Metagenome Family F014021

Basic Information
Family ID	F014021
Family Type	Metagenome
Number of Sequences	266
Average Sequence Length	42 residues
Representative Sequence	VTHLDLRAATAKQVQQLRFVDFEVWFPPRRDERASEGFYTPL
Number of Associated Samples	75
Number of Associated Scaffolds	266

Quality Assessment
Transcriptomic Evidence	No
Most common taxonomic group	Eukaryota
% of genes with valid RBS motifs	66.17 %
% of genes near scaffold ends (potentially truncated)	68.42 %
% of genes from short scaffolds (< 2000 bps)	100.00 %
Associated GOLD sequencing projects	75
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.30

Most Common Taxonomy
Group	Eukaryota (69.173 % of family members)
NCBI Taxonomy ID	2759
Taxonomy	All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere (95.113 % of family members)
Environment Ontology (ENVO)	Unclassified (95.489 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant surface (95.489 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 25.71% β-sheet: 0.00% Coil/Unstructured: 74.29%
Feature Viewer

Powered by Feature Viewer

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	69.92 %
Unclassified	root	N/A	30.08 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	69.17 %
Unclassified	root	N/A	30.08 %
Viruses	superkingdom	All Organisms → Viruses	0.75 %

Name	Rank	Taxonomy	Distribution
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	69.17 %
Unclassified	root	N/A	30.08 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.75 %

Name	Rank	Taxonomy	Distribution
Viridiplantae	kingdom	All Organisms → cellular organisms → Eukaryota → Viridiplantae	69.17 %
Unclassified	root	N/A	30.08 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.75 %

Name	Rank	Taxonomy	Distribution
Streptophyta	phylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	69.17 %
Unclassified	root	N/A	30.08 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.75 %

Name	Rank	Taxonomy	Distribution
Streptophytina	subphylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina	69.17 %
Unclassified	root	N/A	30.08 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.75 %

Name	Rank	Taxonomy	Distribution
Embryophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	69.17 %
Unclassified	root	N/A	30.08 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.75 %

Name	Rank	Taxonomy	Distribution
Tracheophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta	69.17 %
Unclassified	root	N/A	30.08 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.75 %

Name	Rank	Taxonomy	Distribution
Euphyllophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta	69.17 %
Unclassified	root	N/A	30.08 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.75 %

Name	Rank	Taxonomy	Distribution
Spermatophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta	69.17 %
Unclassified	root	N/A	30.08 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.75 %

Name	Rank	Taxonomy	Distribution
Magnoliopsida	class	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	69.17 %
Unclassified	root	N/A	30.08 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.75 %

Name	Rank	Taxonomy	Distribution
Mesangiospermae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae	69.17 %
Unclassified	root	N/A	30.08 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.75 %

Name	Rank	Taxonomy	Distribution
Liliopsida	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida	69.17 %
Unclassified	root	N/A	30.08 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.75 %

Name	Rank	Taxonomy	Distribution
Petrosaviidae	subclass	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae	69.17 %
Unclassified	root	N/A	30.08 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.75 %

Name	Rank	Taxonomy	Distribution
commelinids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids	69.17 %
Unclassified	root	N/A	30.08 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.75 %

Name	Rank	Taxonomy	Distribution
Poales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales	69.17 %
Unclassified	root	N/A	30.08 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.75 %

Name	Rank	Taxonomy	Distribution
Poaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	69.17 %
Unclassified	root	N/A	30.08 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.75 %

Name	Rank	Taxonomy	Distribution
PACMAD clade	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade	69.17 %
Unclassified	root	N/A	30.08 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.75 %

Name	Rank	Taxonomy	Distribution
Panicoideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	69.17 %
Unclassified	root	N/A	30.08 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.75 %

Name	Rank	Taxonomy	Distribution
Andropogonodae	no rank	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae	69.17 %
Unclassified	root	N/A	30.08 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.75 %

