_10205437 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1466 | Open in IMG/M |
| 3300031879|Ga0306919_10857393 | All Organisms → cellular organisms → Bacteria | 697 | Open in IMG/M |
| 3300031890|Ga0306925_12160984 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300031893|Ga0318536_10357057 | All Organisms → cellular organisms → Bacteria | 740 | Open in IMG/M |
| 3300031896|Ga0318551_10124062 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1393 | Open in IMG/M |
| 3300031912|Ga0306921_10892635 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1010 | Open in IMG/M |
| 3300031939|Ga0308174_10110895 | Not Available | 1985 | Open in IMG/M |
| 3300031939|Ga0308174_11869918 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 516 | Open in IMG/M |
| 3300031941|Ga0310912_10322048 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 1198 | Open in IMG/M |
| 3300031945|Ga0310913_10127312 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1744 | Open in IMG/M |
| 3300031945|Ga0310913_10957332 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 601 | Open in IMG/M |
| 3300031946|Ga0310910_10062308 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 2666 | Open in IMG/M |
| 3300031947|Ga0310909_10263427 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1442 | Open in IMG/M |
| 3300032001|Ga0306922_11058776 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 834 | Open in IMG/M |
| 3300032001|Ga0306922_11907914 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
| 3300032009|Ga0318563_10210047 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1050 | Open in IMG/M |
| 3300032010|Ga0318569_10344731 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 694 | Open in IMG/M |
| 3300032039|Ga0318559_10615348 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → unclassified Acidimicrobiales → Acidimicrobiales bacterium | 506 | Open in IMG/M |
| 3300032041|Ga0318549_10036377 | All Organisms → cellular organisms → Bacteria | 1971 | Open in IMG/M |
| 3300032041|Ga0318549_10420941 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 602 | Open in IMG/M |
| 3300032052|Ga0318506_10191560 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → unclassified Acidimicrobiales → Acidimicrobiales bacterium | 901 | Open in IMG/M |
| 3300032054|Ga0318570_10030924 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 2122 | Open in IMG/M |
| 3300032067|Ga0318524_10032088 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2428 | Open in IMG/M |
| 3300032091|Ga0318577_10579028 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 534 | Open in IMG/M |
| 3300032160|Ga0311301_11117345 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1023 | Open in IMG/M |
| 3300032160|Ga0311301_11607601 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 790 | Open in IMG/M |
| 3300032180|Ga0307471_100809302 | Not Available | 1104 | Open in IMG/M |
| 3300032261|Ga0306920_103690550 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300032515|Ga0348332_13903672 | All Organisms → cellular organisms → Bacteria | 1002 | Open in IMG/M |
| 3300032770|Ga0335085_10377036 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1654 | Open in IMG/M |
| 3300032897|Ga0335071_11659342 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium tuberculosis complex → Mycobacterium tuberculosis | 583 | Open in IMG/M |
| 3300032954|Ga0335083_11024483 | Not Available | 649 | Open in IMG/M |
| 3300032955|Ga0335076_10214571 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1825 | Open in IMG/M |
| 3300033134|Ga0335073_10089002 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4014 | Open in IMG/M |
| 3300033134|Ga0335073_11213750 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 755 | Open in IMG/M |
| 3300033290|Ga0318519_11061285 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 504 | Open in IMG/M |
| 3300033805|Ga0314864_0110172 | All Organisms → cellular organisms → Bacteria | 678 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 31.20% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 6.77% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 4.89% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 4.51% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.51% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 4.14% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.76% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.76% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.76% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.26% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.26% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.26% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.88% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.88% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.88% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 