Name	Rank	Taxonomy	Distribution
Andropogoneae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	69.17 %
Unclassified	root	N/A	30.08 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.75 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	30.08 %
Saccharinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae	17.67 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.75 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	30.08 %
Saccharum	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum	17.67 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.75 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	30.08 %
Saccharum officinarum complex	no rank	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex	17.67 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.75 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	30.08 %
Saccharum hybrid cultivar	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum hybrid cultivar	17.67 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.75 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300005840\|Ga0068870_11397441	Not Available	513	Open in IMG/M
3300006358\|Ga0068871_101038131	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum hybrid cultivar	765	Open in IMG/M
3300009148\|Ga0105243_11585017	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	681	Open in IMG/M
3300009148\|Ga0105243_12541449	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum hybrid cultivar	551	Open in IMG/M
3300009176\|Ga0105242_12553993	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum hybrid cultivar	559	Open in IMG/M
3300011119\|Ga0105246_10863497	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum hybrid cultivar	808	Open in IMG/M
3300011119\|Ga0105246_11738831	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	594	Open in IMG/M
3300013297\|Ga0157378_11109046	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum hybrid cultivar	828	Open in IMG/M
3300013297\|Ga0157378_11982547	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	632	Open in IMG/M
3300013297\|Ga0157378_12504735	Not Available	568	Open in IMG/M
3300013297\|Ga0157378_12758573	Not Available	544	Open in IMG/M
3300015267\|Ga0182122_1009189	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum hybrid cultivar	878	Open in IMG/M
3300015267\|Ga0182122_1023404	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum hybrid cultivar	687	Open in IMG/M
3300015267\|Ga0182122_1038906	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	599	Open in IMG/M
3300015267\|Ga0182122_1063222	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	522	Open in IMG/M
3300015268\|Ga0182154_1023946	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum hybrid cultivar	685	Open in IMG/M
3300015268\|Ga0182154_1037851	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	608	Open in IMG/M
3300015268\|Ga0182154_1046351	Not Available	574	Open in IMG/M
3300015268\|Ga0182154_1048047	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	569	Open in IMG/M
3300015268\|Ga0182154_1057712	Not Available	540	Open in IMG/M
3300015269\|Ga0182113_1039562	Not Available	659	Open in IMG/M
3300015269\|Ga0182113_1055267	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	599	Open in IMG/M
3300015269\|Ga0182113_1077879	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	539	Open in IMG/M
3300015269\|Ga0182113_1081498	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	532	Open in IMG/M
3300015274\|Ga0182188_1062058	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	503	Open in IMG/M
3300015275\|Ga0182172_1010052	Not Available	877	Open in IMG/M
3300015275\|Ga0182172_1011447	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	847	Open in IMG/M
3300015275\|Ga0182172_1057185	Not Available	549	Open in IMG/M
3300015275\|Ga0182172_1060314	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum hybrid cultivar	541	Open in IMG/M
3300015275\|Ga0182172_1063672	Not Available	532	Open in IMG/M
3300015276\|Ga0182170_1021202	Not Available	725	Open in IMG/M
3300015276\|Ga0182170_1050601	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum hybrid cultivar	570	Open in IMG/M
3300015277\|Ga0182128_1070363	Not Available	521	Open in IMG/M
3300015279\|Ga0182174_1021640	Not Available	746	Open in IMG/M
3300015279\|Ga0182174_1022291	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	740	Open in IMG/M
3300015279\|Ga0182174_1050300	Not Available	591	Open in IMG/M
3300015279\|Ga0182174_1068860	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	538	Open in IMG/M
3300015281\|Ga0182160_1014691	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum hybrid cultivar	817	Open in IMG/M
3300015281\|Ga0182160_1043275	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	610	Open in IMG/M
3300015281\|Ga0182160_1058519	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	560	Open in IMG/M
3300015281\|Ga0182160_1064655	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum hybrid cultivar	544	Open in IMG/M
3300015282\|Ga0182124_1016280	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum hybrid cultivar	788	Open in IMG/M
3300015283\|Ga0182156_1048560	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	601	Open in IMG/M
3300015283\|Ga0182156_1058030	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	570	Open in IMG/M
3300015283\|Ga0182156_1067860	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	544	Open in IMG/M
3300015283\|Ga0182156_1074100	Not Available	530	Open in IMG/M
3300015283\|Ga0182156_1076032	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum hybrid cultivar	525	Open in IMG/M
3300015283\|Ga0182156_1086930	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	504	Open in IMG/M
3300015284\|Ga0182101_1048777	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	644	Open in IMG/M
3300015285\|Ga0182186_1022329	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	734	Open in IMG/M
3300015285\|Ga0182186_1069495	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	530	Open in IMG/M
3300015286\|Ga0182176_1031421	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	688	Open in IMG/M
3300015286\|Ga0182176_1034224	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	671	Open in IMG/M
3300015286\|Ga0182176_1085084	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	502	Open in IMG/M
3300015287\|Ga0182171_1061576	Not Available	561	Open in IMG/M
3300015287\|Ga0182171_1063457	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum hybrid cultivar	556	Open in IMG/M
3300015287\|Ga0182171_1064281	Not Available	554	Open in IMG/M
3300015287\|Ga0182171_1073840	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum hybrid cultivar	531	Open in IMG/M
3300015288\|Ga0182173_1028622	Not Available	690	Open in IMG/M
3300015288\|Ga0182173_1054082	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	578	Open in IMG/M
3300015288\|Ga0182173_1079058	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum hybrid cultivar	516	Open in IMG/M
3300015289\|Ga0182138_1028689	Not Available	697	Open in IMG/M
3300015289\|Ga0182138_1037182	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	650	Open in IMG/M
3300015289\|Ga0182138_1043738	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	620	Open in IMG/M
3300015291\|Ga0182125_1028199	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum hybrid cultivar	715	Open in IMG/M
3300015291\|Ga0182125_1031435	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	693	Open in IMG/M
3300015291\|Ga0182125_1038026	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	657	Open in IMG/M
3300015291\|Ga0182125_1047291	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	619	Open in IMG/M
3300015292\|Ga0182141_1022868	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	755	Open in IMG/M
3300015292\|Ga0182141_1036236	Not Available	666	Open in IMG/M
3300015292\|Ga0182141_1052491	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum hybrid cultivar	599	Open in IMG/M
3300015292\|Ga0182141_1056154	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	587	Open in IMG/M
3300015294\|Ga0182126_1013948	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	872	Open in IMG/M
3300015294\|Ga0182126_1047611	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	620	Open in IMG/M
3300015294\|Ga0182126_1051965	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	604	Open in IMG/M
3300015294\|Ga0182126_1071579	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	550	Open in IMG/M
3300015295\|Ga0182175_1009192	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	990	Open in IMG/M
3300015295\|Ga0182175_1059800	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	586	Open in IMG/M
3300015295\|Ga0182175_1075637	Not Available	546	Open in IMG/M
3300015295\|Ga0182175_1080973	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	535	Open in IMG/M
3300015295\|Ga0182175_1086261	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	524	Open in IMG/M
3300015295\|Ga0182175_1087634	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum hybrid cultivar	521	Open in IMG/M
3300015295\|Ga0182175_1093208	Not Available	511	Open in IMG/M
3300015296\|Ga0182157_1019674	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	815	Open in IMG/M
3300015296\|Ga0182157_1065623	Not Available	578	Open in IMG/M
3300015296\|Ga0182157_1078148	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum hybrid cultivar	548	Open in IMG/M
3300015298\|Ga0182106_1013891	Not Available	905	Open in IMG/M
3300015298\|Ga0182106_1094864	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	515	Open in IMG/M
3300015298\|Ga0182106_1096796	Not Available	512	Open in IMG/M
3300015298\|Ga0182106_1099597	Not Available	507	Open in IMG/M
3300015299\|Ga0182107_1030640	Not Available	725	Open in IMG/M
3300015299\|Ga0182107_1055872	Not Available	610	Open in IMG/M
3300015299\|Ga0182107_1091711	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	524	Open in IMG/M
3300015300\|Ga0182108_1034980	Not Available	703	Open in IMG/M
3300015300\|Ga0182108_1068764	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	577	Open in IMG/M
3300015300\|Ga0182108_1076279	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	559	Open in IMG/M
3300015302\|Ga0182143_1033100	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	707	Open in IMG/M
3300015302\|Ga0182143_1061132	Not Available	593	Open in IMG/M
3300015302\|Ga0182143_1062398	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	590	Open in IMG/M
3300015302\|Ga0182143_1077733	Not Available	551	Open in IMG/M
3300015302\|Ga0182143_1104426	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	502	Open in IMG/M
3300015303\|Ga0182123_1033579	Not Available	685	Open in IMG/M
3300015303\|Ga0182123_1054472	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	599	Open in IMG/M
3300015303\|Ga0182123_1065357	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	569	Open in IMG/M
3300015303\|Ga0182123_1067999	Not Available	562	Open in IMG/M
3300015303\|Ga0182123_1088374	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	520	Open in IMG/M
3300015303\|Ga0182123_1096310	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	506	Open in IMG/M
3300015304\|Ga0182112_1048160	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	638	Open in IMG/M
3300015304\|Ga0182112_1076423	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	556	Open in IMG/M
3300015304\|Ga0182112_1093227	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	523	Open in IMG/M
3300015305\|Ga0182158_1012719	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	918	Open in IMG/M
3300015305\|Ga0182158_1028195	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum hybrid cultivar	739	Open in IMG/M
3300015305\|Ga0182158_1062829	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	588	Open in IMG/M
3300015305\|Ga0182158_1066418	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	578	Open in IMG/M
3300015305\|Ga0182158_1093035	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	521	Open in IMG/M
3300015308\|Ga0182142_1028074	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	767	Open in IMG/M
3300015308\|Ga0182142_1043907	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	674	Open in IMG/M
3300015308\|Ga0182142_1087365	Not Available	548	Open in IMG/M
3300015308\|Ga0182142_1104757	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum hybrid cultivar	518	Open in IMG/M
3300015314\|Ga0182140_1016384	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	892	Open in IMG/M
3300015314\|Ga0182140_1023017	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	811	Open in IMG/M
3300015314\|Ga0182140_1043519	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	678	Open in IMG/M
3300015314\|Ga0182140_1077744	Not Available	571	Open in IMG/M
3300015314\|Ga0182140_1087528	Not Available	550	Open in IMG/M
3300015321\|Ga0182127_1062584	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum hybrid cultivar	626	Open in IMG/M
3300015321\|Ga0182127_1075458	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	591	Open in IMG/M