1.88% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.50% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.50% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.13% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.13% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.13% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.13% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.13% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.75% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.75% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.75% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.75% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.38% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.38% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.38% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.38% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.38% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.38% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.38% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.38% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.38% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.38% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.38% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.38% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.38% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.38% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.38% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.38% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.38% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.38% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
| 3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005533 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006605 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009522 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG | Environmental | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009672 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014169 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaG | Environmental | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300017656 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015 | Environmental | Open in IMG/M |
| 3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
| 3300017926 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2 | Environmental | Open in IMG/M |
| 3300017928 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1 | Environmental | Open in IMG/M |
| 3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
| 3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
| 3300017947 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018001 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_5 | Environmental | Open in IMG/M |
| 3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
| 3300018012 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5 | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021445 | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300022521 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 E3 20-24 | Environmental | Open in IMG/M |
| 3300022522 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-11-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022523 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022528 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022711 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022718 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300024222 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK32 | Environmental | Open in IMG/M |
| 3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026467 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-16-A | Environmental | Open in IMG/M |
| 3300026555 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300027037 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027110 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF001 (SPAdes) | Environmental | Open in IMG/M |
| 3300027158 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF011 (SPAdes) | Environmental | Open in IMG/M |
| 3300027604 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027725 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes) | Environmental | Open in IMG/M |
| 3300027826 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300028023 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 | Host-Associated | Open in IMG/M |
| 3300028780 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_2 | Environmental | Open in IMG/M |
| 3300028782 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_193 | Environmental | Open in IMG/M |
| 3300028877 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_3 | Environmental | Open in IMG/M |
| 3300029701 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300029882 | III_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300029910 | III_Palsa_E2 coassembly | Environmental | Open in IMG/M |
| 3300029951 | III_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030490 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_3 | Environmental | Open in IMG/M |
| 3300030548 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO133-ANR016SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030677 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N3_3 | Environmental | Open in IMG/M |
| 3300030730 | Metatranscriptome of hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030740 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada ARE Co-assembly | Environmental | Open in IMG/M |
| 3300031027 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_3 | Environmental | Open in IMG/M |
| 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031549 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24 | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031769 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031778 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24 | Environmental | Open in IMG/M |
| 3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
| 3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
| 3300031794 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f23 | Environmental | Open in IMG/M |
| 3300031795 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19 | Environmental | Open in IMG/M |
| 3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031835 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
| 3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031939 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2 | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
| 3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
| 3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
| 3300032041 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22 | Environmental | Open in IMG/M |
| 3300032052 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19 | Environmental | Open in IMG/M |
| 3300032054 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23 | Environmental | Open in IMG/M |
| 3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
| 3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032897 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| 3300033805 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_50_10 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGIcombinedJ51221_102097061 | 3300003505 | Forest Soil | ARDLFIATYDLLGPLAAHRVRQVIARYSRDLAARATYHSSGLTAPTAMTVTAK* |
| JGIcombinedJ51221_104430782 | 3300003505 | Forest Soil | PLAARRVRQIITRYSPELAGRAAYHSSELKLSAAPGADGS* |
| Ga0062385_105317562 | 3300004080 | Bog Forest Soil | ELFIGCYDLLGPLAALRVRQIITSYSPELAGRAAYHSSELKLSAAPAVDG* |
| Ga0062389_1037282322 | 3300004092 | Bog Forest Soil | GCYDLLGPLAALRVRQIITSYSPELAGRAAYHSSELKLSAAPAVDG* |
| Ga0062389_1046499771 | 3300004092 | Bog Forest Soil | YDLLGPLAARRVRQIITRYSPELAGRAAYHSSELKLSAAPDPG* |
| Ga0066679_101728391 | 3300005176 | Soil | ELFIGCYDLLGPMAALRVRQIITRYSPELAGRAAYHSSELKLSAAPDTLAAGG* |
| Ga0066388_1087911832 | 3300005332 | Tropical Forest Soil | LGPLAALRIRQIITRYSPDLADRAAYHSSELKISAAPDPSAGEGS* |
| Ga0068868_1001705111 | 3300005338 | Miscanthus Rhizosphere | ELFIGCYDLLGPPAALRVRQIITRYSPELADRAAYHSSELKLSTAPDPLTGTG* |
| Ga0070714_1000044601 | 3300005435 | Agricultural Soil | LAALRVRQIITRYSPELADRAAYHSSELKLSAAPDPAVGRPASA* |
| Ga0070714_1005854561 | 3300005435 | Agricultural Soil | CYDLLGPLAALRVRQIITRYSPELADRAAYHSSELKLSTAPDPAADRNAR* |
| Ga0070714_1023641221 | 3300005435 | Agricultural Soil | RELFIACYDLLGPLATRRVRQIIARYSPELAVRANFHNTELAMNETAEA* |
| Ga0070663_1005992022 | 3300005455 | Corn Rhizosphere | DLLGPPAALRVRQIITRYSPELADRAAYHSSELTLSAAPDPLTGTG* |
| Ga0070662_1006187832 | 3300005457 | Corn Rhizosphere | LGPPAALRVRQIITRYSPELADRAAYHSSELTLSAAPDPLTGTG* |
| Ga0070734_103297972 | 3300005533 | Surface Soil | RQIIARYSPELAGRAAYHSSQLTLSAAPDPSAGDG* |
| Ga0070697_1000469801 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | GCYDLLGPLAALRVRQIITRYSPELADRAAYHSSELKLSAAPDPLAADR* |
| Ga0070730_101177332 | 3300005537 | Surface Soil | RELFIGCYDLLGPLAARRVRQIITRYSPDLAGRAAYHSSELKLSAAPDPSAADG* |
| Ga0070665_1002367291 | 3300005548 | Switchgrass Rhizosphere | ARELFIGCYDLLGPPAALRVRQIITRYSPELADRAAYHSSELKLSAAPVASAPDG* |
| Ga0070761_110515682 | 3300005591 | Soil | RELFIGCYDLLGPLAARRVRQIITRYSPELAGRAAYHSSELKLSAAPDPG* |
| Ga0070762_102351562 | 3300005602 | Soil | PLAARRVRQIITRYSPELADRAAYHSSQLKLSTAPGADGS* |
| Ga0066903_1071323133 | 3300005764 | Tropical Forest Soil | VRQIITRYSPELAGRAAYHSSELKLSAAPDPSAADG* |
| Ga0066903_1077632881 | 3300005764 | Tropical Forest Soil | ELFIACYDLLGPLATRRVRQIIARYSPELSARANYHNTELAMSDTAEV* |
| Ga0066903_1080973101 | 3300005764 | Tropical Forest Soil | AARELFIACYDLLGPLAARRVRQIIDKYSPDLACRAAYHSTELTVSAADA* |