3300015321\|Ga0182127_1108741	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	525	Open in IMG/M
3300015321\|Ga0182127_1112967	Not Available	519	Open in IMG/M
3300015321\|Ga0182127_1121073	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	507	Open in IMG/M
3300015322\|Ga0182110_1029660	Not Available	777	Open in IMG/M
3300015322\|Ga0182110_1093218	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	551	Open in IMG/M
3300015322\|Ga0182110_1106219	Not Available	529	Open in IMG/M
3300015323\|Ga0182129_1037995	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	702	Open in IMG/M
3300015323\|Ga0182129_1066427	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum hybrid cultivar	596	Open in IMG/M
3300015323\|Ga0182129_1108972	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	512	Open in IMG/M
3300015323\|Ga0182129_1113216	Not Available	506	Open in IMG/M
3300015341\|Ga0182187_1062739	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	758	Open in IMG/M
3300015341\|Ga0182187_1138673	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	575	Open in IMG/M
3300015341\|Ga0182187_1180549	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	522	Open in IMG/M
3300015341\|Ga0182187_1202236	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	500	Open in IMG/M
3300015342\|Ga0182109_1055554	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	839	Open in IMG/M
3300015342\|Ga0182109_1098475	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	684	Open in IMG/M
3300015342\|Ga0182109_1110793	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	655	Open in IMG/M
3300015342\|Ga0182109_1116841	Not Available	642	Open in IMG/M
3300015342\|Ga0182109_1172834	Not Available	555	Open in IMG/M
3300015342\|Ga0182109_1187220	Not Available	538	Open in IMG/M
3300015342\|Ga0182109_1205234	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	519	Open in IMG/M
3300015342\|Ga0182109_1213859	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	511	Open in IMG/M
3300015342\|Ga0182109_1223742	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	502	Open in IMG/M
3300015342\|Ga0182109_1224557	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	501	Open in IMG/M
3300015343\|Ga0182155_1108258	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	658	Open in IMG/M
3300015343\|Ga0182155_1121984	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	631	Open in IMG/M
3300015343\|Ga0182155_1173758	Not Available	554	Open in IMG/M
3300015344\|Ga0182189_1102681	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	679	Open in IMG/M
3300015345\|Ga0182111_1128649	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	645	Open in IMG/M
3300015345\|Ga0182111_1131807	Not Available	639	Open in IMG/M
3300015345\|Ga0182111_1179656	Not Available	567	Open in IMG/M
3300015345\|Ga0182111_1209481	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	534	Open in IMG/M
3300015345\|Ga0182111_1212656	Not Available	531	Open in IMG/M
3300015345\|Ga0182111_1235829	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum hybrid cultivar	510	Open in IMG/M
3300015346\|Ga0182139_1062317	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	842	Open in IMG/M
3300015346\|Ga0182139_1115940	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	671	Open in IMG/M
3300015346\|Ga0182139_1127761	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum hybrid cultivar	647	Open in IMG/M
3300015346\|Ga0182139_1142289	Not Available	621	Open in IMG/M
3300015346\|Ga0182139_1143917	Not Available	619	Open in IMG/M
3300015346\|Ga0182139_1155593	Not Available	601	Open in IMG/M
3300015346\|Ga0182139_1232685	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	513	Open in IMG/M
3300015346\|Ga0182139_1243370	Not Available	503	Open in IMG/M
3300015347\|Ga0182177_1033406	All Organisms → Viruses → Predicted Viral	1053	Open in IMG/M
3300015347\|Ga0182177_1206044	Not Available	541	Open in IMG/M
3300015347\|Ga0182177_1217123	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum hybrid cultivar	530	Open in IMG/M
3300015351\|Ga0182161_1057565	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum hybrid cultivar	911	Open in IMG/M
3300015351\|Ga0182161_1148170	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	637	Open in IMG/M
3300015351\|Ga0182161_1180786	Not Available	589	Open in IMG/M
3300015351\|Ga0182161_1221050	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	543	Open in IMG/M
3300015351\|Ga0182161_1241944	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	523	Open in IMG/M
3300015355\|Ga0182159_1112200	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	819	Open in IMG/M
3300015355\|Ga0182159_1184518	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum hybrid cultivar	665	Open in IMG/M
3300015355\|Ga0182159_1213962	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	624	Open in IMG/M
3300015355\|Ga0182159_1234497	Not Available	600	Open in IMG/M
3300015355\|Ga0182159_1249897	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	584	Open in IMG/M
3300015355\|Ga0182159_1279122	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	556	Open in IMG/M
3300015361\|Ga0182145_1132200	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	573	Open in IMG/M
3300015361\|Ga0182145_1165712	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	530	Open in IMG/M
3300015361\|Ga0182145_1193703	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum hybrid cultivar	503	Open in IMG/M
3300017404\|Ga0182203_1045229	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	760	Open in IMG/M
3300017407\|Ga0182220_1024824	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	754	Open in IMG/M
3300017407\|Ga0182220_1029564	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	719	Open in IMG/M
3300017407\|Ga0182220_1096603	Not Available	520	Open in IMG/M
3300017407\|Ga0182220_1107561	Not Available	503	Open in IMG/M
3300017409\|Ga0182204_1045407	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	674	Open in IMG/M
3300017409\|Ga0182204_1085169	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	559	Open in IMG/M
3300017409\|Ga0182204_1094477	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	541	Open in IMG/M
3300017409\|Ga0182204_1103705	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	526	Open in IMG/M
3300017410\|Ga0182207_1127349	Not Available	562	Open in IMG/M
3300017410\|Ga0182207_1154782	Not Available	526	Open in IMG/M
3300017410\|Ga0182207_1170538	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	508	Open in IMG/M
3300017411\|Ga0182208_1009099	All Organisms → Viruses → Predicted Viral	1105	Open in IMG/M
3300017411\|Ga0182208_1019304	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	890	Open in IMG/M
3300017411\|Ga0182208_1066429	Not Available	620	Open in IMG/M
3300017411\|Ga0182208_1072917	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	603	Open in IMG/M
3300017411\|Ga0182208_1083030	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	579	Open in IMG/M
3300017413\|Ga0182222_1038672	Not Available	657	Open in IMG/M
3300017413\|Ga0182222_1081082	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	542	Open in IMG/M
3300017415\|Ga0182202_1049022	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	700	Open in IMG/M
3300017415\|Ga0182202_1085900	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum hybrid cultivar	588	Open in IMG/M
3300017415\|Ga0182202_1101433	Not Available	558	Open in IMG/M
3300017417\|Ga0182230_1036666	Not Available	857	Open in IMG/M
3300017417\|Ga0182230_1068074	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	635	Open in IMG/M
3300017417\|Ga0182230_1112189	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	510	Open in IMG/M
3300017420\|Ga0182228_1077443	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	605	Open in IMG/M
3300017420\|Ga0182228_1082766	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	591	Open in IMG/M
3300017420\|Ga0182228_1092048	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum hybrid cultivar	569	Open in IMG/M
3300017420\|Ga0182228_1104198	Not Available	544	Open in IMG/M
3300017420\|Ga0182228_1112708	Not Available	528	Open in IMG/M
3300017420\|Ga0182228_1120914	Not Available	515	Open in IMG/M
3300017424\|Ga0182219_1078405	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum hybrid cultivar	603	Open in IMG/M
3300017425\|Ga0182224_1069536	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum hybrid cultivar	663	Open in IMG/M
3300017425\|Ga0182224_1134935	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	538	Open in IMG/M
3300017427\|Ga0182190_1025875	Not Available	934	Open in IMG/M
3300017427\|Ga0182190_1087329	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	626	Open in IMG/M
3300017427\|Ga0182190_1094669	Not Available	609	Open in IMG/M
3300017427\|Ga0182190_1105346	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum hybrid cultivar	587	Open in IMG/M
3300017430\|Ga0182192_1043986	Not Available	804	Open in IMG/M
3300017430\|Ga0182192_1100676	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum hybrid cultivar	608	Open in IMG/M
3300017430\|Ga0182192_1137647	Not Available	545	Open in IMG/M
3300017430\|Ga0182192_1161353	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum hybrid cultivar	515	Open in IMG/M
3300017433\|Ga0182206_1070651	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	652	Open in IMG/M
3300017433\|Ga0182206_1075865	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	638	Open in IMG/M
3300017436\|Ga0182209_1036511	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	822	Open in IMG/M
3300017436\|Ga0182209_1046558	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	764	Open in IMG/M
3300017436\|Ga0182209_1070983	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	671	Open in IMG/M
3300017436\|Ga0182209_1131643	Not Available	551	Open in IMG/M
3300017436\|Ga0182209_1171099	Not Available	504	Open in IMG/M
3300017438\|Ga0182191_1042610	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum hybrid cultivar	814	Open in IMG/M
3300017438\|Ga0182191_1085161	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	650	Open in IMG/M
3300017438\|Ga0182191_1097966	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum hybrid cultivar	621	Open in IMG/M
3300017438\|Ga0182191_1124059	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	574	Open in IMG/M
3300017438\|Ga0182191_1147955	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	541	Open in IMG/M
3300017438\|Ga0182191_1155384	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	532	Open in IMG/M
3300017442\|Ga0182221_1044655	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum hybrid cultivar	759	Open in IMG/M
3300017442\|Ga0182221_1117007	Not Available	566	Open in IMG/M
3300017443\|Ga0182193_1039556	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	857	Open in IMG/M
3300017443\|Ga0182193_1039851	Not Available	856	Open in IMG/M
3300017443\|Ga0182193_1090500	Not Available	657	Open in IMG/M
3300017443\|Ga0182193_1110981	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	614	Open in IMG/M
3300017443\|Ga0182193_1146718	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	558	Open in IMG/M
3300017680\|Ga0182233_1052110	Not Available	723	Open in IMG/M
3300017683\|Ga0182218_1033411	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum hybrid cultivar	798	Open in IMG/M
3300017683\|Ga0182218_1039121	Not Available	762	Open in IMG/M
3300017683\|Ga0182218_1068633	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum hybrid cultivar	645	Open in IMG/M
3300017683\|Ga0182218_1136839	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	521	Open in IMG/M
3300017684\|Ga0182225_1021907	Not Available	905	Open in IMG/M
3300017684\|Ga0182225_1105307	Not Available	555	Open in IMG/M
3300017684\|Ga0182225_1135379	Not Available	513	Open in IMG/M
3300017685\|Ga0182227_1087516	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	593	Open in IMG/M
3300017685\|Ga0182227_1091782	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum hybrid cultivar	583	Open in IMG/M
3300017686\|Ga0182205_1060666	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	711	Open in IMG/M
3300017686\|Ga0182205_1066428	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum hybrid cultivar	691	Open in IMG/M
3300017686\|Ga0182205_1119891	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum hybrid cultivar	569	Open in IMG/M
3300017686\|Ga0182205_1121907	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	565	Open in IMG/M
3300017686\|Ga0182205_1149751	Not Available	526	Open in IMG/M
3300017690\|Ga0182223_1074664	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	580	Open in IMG/M
3300017690\|Ga0182223_1105140	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	527	Open in IMG/M
3300017690\|Ga0182223_1105581	Not Available	527	Open in IMG/M
3300025927\|Ga0207687_11891350	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum hybrid cultivar	510	Open in IMG/M