| Ga0066903_1082060042 | 3300005764 | Tropical Forest Soil | VRQIITRYSPELADRAAYHSSELKLSAAPDPSADR* |
| Ga0068860_1023484971 | 3300005843 | Switchgrass Rhizosphere | DLLGPPAALRVRQIITRYSPDLADRAAYHSSELKLSTAPDPLTGTG* |
| Ga0070717_103486472 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | LRVRQIITRYSPELADRAAYHSSELKLSTAPDPAADRSAR* |
| Ga0075017_1005048461 | 3300006059 | Watersheds | LLGPLAALRVRQIITRYSPELAGRAAYHSSELKLSAAPDS* |
| Ga0075030_1008532752 | 3300006162 | Watersheds | FIGCYDLLGPLAALRVRQIITSYSPELAGRAAYHSSELKLSAAPGVDG* |
| Ga0070712_1004500042 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | ATARELFIACYDLLGPLATRRVRQIIARYSPELAVRANFHNTELAMNESAEA* |
| Ga0070712_1006192432 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | ARELFIGCYDLLGPLAALRVRQIITRYSPDLADRAAYHSSELKLSAAPDTLAAGG* |
| Ga0070712_1011262382 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | LFIACYDLLGPLAALRVRQIITRYSPELADRAAYHSSELKLSAAPDR* |
| Ga0070712_1014287072 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | RQIINRYSPELADRAAYHSSELKLSTAPDPAGHRPGSRG* |
| Ga0070712_1020524421 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | YDLLGPLAALRVRQIITRYSPELADRAAYHSSELKLSAAPATDG* |
| Ga0070765_1013124273 | 3300006176 | Soil | RAQARELFIGCYDLLGPLAARRVRQIITRYSPDLAGRAAYHSSELKLSAAPDPG* |
| Ga0074057_100005422 | 3300006605 | Soil | ELFIGCYDLLGPPAALRVRQIITRYSPGLADRAAYHSSQLKLSAAPVPDNAGR* |
| Ga0079221_106214062 | 3300006804 | Agricultural Soil | DARELFIGCYDLLGPPAALRVRQIITRYNPELADRAAYHSSELKLSAAPDR* |
| Ga0079219_113795022 | 3300006954 | Agricultural Soil | IITRYSPELADRAAYHSSELKLSSAPDVAGDRSAR* |
| Ga0099827_100119958 | 3300009090 | Vadose Zone Soil | LFIGCDDLLGQLAALRVRQIITRYSPELADRAAYHSSELKLSAAPDPSTADA* |
| Ga0105240_118373652 | 3300009093 | Corn Rhizosphere | LGPPAALRVRQIITRYSPELADRAAYHSSELKLSTAPDPLTGTG* |
| Ga0116218_11598832 | 3300009522 | Peatlands Soil | LAALRVRQIITRYGPELADRAAYHSSELKLSAAPSGADGS* |
| Ga0105237_109839902 | 3300009545 | Corn Rhizosphere | ARELFIGCYDLLGPPAALRVRQIITRYSPELADRAAYHSSELTLSAAPLLADP* |
| Ga0105237_123301221 | 3300009545 | Corn Rhizosphere | GPPAALRVRQIITRYSPELADRAAYHSSELKLNTAPDPLTGTG* |
| Ga0116215_12403811 | 3300009672 | Peatlands Soil | ALRVRQIITRYSPELADRAAYHSSELTLSAAPSADG* |
| Ga0116215_12465182 | 3300009672 | Peatlands Soil | CYDLLGPLAALRVRQIITRYGPELADRAAYHSSELKLSAAPSGADGS* |
| Ga0126374_110246371 | 3300009792 | Tropical Forest Soil | DLLGPPAALRVRQIITRYSPELADRAAYHSSELKLSAAPLSAG* |
| Ga0116219_108120851 | 3300009824 | Peatlands Soil | CYDLLGPLAAQRVRQIITRYSPDLAGRAAYHSSELKLSAAPDPSTADG* |
| Ga0126380_116504202 | 3300010043 | Tropical Forest Soil | PPAALRVRQIITRYSPELADRAAYHSSELKLSAAPLSAG* |
| Ga0126373_114032072 | 3300010048 | Tropical Forest Soil | CYDMLGPLAARRVRQVIARYSPELAGLAAYHSTELTLSVADA* |
| Ga0126373_114435033 | 3300010048 | Tropical Forest Soil | GPLAAHRVRQIIARYSRELAAKAAYHSSELTTAAAASAARAP* |
| Ga0074046_103823661 | 3300010339 | Bog Forest Soil | ARELFIGCYDLLGPLAALRVRQIITRYGPELADRAAYHSSELKLSAAPAVDG* |
| Ga0126372_110261301 | 3300010360 | Tropical Forest Soil | LLGPLAALRIRQIITRYSPDLADRAAYHSSELKISAAPDPSAGEGS* |
| Ga0126372_127380372 | 3300010360 | Tropical Forest Soil | AARRVRQIIARYSPDLACRAAYHSTELTVSAADA* |
| Ga0126378_116895492 | 3300010361 | Tropical Forest Soil | PRASARELFIACYDLLGPLAARRVRQIIDHYSPDLACRAAYHSTQLTVSAAEA* |
| Ga0126378_130064952 | 3300010361 | Tropical Forest Soil | ASARELFIACYDLLGPPAALRIRQIITRYSPELADRAAYHSSELELSAAPDPSWPGTGA* |
| Ga0136449_1006149013 | 3300010379 | Peatlands Soil | ARELFIGCYDLLGPLAARRVRQIITRYSPDLAGAAAYHSSELKLSAAPDPSAADG* |
| Ga0136449_1012084403 | 3300010379 | Peatlands Soil | CYDLLGPLATRRVRQIIARYSPDLAVRANFHNTELTMSDTAEA* |
| Ga0136449_1020335252 | 3300010379 | Peatlands Soil | ELFIGCYDLLGPLAARRVRQIITRYSPELAGRAAYHSSELKLSAAPDPASA* |
| Ga0136449_1022481791 | 3300010379 | Peatlands Soil | QARELFIGCYDLLGPLAARRVRQIITRYSPELAGRAAYHSSELKLSAAPDPASA* |
| Ga0136449_1024455902 | 3300010379 | Peatlands Soil | YDLLGPLAAQRVRQIITRYSPDLAGRAAYHSSELKLSVAPDPSTADG* |
| Ga0134126_118833901 | 3300010396 | Terrestrial Soil | IACYDLLGPIATRRVRQIIARYSPELAIRAAYHNTELEMSDAGAA* |
| Ga0134126_125617222 | 3300010396 | Terrestrial Soil | ACYDLLGPLAARRVRQIIDRYSPELACRAAYHSTKLTVSAAEG* |
| Ga0134124_115683202 | 3300010397 | Terrestrial Soil | FIGCYDLLGPPAALRVRQIITRYSPELADRAAYHSSELKLNTAPDPLTGTG* |
| Ga0134124_130213202 | 3300010397 | Terrestrial Soil | DARELFIGCYDLLGPPAALRVRQIITRYSPELADRAAYHSSELTLSAAPDPLTGTG* |
| Ga0105246_104821721 | 3300011119 | Miscanthus Rhizosphere | IGCYDLLGPLAALRVRQIITRYSPELADRAAYHSSELKLSAAPDR* |
| Ga0150983_119321351 | 3300011120 | Forest Soil | DLLGPLAARRVRQIITRYSPELAGRAAYHSSELKLSAAPGADGS* |
| Ga0150983_161637812 | 3300011120 | Forest Soil | DARELFIDCYDRLGPLAVRRVRQIICKYSPELAGRACYHSTELTLSAAED* |
| Ga0137398_108212911 | 3300012683 | Vadose Zone Soil | VRQIITRYSPDLADRAAYHSSELKLSAAPDPLTAGG* |
| Ga0164300_107195301 | 3300012951 | Soil | DARELFIGCYDLLGPPAALRVRQIITRYSPDLADRAAYHSSELKLSTAPDPLTGTG* |
| Ga0126369_100307061 | 3300012971 | Tropical Forest Soil | YDLLGPLAARRVRQIIDHYSPDLACRAAYHSTTLTVSAAEA* |
| Ga0126369_107591781 | 3300012971 | Tropical Forest Soil | CYDLLGPLAARRVRQIIAKYSPDLACRAAYHSTKLTVSAADA* |
| Ga0157373_110362731 | 3300013100 | Corn Rhizosphere | IGCYDLLGPLAALRVRQIITRYSPELADRAAYHSSELKLSTAPDPAADRNAL* |
| Ga0157369_109050342 | 3300013105 | Corn Rhizosphere | FIGCYDLLGPPAALRVRQIITRYSPELADRAAYHSSELKLSTAPDPLTGTG* |
| Ga0157369_113230571 | 3300013105 | Corn Rhizosphere | LLGPPAALRVRQIITRYSPELADRAAYHSSELKLNTAPDPLTGTG* |
| Ga0157372_111634831 | 3300013307 | Corn Rhizosphere | ELFVACYDLLGPLATRRVRQIIARYSPELAIRAAFHNTELVMSDSAGAA* |
| Ga0157375_114488662 | 3300013308 | Miscanthus Rhizosphere | IGCYDLLGPPAALRVRQIITRYSPELADRAAYHSSELKLSTAPDPLTGTG* |
| Ga0181531_104652511 | 3300014169 | Bog | ACYDLLGPLATRRVRQIIARYSPDLAVRANFHNTELTMSDTAEA* |
| Ga0163163_126284212 | 3300014325 | Switchgrass Rhizosphere | FIGCYDLLGPPAALRVRQIITRYSPELADRAAYHSSELKLSAAPDPLAGDG* |
| Ga0157379_105648571 | 3300014968 | Switchgrass Rhizosphere | ALRVRQIITRYSPDLADRAAYHSSELKLSTAPDPLTGTG* |
| Ga0132258_133882911 | 3300015371 | Arabidopsis Rhizosphere | YDLLGPPAALRVRQIITRYSPELADRAAYHSSELKLSAAPAAHT* |
| Ga0182041_102105162 | 3300016294 | Soil | FIACYDLLGPLAARRVRQIITRYSPELADRAAYHSSELKLSAAPDPSAGR |
| Ga0182032_120480561 | 3300016357 | Soil | ARELFIGCYDLLGPLAARRVRQIITRYSPELAGRAAYHSSELKLSAAPDPSAADG |
| Ga0182040_103759913 | 3300016387 | Soil | RARELFIGCYDLLGPLAARRVRQIITRYSPELAGRAAYHSSELKLSAAPDPSAAEG |
| Ga0182037_114510882 | 3300016404 | Soil | PLAARRVRQIIAKYSPDLACRAAYHSTELTVSAADD |
| Ga0134112_103585211 | 3300017656 | Grasslands Soil | LGPPAALRVRQIITRYSPELADRAAYHSSELKLSAAPDPSADR |
| Ga0187818_100229505 | 3300017823 | Freshwater Sediment | LLGPLAARRVRQLITTYSHDLDGRAAYHSSELKLSAAPDPSAADG |
| Ga0187807_10054565 | 3300017926 | Freshwater Sediment | GPLAVRRVRQIIARYSPELSGRAAYHSTELTLSAADA |
| Ga0187806_11775251 | 3300017928 | Freshwater Sediment | ARELFIDCYDRLGPLAVRRVRQIICRYSPELAGRACYHSTELTLSAAED |
| Ga0187814_100322611 | 3300017932 | Freshwater Sediment | LLGPLAARRVRQIITRYSPDLAGRAAYHSSELKLSAAPDPSAADG |
| Ga0187814_102028952 | 3300017932 | Freshwater Sediment | YDLLGPLAARRVRQIITRYSPELAGRAAYHSSELKLSAAPDPASA |
| Ga0187814_102785382 | 3300017932 | Freshwater Sediment | AARELFIGCYDLLGPLAARRVRQIITRYSPDLAGRAAYHSSELKLSAAPDPSAADG |
| Ga0187808_102680412 | 3300017942 | Freshwater Sediment | YDLLGPLAARRVRQIITRYSPELAGLAAYHSSELTLSAAPDPASA |
| Ga0187785_100818103 | 3300017947 | Tropical Peatland | YDLLGPLAALRVRQIITRYSPELADRAAYHSSELKLSAAPDPSAGR |
| Ga0187817_111061822 | 3300017955 | Freshwater Sediment | LLGPLAALRVRQIITRYSPELADRAAYHSSELKLSAAPDLFTADS |
| Ga0187779_112184922 | 3300017959 | Tropical Peatland | LAARRVRQIISRYSPDLAGRAAYHSSELKLSAAPDPST |
| Ga0187782_100419305 | 3300017975 | Tropical Peatland | CYDLLGPLAARRVRQIITRHSPELAGRAAYHSSELKLSAAPDPAST |
| Ga0187782_103418731 | 3300017975 | Tropical Peatland | GGWPRADARELFIGCYDLLGPLAARRVRQIISRYSPDLAGRAAYHSSELKLSAAPDPST |
| Ga0187815_103037081 | 3300018001 | Freshwater Sediment | LLGSLAVRRVRQIIARYSPELSGRAAYHSTELTLSAADA |
| Ga0187805_103933032 | 3300018007 | Freshwater Sediment | RSAARELFIGCYDLLGPLAARRVRQIITRYSPDLAGRAAYHSSELKLSAAPDPSAADG |
| Ga0187810_100508454 | 3300018012 | Freshwater Sediment | LAARRVRQIITRYSPDLAGRAAYHSSELKLSAAPDPSAADG |
| Ga0187810_100777641 | 3300018012 | Freshwater Sediment | LLGPLAARRVRQIITRYSPELAGRAAYHSSELKLSAAPDPAGA |
| Ga0187770_105937091 | 3300018090 | Tropical Peatland | QARELFIGCYDLLGPLAARRVRQIITRYSPELAGRAAYHSSELKLSAAPDPASA |
| Ga0206354_104050982 | 3300020081 | Corn, Switchgrass And Miscanthus Rhizosphere | RATARELFIACYDLLGPIATRRVRQIIARYSPELAIRAAYHNTELEMSDAGAA |
| Ga0210403_104887702 | 3300020580 | Soil | ARRVRQIIARYSPELAGRAAYHSSELKLSAAPDPASA |
| Ga0210399_112129241 | 3300020581 | Soil | RAAARELFIACYDLLGPLAARRVRQIIDRYSPDLACRAAYHSTKLTVSAAEG |
| Ga0210395_108876851 | 3300020582 | Soil | LRVRHIITRYSPDLADRAAYHSSELKLSAAPDPLTAGRAE |
| Ga0210395_112156222 | 3300020582 | Soil | LLGPLAALRVRQIITRYSPELADRAAYHSSELKLSTAPDPSDAA |
| Ga0210404_104047942 | 3300021088 | Soil | DDLLGPLAARRVRQIITRYSPELAGRAAYHSSELKLSAAPDPG |
| Ga0210408_104692742 | 3300021178 | Soil | ELFIGCYDLLGPLAARRVRQIITRYSPELAGRAAYHSSELKLSAAPDPASA |
| Ga0210396_104173052 | 3300021180 | Soil | AALRVRQIITRYSPELADRAAYHSSELKLSTAPDPSDAA |
| Ga0210396_112715242 | 3300021180 | Soil | LAARRVRQIITRYSPELAGRAAYHSSELKLSAAPDPG |
| Ga0210388_100588181 | 3300021181 | Soil | RDLFITCYDLLGPLAARRVRQIISRYSPELACRAAYHSSQLTLSAADD |
| Ga0210388_109647671 | 3300021181 | Soil | AAARELFIGCYDLLGPLAARRVRQIITRYSPELAGRAAYHSSELKLSTAPDPSAG |
| Ga0210388_115591541 | 3300021181 | Soil | AARDLFITCYDLLGPLAARRVRQIIARYSPELAGRAAYHSSQLTLSDADD |
| Ga0210393_107841003 | 3300021401 | Soil | ARELFIGCYDLLGPLAARRVRQIITRYSPELAGRAAYHSSELKLSAAPDPSAG |
| Ga0210393_108545351 | 3300021401 | Soil | LLGPLAARRVRQIIARYSPELAGRAAYHSSELTLSSAED |
| Ga0210385_100571144 | 3300021402 | Soil | LGPLAARRVRQIIDRYSPDLACRAAYHSTKLTVSAAEG |