Habitat	Taxonomy	Distribution
Host-Associated	Host-Associated	100.00%

Habitat	Taxonomy	Distribution
Plants	Host-Associated → Plants	100.00%

Habitat	Taxonomy	Distribution
Phyllosphere	Host-Associated → Plants → Phyllosphere	95.49%
Rhizosphere	Host-Associated → Plants → Rhizosphere	3.76%
Rhizoplane	Host-Associated → Plants → Rhizoplane	0.38%
Roots	Host-Associated → Plants → Roots	0.38%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified	95.49%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	3.76%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	0.38%
Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere	0.38%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified	95.49%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	3.76%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	0.38%
Soil	Host-Associated → Plants → Roots → Rhizosphere → Soil	0.38%

Habitat	Taxonomy	Distribution
Miscanthus Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere	95.11%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	2.26%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	1.50%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	0.38%
Miscanthus Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere	0.38%
Switchgrass Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere	0.38%

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300005840	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2	Host-Associated	Open in IMG/M
3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Host-Associated	Open in IMG/M
3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Host-Associated	Open in IMG/M
3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Host-Associated	Open in IMG/M
3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Host-Associated	Open in IMG/M
3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Host-Associated	Open in IMG/M
3300015267	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015268	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015269	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015274	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015275	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015276	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015277	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015279	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015281	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015282	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015283	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015284	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015285	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015286	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015287	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015288	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015289	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015291	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015292	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015294	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015295	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015296	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015298	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015299	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015300	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015302	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015303	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015304	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015305	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015308	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015314	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015321	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015322	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015323	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015341	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015342	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015343	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015344	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015345	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015346	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015347	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015351	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015355	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015361	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300017404	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017407	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017409	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017410	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017411	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017413	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017415	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017417	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017420	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017424	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017425	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017427	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017430	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017433	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017436	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017438	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017442	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017443	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017680	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017683	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017684	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017685	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017686	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017690	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)	Host-Associated	Open in IMG/M