| Ga0210385_109129041 | 3300021402 | Soil | LGPLAARRVRQIIARYSPELAGRAAYHSSALTLSAAED |
| Ga0210385_110698202 | 3300021402 | Soil | AARDLFITCYDLLGPLAARRVRQIIARYSPDLAGRAAYHSSQLTLADADA |
| Ga0210397_110676431 | 3300021403 | Soil | RAAARELFIGCYDLLGPLAARRVRQIITRYSPELAGRAAYHSSELKLSTAPDPSAG |
| Ga0210389_102156111 | 3300021404 | Soil | IACYDLLGPIATRRVRQIIARYSPELAIRAAYHNTELVMSDGGAA |
| Ga0210389_105951711 | 3300021404 | Soil | CYDLLGPIATRRVRQIIARYSPDLAIRAAYHNTELRMPDAGAGAA |
| Ga0210383_106795373 | 3300021407 | Soil | ELFIGCYDLLGPLAARRVRQIITRYSPELAGRAAYHSSELKLSAAPDPSAG |
| Ga0210383_109475121 | 3300021407 | Soil | ELFIACYDLLGPLATRRVRQIIARYSPDLAVRANFHNTELTMSNTAEA |
| Ga0210383_115297782 | 3300021407 | Soil | AARDLFIATYDLLGPLAAHRVRQVIARYSRDLAARATYHSSGLTAPTAMTVTAK |
| Ga0210394_115783651 | 3300021420 | Soil | ARELFIACYDLLGPLAARRVRQIIDHYSPELACRAAYHSTKLTVSAAEG |
| Ga0210384_112327572 | 3300021432 | Soil | FIGCYDLLGPLAALRVRQIITRYSPDLADRAAYHSSELKLSAAPDPLTAGG |
| Ga0210384_117686301 | 3300021432 | Soil | LRVRQIITRYSPELADRAAYHSSELKLSAAPATAG |
| Ga0210391_100569934 | 3300021433 | Soil | LGPLAARRVRQIITRYSPELAGRAAYHSSELKLSAAPDPG |
| Ga0182009_108311632 | 3300021445 | Soil | DLLGPLAALRVRQIITRYSPELADRAAYHSSELKLSTAPDG |
| Ga0210409_116132702 | 3300021559 | Soil | RVRQIITRYSPELAGRAAYHSSELKLSAAPDPASA |
| Ga0224541_10215252 | 3300022521 | Soil | AARRVRQIITRYSPELAGRAAYHSSELKLSAAPDPASG |
| Ga0242659_11291801 | 3300022522 | Soil | IGCYDLLGPLAARRVRQIITRYSPELAGRAAYHSSELKLSAAPDPG |
| Ga0242663_11450241 | 3300022523 | Soil | DARELFIDCYDRLGPLAVRRVRQIICRYSPELAGRACYHSTELTLSAAED |
| Ga0242669_10054913 | 3300022528 | Soil | GCYDLLGPLAARRVRQIITRYSPELAGRAAYHSSELKLSAAPDPG |
| Ga0242674_10621142 | 3300022711 | Soil | CYDLLGPLAARRVRQIITRYSPELAGRAAYHSSELKLSTAPDPSAG |
| Ga0242675_11352472 | 3300022718 | Soil | IGCYDLLGPLAARRVRQIITRYSPELAGRAAYHSSELKLSAAPDPSAG |
| Ga0247691_10304881 | 3300024222 | Soil | FIACYDLLGPLAALRVRQIITRYSPELADRAAYHSSELKLSTAPDPLTGTG |
| Ga0179589_106189131 | 3300024288 | Vadose Zone Soil | LRVRQIITRHSPELADRAAYHSSELTLSAAPDPLTGTG |
| Ga0207699_109432162 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | LFIGCYDLLGPLAALRVRQIITRYSPELADRAAYHSSELKLSAAPDPLAADG |
| Ga0207699_112194512 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | VRQIITRYSPELADRAAYHSSELKLNTAPDPLTGTG |
| Ga0207684_110963932 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | RVRQIITRYSPELADRAAYHSSELKLSTAPDPSASDGDR |
| Ga0207693_100256851 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | AAARELFIACYDLLGPLAARRVRQIIDRYSPELACRAAYHSTKLTVSAAEG |
| Ga0207693_100534381 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | DLLGPPAALRVRQIITRYSPELADRAAYHSSELKLNTAPDPLTGTG |
| Ga0207693_111275092 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | RQIINRYSPELADRAAYHSSELKLSTAPDPAGHRPGSRG |
| Ga0207663_100685551 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | ECYDLLGPPAALRVRQIITRYSPELADRAAYHSSELKLSAAPDPLTTDG |
| Ga0207663_105926651 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | AALRVRQIITRYSPELADRAAYHSSELKLSTAPDPAADRSTR |
| Ga0207700_102775091 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | AREQFIACYDLLGPLATRRVRQIIARYSPELAGRAAYHNTELTMSDAEA |
| Ga0207700_109112731 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | RQIITRYSPELADRAAYHSSELKLSTAPDPAADRSAR |
| Ga0207664_100183675 | 3300025929 | Agricultural Soil | LAALRVRQIITRYSPELADRAAYHSSELKLSAAPDPAVGRPASA |
| Ga0207664_104044731 | 3300025929 | Agricultural Soil | AALRVRQIITRYSPGLADRAAYHSSELKLSAAPVAHT |
| Ga0207665_110309862 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | AALRVRQIITRYSPELADRAAYHSSELKLNTAPDPLTGTG |
| Ga0207711_100758773 | 3300025941 | Switchgrass Rhizosphere | IGCYDLLGPPAALRVRQIITRYSPELADRAAYHSSELTLSAAPDPLTGTG |
| Ga0207702_100415241 | 3300026078 | Corn Rhizosphere | GPPAALRVRQIITRYSPELADRAAYHSSELKLNTAPDPLTGTG |
| Ga0207676_105874431 | 3300026095 | Switchgrass Rhizosphere | LLGPPAALRVRQIITRYSPELADRAAYHSSELKLNTAPDPLTGTG |
| Ga0207676_122606381 | 3300026095 | Switchgrass Rhizosphere | GCYDLLGPLAALRVRQIITRYSPELADRAAYHSSELKLSTAPDPAADRSTR |
| Ga0257154_10070843 | 3300026467 | Soil | RELFIGCYDLLGPLAARRVRQIITRYSPDLAGRAAYHSSELKLSAAPDPG |
| Ga0179593_11892871 | 3300026555 | Vadose Zone Soil | TARELFSACYNLLGPIATRRVRQIIARYSPELANRATYHNTELRMPDAGAGAGAA |
| Ga0209005_10255681 | 3300027037 | Forest Soil | ELFIACYDLLGPIATRRVRQIIARYSPELAIRAAFHNTELVMSDAGAA |
| Ga0208488_10527192 | 3300027110 | Forest Soil | YDQLGPLAAHRVRQIIGRYNRDLAAKAAYHSSELTTTVAR |
| Ga0208488_10702981 | 3300027110 | Forest Soil | LAARRVRQIIARYSPELAGRAAYHSSALTLSSAED |
| Ga0208725_10521591 | 3300027158 | Forest Soil | GPLAARRVRQIIARYSPELAGRAAYHSSELTLASAED |
| Ga0208324_10095061 | 3300027604 | Peatlands Soil | AALRVRQIITRYGPELADRAAYHSSELKLSAAPDS |
| Ga0209178_12530422 | 3300027725 | Agricultural Soil | LLGPLAALRVRQIITRYSPELADRAAYHSSELKLSAAPDPLAAGG |