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
Ga0068870_113974412	3300005840	Miscanthus Rhizosphere	VTHLDLRAAMAKQVQHLRFVDFEVWFPHRRDERASEGFYTPL*
Ga0068871_1010381311	3300006358	Miscanthus Rhizosphere	PPVVHLDLRAATDKQVQQLRFVEFDVWFPPRRDERAAEGFYTPL*
Ga0105243_115850171	3300009148	Miscanthus Rhizosphere	VTHLDLRAAMAKQVQQLRFVEFEQWFPPRRDDRASEDFYTPL*
Ga0105243_125414491	3300009148	Miscanthus Rhizosphere	HLDLRVATAKQVQQLRFVEFEQWFPPRRDDRASEDFYTPL*
Ga0105242_125539932	3300009176	Miscanthus Rhizosphere	VVHLDLRATIARQVHQLRFVEFDVWFPPRRDERAVEGFYTPL*
Ga0105246_108634972	3300011119	Miscanthus Rhizosphere	GLRAATAKQVQQLRFMDFEQWFLPRRDDRASEGFYTPL*
Ga0105246_117388311	3300011119	Miscanthus Rhizosphere	VTHLDLRAATAKQVQQLRFVDFEVWFPPRRDERALEDFYTPL*
Ga0157378_111090461	3300013297	Miscanthus Rhizosphere	RATMAKQVQPLRFVDFEQWFLPRQAERASEGLYTPL*
Ga0157378_119825472	3300013297	Miscanthus Rhizosphere	VTHLDLRATTAKQVQQLRFVDFEVWFPLRRDERASEGFYTLL*
Ga0157378_125047351	3300013297	Miscanthus Rhizosphere	VTHLDLRAATAKQVQQLRFVQFEDWFPPRRDERALEGFYTPL
Ga0157378_127585732	3300013297	Miscanthus Rhizosphere	VTHLDLRASTAKQVQQLRFVEFDVWFPPRRDERAAEGF
Ga0182122_10091892	3300015267	Miscanthus Phyllosphere	DLWVATARHVWQLRFVEFEVWFPPRRDERAAEGFYTPL*
Ga0182122_10234041	3300015267	Miscanthus Phyllosphere	PVTHLDLRAAMAKQLKFVQFEEWFLPRRDERASEGFYTPL*
Ga0182122_10389062	3300015267	Miscanthus Phyllosphere	LDLRAATAKQVQQLRFVDFEQWFPPRRDDRASEGFY
Ga0182122_10632221	3300015267	Miscanthus Phyllosphere	VTHLDLRAATAKQVQQLRFVEFEVWFPPRRDERAAEGFYTPLQQD
Ga0182154_10239461	3300015268	Miscanthus Phyllosphere	PVNHLDLRAAMAKQVQQLRFVQFEEWFLPRWDEHASEGFYTPL*
Ga0182154_10378512	3300015268	Miscanthus Phyllosphere	HLDLRATMARQVWQLRFVEFEVWLPPRRDERAAEGFYTPL*
Ga0182154_10463511	3300015268	Miscanthus Phyllosphere	VTHLDLRATMAKQVQQLRFVEFDVWFPPRRDEIAAEGFYTPL*
Ga0182154_10480471	3300015268	Miscanthus Phyllosphere	VTHLDLRAATAKQVQQLRFMDFEVWFPPRRDERASEGF
Ga0182154_10577121	3300015268	Miscanthus Phyllosphere	MTHLDLRAATAKQVQQLRFVQFEDWFPPRQDEHASEQ
Ga0182113_10395622	3300015269	Miscanthus Phyllosphere	MTHLDLRVATAKQVQQLRFVEFEQWFPPRRDDRASEDFYTPL*
Ga0182113_10552672	3300015269	Miscanthus Phyllosphere	VTHLDLRATSAKQVRQLRFIEFEVWFPPRRDERASEGFYTLLQEDFY
Ga0182113_10778792	3300015269	Miscanthus Phyllosphere	VTHLDLRAATAKQVHQLRFVDFEVWFPPRRDERASEGFYTPLQKDFY
Ga0182113_10814982	3300015269	Miscanthus Phyllosphere	VIHLDLRAATAKQVQQLRFMDFEVWFPSRRDERASERFYTPL*
Ga0182188_10620581	3300015274	Miscanthus Phyllosphere	VTHLDLRATTAKQVQQLRFMDFEVWFPPRRDERASEGFYTPL*
Ga0182172_10100522	3300015275	Miscanthus Phyllosphere	LRAATVKQVQQLRFIQFEEWFPLRRDERALEGFYTPL*
Ga0182172_10114472	3300015275	Miscanthus Phyllosphere	ATTTKQVWQLRFVEFEVWFPPRRDERASEGFYTPL*
Ga0182172_10571851	3300015275	Miscanthus Phyllosphere	VTHLDVRVTTDKQVWQLRFVEFEVWFPSRRDERASEGFYTPL*
Ga0182172_10603142	3300015275	Miscanthus Phyllosphere	PQGPPPLTHLDLRATMAKQVQQLRSMDFEQWFLPRRDDRASKGFYTPL*
Ga0182172_10636721	3300015275	Miscanthus Phyllosphere	VVHLDLRAAIARQVRQLRFVEFNVWFPPRRDERAAEGF
Ga0182170_10212021	3300015276	Miscanthus Phyllosphere	VVHLDLKAATARQVHQLRFVEFDVWFPPRRDERAAEG
Ga0182170_10506011	3300015276	Miscanthus Phyllosphere	ATAKQVQQLRFVDFEIWFLPRRDERASEGFYTLL*
Ga0182128_10703632	3300015277	Miscanthus Phyllosphere	VTHLDLRAATTKQVQQLRFMDFEVWFPPRRDERASEGFY
Ga0182174_10216401	3300015279	Miscanthus Phyllosphere	VTHLDLRAATSKQVQQLRFVQFEEWFPPRRDERASEGFYTPLQ
Ga0182174_10222912	3300015279	Miscanthus Phyllosphere	VTHLDLRAATAKQVQQLCFVEFDVWFPSRRDERAAEGFYTLL*
Ga0182174_10503001	3300015279	Miscanthus Phyllosphere	LDLRAATAKQVQQLRFMQLEEWFLPRRDEHASEGFYTPL*
Ga0182174_10688601	3300015279	Miscanthus Phyllosphere	QGPPLVTHLDLRAATAKQVQQLRFVQFEDWFPPRRDERASEGFYTPL*
Ga0182160_10146912	3300015281	Miscanthus Phyllosphere	VVHLDLRAATARQVRQLRFVEFDVWFPLRRDERAAEGFYTPL*
Ga0182160_10432751	3300015281	Miscanthus Phyllosphere	PPPVTHLDLRAATTKQVQQLCFVEFDVWFRPRRDERAAEGFYMPL*
Ga0182160_10585192	3300015281	Miscanthus Phyllosphere	LRAATAKQVQQLRFVQFKEWFLLRRDERASEGFYTPLQEDFY
Ga0182160_10646551	3300015281	Miscanthus Phyllosphere	LQGLSPMTHLDLRAATIKQVQQLRFVQFEEWFPPRRDERASEGFYTPL*
Ga0182124_10162801	3300015282	Miscanthus Phyllosphere	VVHLDLRAATARHVRQLRFVEFDVWFPPRRDERAAEGFYTPL
Ga0182156_10485601	3300015283	Miscanthus Phyllosphere	VVHLDLRAATARQVRQLRFVEFDVWFPPKRDERAAEGFYMPLQEDFYNA
Ga0182156_10580302	3300015283	Miscanthus Phyllosphere	VTHLDLRAATAKQVQQLRFMDFEVWFPPRRDERA*
Ga0182156_10678602	3300015283	Miscanthus Phyllosphere	VVHLELRAAIARQVRQLRFVEFDLWFPPRRDERAAEEF
Ga0182156_10741001	3300015283	Miscanthus Phyllosphere	VTHLDLRAAMAKQVQQLRFVDFEVWFLPRRDERASEGFYTPL*
Ga0182156_10760321	3300015283	Miscanthus Phyllosphere	VTHLDLRAAIAKQVQQLRFVDFEVWFPPRRDERASEEFYTPLQEDFYN
Ga0182156_10869302	3300015283	Miscanthus Phyllosphere	LDLRATTAKQVQQLRFVDFEQWFPLRRDDRALEDFYTPLQ
Ga0182101_10487771	3300015284	Switchgrass Phyllosphere	MHLDLSRATARKVKELRMVDFEVWFPAERDPRASEGFYTLLQEDFY
Ga0182186_10223291	3300015285	Miscanthus Phyllosphere	LDLRAAMAKQVQQFRFVDFEEWFPPRRDDRASEGFYTPL*
Ga0182186_10694952	3300015285	Miscanthus Phyllosphere	LDLRAATAKQVQQLRFVEFEQWFPPRRDDRASEDFYTPL
Ga0182176_10314211	3300015286	Miscanthus Phyllosphere	PMTHLDLRAAMAKQVQRLRFVDFEVWFPSRRDDRASEGFYMPL*
Ga0182176_10342241	3300015286	Miscanthus Phyllosphere	VTHLDLRAATAKQVRQLRFMELDVWFSPRRDERAAE
Ga0182176_10850841	3300015286	Miscanthus Phyllosphere	DLRATTAKQVQQLRFVDFEVWFPPKRDERASEGFYTPL*
Ga0182171_10615761	3300015287	Miscanthus Phyllosphere	VTHLDLRAATAKQVQQLKFVSFEDWSPLRRDERASEGF
Ga0182171_10634572	3300015287	Miscanthus Phyllosphere	VTHLDLRAATAKQVQQLRFVDFEVWFPPRRDERASEGFYTL
Ga0182171_10642811	3300015287	Miscanthus Phyllosphere	MTHLDLRATTTKQVQQLRFVQFEDWFPPRRDERVSKGFYTPL*
Ga0182171_10738401	3300015287	Miscanthus Phyllosphere	RAATARQVQQLRFVQFEDRFSPRRDERALEHFYTVL*
Ga0182173_10286222	3300015288	Miscanthus Phyllosphere	VTHLDLRAATAKQVQQLRFVDFEIWFLPRRDERAL
Ga0182173_10540822	3300015288	Miscanthus Phyllosphere	DLRATTARRVHQLRFVEFDVWFPLRRDERAAEGFYTPL*
Ga0182173_10790581	3300015288	Miscanthus Phyllosphere	VTHLDLRAATAKQVQQLRFMQFEDCFLPRRDERASEGFYTPL*
Ga0182138_10286891	3300015289	Miscanthus Phyllosphere	VTHLDLRATTAKQVQQLKFVDFDQWFPPRWDERASKGF
Ga0182138_10371821	3300015289	Miscanthus Phyllosphere	VTHLDLRAATAKQVQQLRFVDFDQWFLSRWDEHASEGFYTPL
Ga0182138_10437381	3300015289	Miscanthus Phyllosphere	VVHLDLRAATARQVRQLRFVEFEVWFPPRRDERATEGFYTPLQ