| Ga0209060_101898471 | 3300027826 | Surface Soil | SPLAARRVRQIIARYSPELAGRAAYHSSQLTLSAAPDPSAGDG |
| Ga0209693_102049991 | 3300027855 | Soil | ARELFVACYDLLGPIATRRVRQVIARFSPELAVRAAYHNSALVMSDAVA |
| Ga0209465_104806711 | 3300027874 | Tropical Forest Soil | RATARELFIACYDLLGPLAVSRVRQIIARYSPELSGRAAYHSTELTLSAADA |
| Ga0209169_100241245 | 3300027879 | Soil | RRVRQIITRYSPELAGRAAYHSSELKLSTAPGADGS |
| Ga0209590_100459362 | 3300027882 | Vadose Zone Soil | LFIGCYDLLGPLAALRVRQIITRYSPELADRAAYHSSELKLSAAPDPSTADA |
| Ga0209275_100502333 | 3300027884 | Soil | YDLLGPLAARRVRQIITRYSPELAGRAAYHSSELKLSAAPDPG |
| Ga0209624_102247381 | 3300027895 | Forest Soil | ARELFIACYDLLGPIATRRVRQIIARYSPELAIRAVYHNTELRMPDAGAA |
| Ga0209624_103857104 | 3300027895 | Forest Soil | RRVRQIITRYSPELADRAAYHSSQLKLSTAPGADGS |
| Ga0209415_104415021 | 3300027905 | Peatlands Soil | ARELFIGCYDLLGPLAARRVRQIITRYSPDLAGRAAYHSSELKLSAAPDPSAADG |
| Ga0265357_10129091 | 3300028023 | Rhizosphere | GPLAARRVRQIIDRYSPDLACRAAYHSTKLTVSAAEG |
| Ga0302225_104764972 | 3300028780 | Palsa | LGPLAARRVRQIITRYSPELAGRAAYHSSELKLSAAPDPASG |
| Ga0307306_100829451 | 3300028782 | Soil | YDLLGPPAALRVRQIITRYSPELADRAAYHSSELKLSTAPVPENAGS |
| Ga0302235_103791381 | 3300028877 | Palsa | CYDLLGPLAARRVRQIIARYSPELAGRAAYHSSQLTLSDADA |
| Ga0302235_104276412 | 3300028877 | Palsa | RAAARELFISCYDLLGPPAARRVRQIICRYSPDLAVRAAYHSSGLTLSTADD |
| Ga0222748_11184662 | 3300029701 | Soil | IGCYDLLGPLAARRVRQIITRYSPDLAGRAAYHSSELKLSAAPDPSAG |
| Ga0311368_103204242 | 3300029882 | Palsa | LLGPLAARRVRQIIARYSPELAGRAAYHSSQLTLSDADA |
| Ga0311369_110129752 | 3300029910 | Palsa | LAARRVRQIITRYSPELAGRAAYHSSELKLSAAPDPASG |
| Ga0311371_109616463 | 3300029951 | Palsa | PLAARRVRQIIARYSPDLAGRAAYHSSQLTLSAVDD |
| Ga0311339_114258541 | 3300029999 | Palsa | DLLGPLATRRVRQIIARYSPELAGRAAYHNTELAMSDGS |
| Ga0302184_100534401 | 3300030490 | Palsa | YDLLGPLAARRVRQIIARYSPELAGRAAYHSSQLTLSDADG |
| Ga0210252_110917211 | 3300030548 | Soil | LLGPLAARRVRQIIGRYSPELAGRAAYHSSRLTLSAADD |
| Ga0302317_100603802 | 3300030677 | Palsa | FITCYDLLGPLAARRVRQIIARYSPELAGRAAYHSSQLTLSDADG |
| Ga0307482_11360342 | 3300030730 | Hardwood Forest Soil | LDLLGPLATRRVRQIIARYSPELAGRANFHNTELTMAEEPS |
| Ga0265460_103488832 | 3300030740 | Soil | FFFYILFIGCYDLLGPLAARRVRQIITRYSPELAGRAAYHSSELKLSAAPDPASA |
| Ga0302308_101485071 | 3300031027 | Palsa | LFITCYDLLGPLAARRVRQIIARYSPELAGRAAYHSSQLTLSDADG |
| Ga0265760_100111551 | 3300031090 | Soil | GPLAALRVRQIITRYSPELADRAAYHSSELKLSTAPDPSDAA |
| Ga0302325_107894972 | 3300031234 | Palsa | PLAARRVRQIIARYSPELACRAAYHSTELTLSAAED |
| Ga0318534_100834233 | 3300031544 | Soil | YDLLGPLAVGRVRQIIARYSPDLADRAAYHSSQLTLAAAAD |
| Ga0318534_101101211 | 3300031544 | Soil | AAQRVRQIITRYSPELADRAAYHSSELKLSTAPAGPGS |
| Ga0318534_104792851 | 3300031544 | Soil | GCYDLLGPLAARRVRQIITRYSPELAGRAAYHSSELKLSAAPDPSGADG |
| Ga0318571_100996311 | 3300031549 | Soil | RRVRQIITRYSPELAGRAAYHSSELKLSAAPDPLAAEG |
| Ga0318573_100851333 | 3300031564 | Soil | RRIRQIITRYSPELAGRAAYHSSELKLSAAPDPSAADG |
| Ga0318515_106429642 | 3300031572 | Soil | VVGGPLAAMRVRQIITRYSPELADRAAYHSSELKLSAAPSAADD |
| Ga0310915_101017581 | 3300031573 | Soil | FIACYDLLGPPAALRIRQIITRYSPELADRAAYHSSELKLSAAPLVADG |
| Ga0318542_104859012 | 3300031668 | Soil | DLLGPLAARRVRQIITRYSPELAGRAAYHSSELKLSAAPDPSAAEG |
| Ga0318572_107462532 | 3300031681 | Soil | FIGCYDLLGPLAARRVRQIITRYSPELAGRAAYHSSELKLSAAPDPSAADG |
| Ga0318560_103476082 | 3300031682 | Soil | LFITCYDLLGPLAVRRVRQIITRYSPDLADRAAYHSSQLTLAAAAD |
| Ga0310686_1045181544 | 3300031708 | Soil | GCYDLLGPLAALRVRQIITRYSPELADRAAYHSSELKLSTAPAADSRATDS |
| Ga0310686_1045211492 | 3300031708 | Soil | GCYDLLGPLAALRVRQIITRYSPELADRAAYHSSELKLSTAPDPSDAA |
| Ga0307476_101464292 | 3300031715 | Hardwood Forest Soil | LAARRVRQIIARYSPELAGRAAYHSSELTLSSAED |
| Ga0307474_104544781 | 3300031718 | Hardwood Forest Soil | ELFSACYNLLGPIATRRVRQIIARYSPELANRATYHNTELRMPDAGAGAGAA |
| Ga0307474_111488911 | 3300031718 | Hardwood Forest Soil | GTARELFSACYNLLGPIATRRVRQIIARYSPELANRATYHNTELRMPDAGAGAGAGAGAG |
| Ga0307474_115828452 | 3300031718 | Hardwood Forest Soil | DLLGPPAALRVRQIITRYSPELADRAAYHSSELKLSAAPDR |
| Ga0306917_112526592 | 3300031719 | Soil | YDLLGPLAARRVRQIITRYSPELAGRAAYHSSELKLSAAPDPSAADG |
| Ga0318493_100029406 | 3300031723 | Soil | RELFITCYDLLGPLAVGRVRQIIARYSPDLADRAAYHSSQLTLAAAAD |
| Ga0318501_106669232 | 3300031736 | Soil | LGPLAARRVRQIITRYSPELAGRAAYHSSELKLSAAPDPASV |
| Ga0307468_1002272111 | 3300031740 | Hardwood Forest Soil | ALRVRQIITRYSPELADRAAYHSSELKLSTAPDPLTGTG |
| Ga0318502_102874272 | 3300031747 | Soil | TRRARRIRQIITRYSPELAGRAAYHSSELKLSAAPDPSATDG |
| Ga0307477_101924501 | 3300031753 | Hardwood Forest Soil | RVRQIITRYSPELAGRAAYHSSELKLSAAPDPSAADG |
| Ga0307475_114231411 | 3300031754 | Hardwood Forest Soil | DLLGPLAARRVRQIITRYSPELAGRAAYHSSELKLSAAPDPG |
| Ga0318526_102711072 | 3300031769 | Soil | CYDLLGPLAARRVRQIIDRYSPDLACRAAYHSTELTVSAADA |
| Ga0318521_104046921 | 3300031770 | Soil | GRRPARRVRQIITRYSPELAGRAAYHSSELKLSAAPDPSAAEG |