Ga0182125_10281992	3300015291	Miscanthus Phyllosphere	VTHLDLRATTAKQVQQLRFMDFEVWFPPRRDERASEGFYTPLQEDF
Ga0182125_10314351	3300015291	Miscanthus Phyllosphere	VTHLDLRAATAKQVQQLRFMLFEDWFPPRRDERASEGFYTPL*
Ga0182125_10380261	3300015291	Miscanthus Phyllosphere	PLVVHLDLRAAMAKQVQQLRFVEFEVWFPPRRDERAAEGFYTPL*
Ga0182125_10472912	3300015291	Miscanthus Phyllosphere	VTHLDLRAATAKHIQQLRFVDFEVWFPPRRDERASEGFYT
Ga0182141_10228681	3300015292	Miscanthus Phyllosphere	VVHLDLRAAIARQVRQLRFVEFDVWFPPRRDERAAEGFYTLL*
Ga0182141_10362361	3300015292	Miscanthus Phyllosphere	VVHLDLRATTARQVRQLRFVEFEVWFPLRRDERAAEGFYT
Ga0182141_10524912	3300015292	Miscanthus Phyllosphere	VTHLDLRAAAAKQVQQLRFIEFEVWFPPRRDERAAEGFYTPF*
Ga0182141_10561542	3300015292	Miscanthus Phyllosphere	VVHLDLRAATARQVRQLRFVEFDVWFPPRRDERAAEGFYTPLQEDFYNA
Ga0182126_10139481	3300015294	Miscanthus Phyllosphere	VVHLYLRAATARQVRQLKFVEFDVWFPPRRDERAAEGFYTPLQED
Ga0182126_10476111	3300015294	Miscanthus Phyllosphere	LDLRAAMAKQVQQLRFVEFEQWFSSRRDDRASEDFYTPL*
Ga0182126_10519651	3300015294	Miscanthus Phyllosphere	PPPRAQGPSPVTHLVLRAATAKQLRFVDFEQWFSLRQDDRALEGFYTPL*
Ga0182126_10715791	3300015294	Miscanthus Phyllosphere	VTHLDLRATTAKQMQQLRFVDFEVWFPLRRDDRASEGFYTPLQEDYYN
Ga0182175_10091922	3300015295	Miscanthus Phyllosphere	VVHLELRAAIARQVRQLRFVEFDMWFPLRRDERAVEGFYTPL*
Ga0182175_10598002	3300015295	Miscanthus Phyllosphere	VVHLDLRAATAKQVRQLRFMEFDVWFPPRRDERAAEGFY
Ga0182175_10756371	3300015295	Miscanthus Phyllosphere	MTHLDLRAATAMQVQQLRFVDFEVWFPPRRDDRASEGFYMPL*
Ga0182175_10809731	3300015295	Miscanthus Phyllosphere	VTHLDLRAATAKQVQQLRFVDFDQWFPPRRDERASEGFYTPL
Ga0182175_10862612	3300015295	Miscanthus Phyllosphere	LPPVVHLDLRAATARQVRQLRFVEFDVWFPPRRDERAAEGFYTPL*
Ga0182175_10876342	3300015295	Miscanthus Phyllosphere	THLDLRAATAKQVQQLRFMDFEVWFPPRRDERASEGFYTPL*
Ga0182175_10932081	3300015295	Miscanthus Phyllosphere	MTHLDLRAATAKQVQQLRFVQFEEWFPPRRDERASEGFYTPLL
Ga0182157_10196741	3300015296	Miscanthus Phyllosphere	LDLRAATAKQVQQLRFVDFEQWLPPRRDERASERFYTPL*
Ga0182157_10656232	3300015296	Miscanthus Phyllosphere	VTHLDLRATTAKQVKQLRFVQFEDWFPPRRDERALEGFYTPLQE
Ga0182157_10781482	3300015296	Miscanthus Phyllosphere	TTAKQVQQLRFVDFEIWFPPRRDERALEGFYTPL*
Ga0182106_10138913	3300015298	Miscanthus Phyllosphere	VTHLDLRAATAKQVQQLRFVQFEEWFSPRRDERASEGFYTPL*
Ga0182106_10948641	3300015298	Miscanthus Phyllosphere	VTHLDLRATTAKQVQQLRFVDFEQWFPPRRDERASEGFYTPLQEDF
Ga0182106_10967962	3300015298	Miscanthus Phyllosphere	VTHLDLRAAMAKQVQQLRFMDFEVWFPPRRDERASEGFYTPL*
Ga0182106_10995972	3300015298	Miscanthus Phyllosphere	VTHLDLRATTAKQVQQLRFVDFKVWFPLRRDERAL
Ga0182107_10306402	3300015299	Miscanthus Phyllosphere	VTHLDLRATTAKQVQLLRFMDFEVWFLPRRDDRASEGFYTPL
Ga0182107_10558721	3300015299	Miscanthus Phyllosphere	LRAATAKQVQQLRFVDFEQWFPLRRDDRALEGFYTPL*
Ga0182107_10917111	3300015299	Miscanthus Phyllosphere	VTHLDLRAAMAKQVQQLRFVDFEVWFPSRRDDRAAEGFYTPL*
Ga0182108_10349802	3300015300	Miscanthus Phyllosphere	MTHLDLRAATAKQVQQLRFVDFEQWFPPRRDDRALEGF
Ga0182108_10687642	3300015300	Miscanthus Phyllosphere	VTHLDLRATTAKQVQQLRFVDFEVWFPLRRDERASEGFYTPL*
Ga0182108_10762793	3300015300	Miscanthus Phyllosphere	VTHLDLRAATAKQVQQLCFVEFDVWFPPRRDEIAAEGFYTPL*
Ga0182143_10331001	3300015302	Miscanthus Phyllosphere	PPVVHLDLRAATAKQVQQLWFVPFEDWFLLRWDERASEHFYTML*
Ga0182143_10611321	3300015302	Miscanthus Phyllosphere	VTHLDLWAATTKQMQQLRFVDFDQWFLLRRDERASKG
Ga0182143_10623982	3300015302	Miscanthus Phyllosphere	VVHLDLRAAIARQVRQLRFVEFDMWFPLRRDERAAEGFYTPL*
Ga0182143_10777332	3300015302	Miscanthus Phyllosphere	MTHLDLRAAMAKQVQQLRFVDFEQWSLPRRDDRASEGFYTPL*
Ga0182143_11044262	3300015302	Miscanthus Phyllosphere	VTHLDLRAATAKQVQQLRFVDFEIWFPPRRDERALEGFYTPLQEDFY
Ga0182123_10335791	3300015303	Miscanthus Phyllosphere	VVHLDLRAATARQVHQLRFVEFDVWFPLRRDKRAAERFYTSLQEDF
Ga0182123_10544721	3300015303	Miscanthus Phyllosphere	VTHLDLRAATAKQVQQLRFMDFKVWFPSTRDERALEGFYTPL*
Ga0182123_10653571	3300015303	Miscanthus Phyllosphere	LDLRAATAKQVQQLRFVEFEQWFPPRRDDRASEYFYTPLQEDFY
Ga0182123_10679991	3300015303	Miscanthus Phyllosphere	LDLRAATAKQVQQLRFIQFEEWFPLRRDERALEGFYTPL*
Ga0182123_10883742	3300015303	Miscanthus Phyllosphere	VVHLDLRAATARQVQQLRFVEFEVWFPLRRDERAAEGFY
Ga0182123_10963101	3300015303	Miscanthus Phyllosphere	SAAMARQVQQLRFVEFEQWFPLRRYKHASEGFYTPL*
Ga0182112_10481602	3300015304	Miscanthus Phyllosphere	VTHLDLRAATAKQVQQLRFVEFEVWFPPRRDERAAKGFYTPLQEDF
Ga0182112_10764232	3300015304	Miscanthus Phyllosphere	LDLRAATTKQVQQLRFVDFERWFLPRRDDRASEGFYTP
Ga0182112_10932272	3300015304	Miscanthus Phyllosphere	VTHLDLRAATAKQVQQLRFVEFEVWFLLRRDERASEGFYTPL*
Ga0182158_10127191	3300015305	Miscanthus Phyllosphere	VTHLDLRAATAKPVQQLRFMDFEVWFPPRRDERASEGFYTPL*
Ga0182158_10281952	3300015305	Miscanthus Phyllosphere	LRAAIARQVCQLRFVEFDVWFPPRRDERAAEGFYTPLQEDF
Ga0182158_10628291	3300015305	Miscanthus Phyllosphere	LDLRAATAKQVHQLRFVQFEEWFPPRRDERASEGFYTPL*
Ga0182158_10664181	3300015305	Miscanthus Phyllosphere	LRAATAKQVQQLRFVDFEQWFPPRRDDRALEGFYTPLQEDFY
Ga0182158_10930352	3300015305	Miscanthus Phyllosphere	VTHLDLRAATAKQVQQLRFVDFESWFPPRRDERAAEGFYTPLQED
Ga0182142_10280742	3300015308	Miscanthus Phyllosphere	VTHLDLRATTAKQVQQLRFVDFEVWFPPRRDERASEGFYTPLQEDFYN
Ga0182142_10439071	3300015308	Miscanthus Phyllosphere	VVHLDLRATTAKQVRQLRFVEFEVWFPPRRDERASEGFYTPLQEDF
Ga0182142_10873652	3300015308	Miscanthus Phyllosphere	VVHLDLRAATAIQVHQLRFVEFDVWFPPRRDERAAEGFYTPLQ
Ga0182142_11047571	3300015308	Miscanthus Phyllosphere	GPPLVTHLDLRATTAKQVQQLRFMQFEEWFLPRRDEHALEGFYTPL*
Ga0182140_10163841	3300015314	Miscanthus Phyllosphere	VTHLDLRAAIAKQVQQLRFVEFELWFPPRRDERALEGFYTPL*
Ga0182140_10230171	3300015314	Miscanthus Phyllosphere	PPRPQGPPLVTHLDLRAATAKQVQQLRFVDFDQWFPLRQDERAS*
Ga0182140_10435192	3300015314	Miscanthus Phyllosphere	VTYLDLRAATAKQVQQLRFVDFEQLFPPRRDDRASEGFYTPL*
Ga0182140_10777442	3300015314	Miscanthus Phyllosphere	VTHLDLRAATAKQVQQLRFVDFEVWFSPRRDDRVSEGFYTPL*
Ga0182140_10875281	3300015314	Miscanthus Phyllosphere	VTHLDLRAATAKQVQQLRFVQFEEWFPPRRDERASKGFYIVLMMT
Ga0182127_10625842	3300015321	Miscanthus Phyllosphere	MTHLDLRAATAKQVQQLRFMDFEVWFPPRRDDRVSEGFYTPL*
Ga0182127_10754581	3300015321	Miscanthus Phyllosphere	VTHLDLRAATAKQVQQLRFVDFEVWFPPRRDERASEGFYTPLQED
Ga0182127_11087412	3300015321	Miscanthus Phyllosphere	LDLRAATAKQVQQLRFVDFEQWFLPRRDERASEGFYTPLQKDFYNA
Ga0182127_11129671	3300015321	Miscanthus Phyllosphere	VVHLDLRVAIARQVQQLRFVEWFPPRRDERASEQFYI
Ga0182127_11210732	3300015321	Miscanthus Phyllosphere	VVHLDLRAATARQVRQLRFVEFDVWFPPRRDERAAEGFYTPLQEDFY
Ga0182110_10296602	3300015322	Miscanthus Phyllosphere	VVHLDLRATTARQVRQLRFVEFEVWFPPRRDERVAEGFYTS
Ga0182110_10932182	3300015322	Miscanthus Phyllosphere	MRAATAKQVQQLRFMDFEVWFPPRRDERASEGFYTPL
Ga0182110_11062192	3300015322	Miscanthus Phyllosphere	VTHLDLRATTAKQVQQLRFVDFEVWFPPRRDERASEAFYTPL*
Ga0182129_10379951	3300015323	Miscanthus Phyllosphere	VVHLDLRAATARQVHQLRFVEFNVWFPPRRDERAAEGFYT
Ga0182129_10664271	3300015323	Miscanthus Phyllosphere	LDLRAAIARQVRQLHFVEFDVWFPPSRDERAAEGFYTPL*
Ga0182129_11089722	3300015323	Miscanthus Phyllosphere	PPVTHLDLRATKAKQVQQLRFIQFKDWFPLRRDECAS*
Ga0182129_11132161	3300015323	Miscanthus Phyllosphere	MDLRAATAKQVQQLRFVQFDDWFPPRRDERALEGFYTP
Ga0182187_10627392	3300015341	Miscanthus Phyllosphere	VTHLDVRATTAKQVQQLRFVDFEVLFPPRRDEIASEGFYTPL*
Ga0182187_11386733	3300015341	Miscanthus Phyllosphere	VVHLDLRAATARQVHQLRFVEFDAWFPPRRDERAAEGFYTPL*
Ga0182187_11805492	3300015341	Miscanthus Phyllosphere	VTHLDLRATTAKQVQQPRFMDFEVWFPPRRDDIASEGFYTPLQEDFY
Ga0182187_12022361	3300015341	Miscanthus Phyllosphere	LRATTTKQVQQLRFVDFEVWFPSRRDERASEGFYTP
Ga0182109_10555541	3300015342	Miscanthus Phyllosphere	VTHLDLRDTTAKQVQQLRFMDFEVWFPPRRDDRASEGFYTPL*
Ga0182109_10984751	3300015342	Miscanthus Phyllosphere	VTHLDLRAATAKQVQQLRFVDFEVWFPLRRDERAS*
Ga0182109_11107932	3300015342	Miscanthus Phyllosphere	VTHLDLRAATAKQVQQLRFVQFEEWFPPRWDERGSEGFYIPLQE
Ga0182109_11168412	3300015342	Miscanthus Phyllosphere	VTHLDLRAATAKQVQQLRFVDFEVWFPPRRDERPSEGFYTPL*
Ga0182109_11728341	3300015342	Miscanthus Phyllosphere	VVHLDLRATTARQVQQLRFVEFEVWFPPRRDERAAEGFYTPLQE
Ga0182109_11872203	3300015342	Miscanthus Phyllosphere	VTHLDLRATTTKQVQQLRFVLFEEWFSPRRDECASEGFYTP
Ga0182109_12052341	3300015342	Miscanthus Phyllosphere	VTHLDLRAATVKQVQQLRFMDFEVWFAPRRGERALEGFYTPL*
Ga0182109_12138591	3300015342	Miscanthus Phyllosphere	LDLRAATAKQVQQLRFVDFEKWFPPRRVARASEGFYTPLQEDF
Ga0182109_12237422	3300015342	Miscanthus Phyllosphere	VTHLDLRAATAKQVQQLRFVDFEVWFPLRRDERASEGFYTLLQEDFYN
Ga0182109_12245571	3300015342	Miscanthus Phyllosphere	TQLDLRAATAKQVQQLKFVQFEEWFPPRRDERASEGFYTPL*
Ga0182155_11082581	3300015343	Miscanthus Phyllosphere	VTHLDLRAATGKQVHQLRFVQFEEWFPPRRDERAS
Ga0182155_11219842	3300015343	Miscanthus Phyllosphere	VTHLDLRAVTAKQVQQLRFINFEVWFPPRRDERASEGFYTPLQEDFYNA
Ga0182155_11737581	3300015343	Miscanthus Phyllosphere	VTHLDLRAATAKQVQQLRFMEFEQWFPLRQDEQASEGF
Ga0182189_11026811	3300015344	Miscanthus Phyllosphere	VTHLDLRATTAKQVQQLRFVDFEQWFPPRRDECASEGFYTPLQED
Ga0182111_11286493	3300015345	Miscanthus Phyllosphere	VTHLDLRAAMAKQVQQLRFVQFKDWFPLRRDERALEGFYTPL*
Ga0182111_11318072	3300015345	Miscanthus Phyllosphere	VTHLDLRTTTIKQVQQLRFVQFEEWFSPRRDEHASEDFY
Ga0182111_11796561	3300015345	Miscanthus Phyllosphere	VTHLDLRAATAKQVQQFRFVDFEVWFPPKMDERAAEGFYT
Ga0182111_12094812	3300015345	Miscanthus Phyllosphere	VTHLDLRAATAKQVQQLRFMDFEVWFPPRRDDRASEGFYTPLQ
Ga0182111_12126561	3300015345	Miscanthus Phyllosphere	VTHLDLRAAMAKQVQQLRFVDFEVWFPPRRDERASEGFYTPLQ*
Ga0182111_12358291	3300015345	Miscanthus Phyllosphere	VTHLDLRAATAKQVQQLRFVDFDQWFPPRRDERASEGFYTPLQEDI
Ga0182139_10623171	3300015346	Miscanthus Phyllosphere	VTHLDLRAATAKQVQQLRFVDFEVWFPSRRDERASEGFYTPL*
Ga0182139_11159402	3300015346	Miscanthus Phyllosphere	VTHLDLRAATAKQVQQLRFVQFEDWLPPRRDERASEGFYTPLQE
Ga0182139_11277611	3300015346	Miscanthus Phyllosphere	PQGLPLVTHLDLRATMAKQVQQLRFVQFDVWFPPRRDERASEGFYTPL*
Ga0182139_11422892	3300015346	Miscanthus Phyllosphere	LDLRAATAKQVQQLRLVPFEDWFPPRRDERASEGFYTP
Ga0182139_11439171	3300015346	Miscanthus Phyllosphere	VTHLDLRAAMAKQVQQLRFVDFEVWFPPRRDERASEGFYTPL
Ga0182139_11555932	3300015346	Miscanthus Phyllosphere	VTHLDVRVTTDKQVWQLRFVEFEVWFPPMRDEIASEGFYTPL*
Ga0182139_12326851	3300015346	Miscanthus Phyllosphere	VTHLDLRAATAKQVQWLRFVQFEDWFPPRRDERASEGL
Ga0182139_12433701	3300015346	Miscanthus Phyllosphere	MTHLDLRAATAKQVQQLRFVQFEEWFPPRRDERASEGFYTPL*
Ga0182177_10334062	3300015347	Miscanthus Phyllosphere	VTHLDLRAATAKQAQQLRFVDFEVWFPPRRDERASEGFYTLL*
Ga0182177_12060442	3300015347	Miscanthus Phyllosphere	VVHLDLRAATARQVRQLRFVEFDVWFPPRRDERAAEGFYTPL*
Ga0182177_12171231	3300015347	Miscanthus Phyllosphere	GPPLVTHLDLRAATAKQVQQLRFMQFEDWFKPRQDEHASEHFYTIL*
Ga0182161_10575651	3300015351	Miscanthus Phyllosphere	VTHLDLRAATAKQVQQLIFMDFEQWFLPRRDDRASKGFYTPL*
Ga0182161_11481702	3300015351	Miscanthus Phyllosphere	DLRAATAKQVRQLRFVEFEVWFPLRRDERASEGLYTPL*
Ga0182161_11807861	3300015351	Miscanthus Phyllosphere	VTHPDLRATTAKQVQQLRFVEFEQWFPPRRDERALEGFYTPLQED
Ga0182161_12210501	3300015351	Miscanthus Phyllosphere	VIHLDLRATTAKQVQQLRFVDFEVWFPPRRDDRASEGFYMPLQ
Ga0182161_12419442	3300015351	Miscanthus Phyllosphere	LDLRAATTKQVQQLRFVDFEVWFLPRRDDRASEGFYTPL
Ga0182159_11122001	3300015355	Miscanthus Phyllosphere	LDLRAATAKQVQQLKFVDFEQWFPPRRDDRASEGFYTPL*
Ga0182159_11845181	3300015355	Miscanthus Phyllosphere	PPLVVHLDLRAATARQVQQLRFVQFEDLFPLRRDERASEHFYTAL*
Ga0182159_12139622	3300015355	Miscanthus Phyllosphere	VVHLDLRAATARQVRQLRFAEFDVWFPPRRDERAADGFYTPLQEDF
Ga0182159_12344971	3300015355	Miscanthus Phyllosphere	VTHLDLRATTTKQVQQLRFVEFDVWFPPRRDERATEG
Ga0182159_12498971	3300015355	Miscanthus Phyllosphere	VTHLDLRATTAKQVQQLRFVDFEVWFPPRRDERASEGFYTPL*
Ga0182159_12791222	3300015355	Miscanthus Phyllosphere	VIHLDLRAATAKQVQQLRFVEFDVWFPPRRDERAAEGF
Ga0182145_11322001	3300015361	Miscanthus Phyllosphere	QGPPLVTHLDLRTATAKHVQQLSFVQFKDWFPLRRDERASEGFYTPL*
Ga0182145_11657121	3300015361	Miscanthus Phyllosphere	PVTHLDLRAATAKQVHQLRFVDFDQWFLLRRDERASDGFYTPL*
Ga0182145_11937031	3300015361	Miscanthus Phyllosphere	AATAIQVHQLRFVEFDVWFPPRRDERAAEGFYTPL*
Ga0182203_10452291	3300017404	Miscanthus Phyllosphere	VTHLDLRAATAKQAQQLRFVDFEVWFPSRRDERASEGFYTPL
Ga0182220_10248241	3300017407	Miscanthus Phyllosphere	VTHLDLRATSAKQVRQLRFIEFEVSFPLRRDERASEGFYTPL
Ga0182220_10295641	3300017407	Miscanthus Phyllosphere	MTHLDLRVATAKQVQQLRFVEFEQWFPPRRDDRASEDFYTPL
Ga0182220_10966031	3300017407	Miscanthus Phyllosphere	MTHLDLRAAIAKQVHQLRFVSFENWFPPRRDERALEGFYTPL
Ga0182220_11075611	3300017407	Miscanthus Phyllosphere	VTHLDLRAAMAKQVQHLRFVDFEVWFPHRRDERASEGFYTPL
Ga0182204_10454072	3300017409	Miscanthus Phyllosphere	GPPLVTHLDLRAAMTKQVQQLRFVDFEQWFPPRRDDRALEDFYTPL