| Ga0318546_100432724 | 3300031771 | Soil | RELFIGCYDLLGPLAARRIRQIITRYSPELAGRAAYHSSELKLSAAPDPSAADG |
| Ga0318498_100892591 | 3300031778 | Soil | LRIRQIITRYSPELADRAAYHSSELKLSAAPLVADG |
| Ga0318498_105499781 | 3300031778 | Soil | PRAEARELFITCYDLLGPLAVGRVRQIITRYSPDLADRAAYHSSQLTVAAAD |
| Ga0318552_100369911 | 3300031782 | Soil | DLLGPPAALRVRQIITRYSPELADRAAYHSSELKLSAAPDPSAGR |
| Ga0318552_101154943 | 3300031782 | Soil | ARRVRQIITRYSPELAGRAAYHSSELKLSAAPDPSAAEG |
| Ga0318548_103706331 | 3300031793 | Soil | DLLGPPAALRIRQIITRYSPELADRAAYHSSELKLSAAPLVADG |
| Ga0318548_105059132 | 3300031793 | Soil | VGGPLAVRRVRQIITRYSPDLADRAAYHSSQLTLAAAAD |
| Ga0318503_102537922 | 3300031794 | Soil | RRVRQIITRYSPELAGRAAYHSSELKLSAAPDPSAADG |
| Ga0318557_105600942 | 3300031795 | Soil | VPRRVRQIITRYSPELAGRAAYHSSELKLSAAPDPLAAEG |
| Ga0318497_102182161 | 3300031805 | Soil | AELFIACYDLLGPLAARRVRQIIAKYSPDLACRAAYHSTELTVSAADD |
| Ga0318497_104276201 | 3300031805 | Soil | VRQIITRYSPELADRAAYHSSELKLSAAPDPSAGR |
| Ga0318568_109008181 | 3300031819 | Soil | LLGPLAARRVRQIIAKYSPDLACRAAYHSTELTVSAADA |
| Ga0318568_109022612 | 3300031819 | Soil | YDLLGPPAALRVRQIITRYSPELADRAAYHSSELKLSAAPDPSAGR |
| Ga0307478_102259101 | 3300031823 | Hardwood Forest Soil | AARELFIACYDLLGPLAARRVRQIIDRYSPELACRAAYHSTKLTVSAAEG |
| Ga0318517_102325831 | 3300031835 | Soil | CYDLLGLLAVGRVRQIIARYSPDLADRAAYHSSQLTLAAAAD |
| Ga0306919_102054371 | 3300031879 | Soil | RQIITRYSPELAGRAAYHSSELKLSAAPDPLAAEG |
| Ga0306919_108573931 | 3300031879 | Soil | AQRVRQIITRYSPELADRAAYHSSELKLSTAPAGPGS |
| Ga0306925_121609841 | 3300031890 | Soil | FIGCYDLLGPLAAQRVRQIITRYSPELADRAAYHSSELKLSTAPAGPGS |
| Ga0318536_103570571 | 3300031893 | Soil | IGCYDLLGPLAAQRVRQIITRYSPELADRAAYHSSELKLSTAPAGPGS |
| Ga0318551_101240621 | 3300031896 | Soil | GLLAVGRVRQIIARYSPDLADRAAYHSSQLTLAAAAD |
| Ga0306921_108926353 | 3300031912 | Soil | AQARELFIGCYDLLGPLAARRIRQIITRYSPELAGRAAYHSSELKLSAAPDPSAADG |
| Ga0308174_101108953 | 3300031939 | Soil | DLLGPPAALRVRQIITRYSPELADRAAYHSSELKLSTAPVPDNAGS |
| Ga0308174_118699181 | 3300031939 | Soil | ACYDLLGPLATRRVRQIIARYSPELAHRAAYHNTELAMSDAD |
| Ga0310912_103220483 | 3300031941 | Soil | CYDLLGPLAARRVRQIITRYSPELAGRAAYHSSELKLSAAPDPLAAEG |
| Ga0310913_101273121 | 3300031945 | Soil | ASARELFIACYDLLGPPAALRIRQIITRYSPELADRAAYHSSELKLSAAPLVADG |
| Ga0310913_109573321 | 3300031945 | Soil | DLLGPLAVGRVRQIIARYSPDLADRAAYHSSQLTLAAAAD |
| Ga0310910_100623081 | 3300031946 | Soil | AQARELFIGCYDLLGPLAARRVRQIITRYSPELAGRAAYHSSELKLSAAPDPLAAEG |
| Ga0310909_102634273 | 3300031947 | Soil | GPLAARRVRQIIDKYSPDLACRAAYHSTELTVSAADA |
| Ga0306922_110587762 | 3300032001 | Soil | RELFIGCYDLLGPLAARRVRQIITRYSPELAGRAAYHSSELKLSAAPDPSAADG |
| Ga0306922_119079142 | 3300032001 | Soil | LAAQRVRQIITRYSPELADRAAYHSSELKLSTAPAGPGS |
| Ga0318563_102100471 | 3300032009 | Soil | EARELFITCYDLLGPLAVRRVRQIITRYSPDLADRAAYHSSQLTVAAAD |
| Ga0318569_103447312 | 3300032010 | Soil | PRPAARELFIACYDLLGPLAARRVRQIIAKYSPDLACRAAYHSTELTVSAADA |
| Ga0318559_106153481 | 3300032039 | Soil | LFIGCYDLLGPLAARRVRQIITRYSPELAGRAAYHSSELKLSAAPDPSAAEG |
| Ga0318549_100363773 | 3300032041 | Soil | QRVRQIITRYSPELADRAAYHSSELKLSTAPAGPGS |
| Ga0318549_104209412 | 3300032041 | Soil | FIGCYDLLGPLAARRIRQIITRYSPELAGRAAYHSSELKLSAAPDPSATDG |
| Ga0318506_101915601 | 3300032052 | Soil | LAARRVRQIITRYSPELAGRAAYHSSELKLSAAPDPSAAEG |
| Ga0318570_100309241 | 3300032054 | Soil | SRARARELFIGCYDLLGPLAARRVRQIITRYSPELAGRAAYHSSELKLSAAPDPLAAEG |
| Ga0318524_100320881 | 3300032067 | Soil | ELFITCYDLLGPLAVRRVRQIITRYSPDLADRAAYHSSQLTLAAAAD |
| Ga0318577_105790281 | 3300032091 | Soil | YDLLGPLAVRRVRQIIARYSPDLADRAAYHSSQLTLAAAAD |
| Ga0311301_111173451 | 3300032160 | Peatlands Soil | CYDLLGPLATRRVRQIIARYSPDLAVRANFHNTELTMSDTAEA |
| Ga0311301_116076012 | 3300032160 | Peatlands Soil | GCYDLLGPLAALRVRQIITRYGPELADRAAYHSSELKLSAAPSGADGS |
| Ga0307471_1008093021 | 3300032180 | Hardwood Forest Soil | PAALRVRQIITRYSPELANRAAYHSSELKLSAAPVASAPDG |
| Ga0306920_1036905502 | 3300032261 | Soil | LAALRVRQIITRYSPELADRAAYHSSELKLSAAPASASASDG |
| Ga0348332_139036721 | 3300032515 | Plant Litter | LAALRVRQIITRYSPELADRAAYHSSELKLSTAPDPSDAA |
| Ga0335085_103770363 | 3300032770 | Soil | RELFIACYDLLGPLAARRVRQIIDRYSPELACRAAYHSTKLTVSAAEG |
| Ga0335071_116593421 | 3300032897 | Soil | FIGCYDLLGPLAALRVRQIITRYSPELADRAAYHSSELKLSAAPSTDG |
| Ga0335083_110244832 | 3300032954 | Soil | RSAARDLFIGCYGPLAALRVRQIITRYSPELADRAAYHSSELKLSAAPDR |
| Ga0335076_102145711 | 3300032955 | Soil | PLAAHRVRQIIGRYSPELARFATHHSSELQTAAPPR |
| Ga0335073_100890021 | 3300033134 | Soil | AWPRTAARELFIACYDLLGPLAARRVRQIIDRYSPDLACRAAYHSTTLTVSAAEG |
| Ga0335073_112137502 | 3300033134 | Soil | ACYDLLGPLGARRVRQIITRYSPELADRAAYHSSELKLSAAP |
| Ga0318519_110612852 | 3300033290 | Soil | LFIGCYDLLGPLAARRVRQIITRYSPELAGRAAYHSSELKLSAAPDPSAADG |
| Ga0314864_0110172_1_120 | 3300033805 | Peatland | PLAALRVRQIITRYSPELAGRAAYHSSELKLSAAPSADG |
| ⦗Top⦘ |