Ga0182204_10851692	3300017409	Miscanthus Phyllosphere	VTHLDLRVATAKQVQQLRFMDFEVWFPPRRDERASEGFYTPLQEDFY
Ga0182204_10944772	3300017409	Miscanthus Phyllosphere	VTHLDLRAATAKQVQQLIFMDFEQWFLPRRDDRASKGFYTPL
Ga0182204_11037051	3300017409	Miscanthus Phyllosphere	VTHLDLRAATAKQVQQLRFMDFEVWFPPRRDERASEGFYTPL
Ga0182207_11273491	3300017410	Miscanthus Phyllosphere	VVHRDLRAATARQVQQLGFVEFEVWFPPRRDERAAEG
Ga0182207_11547821	3300017410	Miscanthus Phyllosphere	VVHLDLRAATAKQVQQLCFVQFEDWFPPRRDERALEHFYTV
Ga0182207_11705381	3300017410	Miscanthus Phyllosphere	SSRLRATTTKQVQQLIFVQFEEWLLPRRDECASEGFYTPL
Ga0182208_10090991	3300017411	Miscanthus Phyllosphere	VTHLDLRAATAKQVQQLRFVDFEVWFPPRRDARASEGFYTPL
Ga0182208_10193041	3300017411	Miscanthus Phyllosphere	VTHLDLRATTAKQVQQLRFVDFEVWFPPRRDDRASEGFYMPLQEDFYNAYL
Ga0182208_10664293	3300017411	Miscanthus Phyllosphere	VTHLDLRAATAKQVQQLRFVDFEQWFPSRRDDRASEGFYTPLQ
Ga0182208_10729172	3300017411	Miscanthus Phyllosphere	PRPQGPPPVTHLDLRATTAKQVQQLRFMDFEQWFPPRRDDRASEGFYTPL
Ga0182208_10830302	3300017411	Miscanthus Phyllosphere	VTHLDLRVATAKQVQQLRFVDFEVWFPLRRDDRASEGFYMPLQE
Ga0182222_10386721	3300017413	Miscanthus Phyllosphere	MTHLDLRATTAKQVQQLRFVKFEQWLLSRRDDRASEDFYTPL
Ga0182222_10810821	3300017413	Miscanthus Phyllosphere	VVHLDLRAATARQVRQLRFVEFDVWFPLRRDERVAEGFYTPLQEDFY
Ga0182202_10490221	3300017415	Miscanthus Phyllosphere	VTHLDLRAATAKQVLQLRFVDFEQWFPPRRDDRASEGFYT
Ga0182202_10859001	3300017415	Miscanthus Phyllosphere	VVHLDLRAATARQVQQLRFVEFEVWFPPRRDERVAEGFYTPLQ
Ga0182202_11014332	3300017415	Miscanthus Phyllosphere	MTHLDLRATTTKQVQQLRFVQFEDWFPPRRDERSSEKFYTPL
Ga0182230_10366661	3300017417	Miscanthus Phyllosphere	VTHLDLRATTAKQVQQLRFVQFEDWFPLRRDERASQGFYTAL
Ga0182230_10680741	3300017417	Miscanthus Phyllosphere	MTHLDLRAAMAKQVQQLRFVDFEQWFPLRRDDRASEGFYTPL
Ga0182230_11121891	3300017417	Miscanthus Phyllosphere	VVHLDLRAATARQVHQLRFVEFDVWFPPRRDERVAEGFYTPLQEDFYN
Ga0182228_10774431	3300017420	Miscanthus Phyllosphere	LRAATAKQVQQLIFMDFEQWFLPRRDDRASKGFYTPL
Ga0182228_10827661	3300017420	Miscanthus Phyllosphere	VTHLDLRAATAKQVRQLRFVEFEVWFPPRRDEREH
Ga0182228_10920482	3300017420	Miscanthus Phyllosphere	VIHLDLRATTAKQVQQLRFVDFEVWFPPRRDERASEGFYTPLQEDFYN
Ga0182228_11041981	3300017420	Miscanthus Phyllosphere	LDLRAAMAKQVQQFRFVDFEEWFPPRRDDRASEGFYTPL
Ga0182228_11127081	3300017420	Miscanthus Phyllosphere	VVHLDLRVATARQVQQLRFVEFEWFRPRRDERASEQFYIVLQED
Ga0182228_11209141	3300017420	Miscanthus Phyllosphere	VTHLDLRAVTAKQEHQLRFVDFEVWFPSRRDERASERF
Ga0182219_10784051	3300017424	Miscanthus Phyllosphere	PQGVAPVTHLDLRAATAKQVRQLRFVQFEDWFPPRRDERVSKGFYTPL
Ga0182224_10695361	3300017425	Miscanthus Phyllosphere	HLDLWTTTARQVQQLRFVEFEQWFPSRLDERVLEQFYTML
Ga0182224_11349351	3300017425	Miscanthus Phyllosphere	VTHLDLRATTTKQVQQLRFVDFERWFLPRRDDRASEGFYTPLQEDFYN
Ga0182190_10258751	3300017427	Miscanthus Phyllosphere	VTHLDLRAATTKQVQQLIFVDFEQWFPPRRDDQASDGFYTPLQ
Ga0182190_10873292	3300017427	Miscanthus Phyllosphere	VTHIDLRAATAKQVQQLRFVEFEQWFPPRRDDRASEGFYTPL
Ga0182190_10946692	3300017427	Miscanthus Phyllosphere	VVHLDLRAATARQVRQLRFVEFDVWFPPRRDERAAEGFYTPLQ
Ga0182190_11053461	3300017427	Miscanthus Phyllosphere	RPQSPPPVTHLELRAATAKQVHQLRFVDFEVWFPPRRDERASEEFYTSF
Ga0182192_10439863	3300017430	Miscanthus Phyllosphere	VTQLDLRAATAKQVQQVRFVDFEVWFLPRRDDRASEGFY
Ga0182192_11006761	3300017430	Miscanthus Phyllosphere	LDLRATTAKQVQQLRFIDFEVWFPPRRDERALEGFYTPL
Ga0182192_11376471	3300017430	Miscanthus Phyllosphere	VVHLDLRAATAKKVQQLRFVEFDVWFPLRRDERAA
Ga0182192_11613531	3300017430	Miscanthus Phyllosphere	DLRAATAKQVQQLHFVQFEDWFPPRRDERVLEHFYTPL
Ga0182206_10706512	3300017433	Miscanthus Phyllosphere	VIHLDLRATTAKQVQQLRFVEFEVWFLPRRDERALEGFY
Ga0182206_10758652	3300017433	Miscanthus Phyllosphere	PRPQGPPLVTHLDLRAATAKQVQQLRFVDFDQWFPPRRDERASEGFYTPL
Ga0182209_10365111	3300017436	Miscanthus Phyllosphere	PVTHLDLRAAMAKQVQQLRFIDFEVWFPPRRDERALEGFYSPL
Ga0182209_10465581	3300017436	Miscanthus Phyllosphere	MTHLDLRAATAKQVQQLRFVDFEQWFPPRRDDRASEDFYTPL
Ga0182209_10709831	3300017436	Miscanthus Phyllosphere	MTHLDLRATTAKQVQQLRFVEFEQWFPPRRDDRASKDFYTPL
Ga0182209_11316431	3300017436	Miscanthus Phyllosphere	VTHLDLRAATAKQVQQLRFREFDVWFPPRRDERAVESFYTP
Ga0182209_11710991	3300017436	Miscanthus Phyllosphere	RPQGLPPVTHLDLRAAMAKQVQQLRFVDFEVWFPSRRDERASEGFYTPL
Ga0182191_10426102	3300017438	Miscanthus Phyllosphere	RPQDLPPVTHLDLRATTAKQVQQLRFVDFEQWFPPRRDDRVSEGFYTPL
Ga0182191_10851611	3300017438	Miscanthus Phyllosphere	VTHLDLRATTAKQVQQLRFMQFEEWFPPRRDERASEGFYTPLQEDFY
Ga0182191_10979661	3300017438	Miscanthus Phyllosphere	VTHLDLRAATAKQVQQLRFVDFEVWFSPRRDDRVSEGFYTPL
Ga0182191_11240591	3300017438	Miscanthus Phyllosphere	LDLRATTAKQVQQLRFVDFEQWFPPRRDERASEGFYTPL
Ga0182191_11479551	3300017438	Miscanthus Phyllosphere	VIHLDLRATTTKQVRQLRFVEFEVWFPPRRDERAAEVFYTPLREDF
Ga0182191_11553842	3300017438	Miscanthus Phyllosphere	THLDLRAATAKQVQQLRFVDFEVWFPPRRDDRASEGFYTPL
Ga0182221_10446551	3300017442	Miscanthus Phyllosphere	PPVVHLDLRAATARQVRQLRFVEFDVWFPPRRDERAAEGFYTPL
Ga0182221_11170071	3300017442	Miscanthus Phyllosphere	VVHLDLRATTAKQVQQLRFMEFDVWFPPRRDERAAE
Ga0182193_10395562	3300017443	Miscanthus Phyllosphere	VTHLDLRVATAKQVQQLRFVLFEDWFPLRRDERASEGFYTPLQE
Ga0182193_10398513	3300017443	Miscanthus Phyllosphere	VTHLDLRATTTKQVQQLGFVQFEDWFPPRRDERASEGFYTPLQE
Ga0182193_10905001	3300017443	Miscanthus Phyllosphere	VTHLDLRAAIAKQVHQLRFVSFENWFPPRRDERALEGFYTPL
Ga0182193_11109811	3300017443	Miscanthus Phyllosphere	LPPVTHLDLRAATAKQVQQLRFVDFEQWFLPRRDERASEGFYTPL
Ga0182193_11467182	3300017443	Miscanthus Phyllosphere	PPLVVHLDLRAATARQVHQLCFVEFDVWFPPRRDERAAEGFYTPLH
Ga0182233_10521101	3300017680	Miscanthus Phyllosphere	VTHLDLRAATAKQVQQLRFVDFEKWFPLRQDERASKA
Ga0182218_10334111	3300017683	Miscanthus Phyllosphere	VTHLDLRAATVKQVQQLRFVDFEQWFPPRRDDRASEGFYTPLQEDF
Ga0182218_10391212	3300017683	Miscanthus Phyllosphere	MAKQVQQLRFIQFEDWFPPRRDERALEGFYAPLQEDF
Ga0182218_10686331	3300017683	Miscanthus Phyllosphere	PRPQGPPPVVHLDLRAATARQVRQLRFVEFEVWFPPRRDKRAAEGFYMPL
Ga0182218_11368391	3300017683	Miscanthus Phyllosphere	VVHLDLRVTIARQVRQLRFVEFDVWFPPRRDERAAEGFYTPL
Ga0182225_10219072	3300017684	Miscanthus Phyllosphere	MQRLDLRAATARQVQQLRFVEFDQLFPPRRDERASEGFYTVLQE
Ga0182225_11053072	3300017684	Miscanthus Phyllosphere	MTHLDLRATTAKQVQQLRFVLFEDWFLPRRDERASEGFYTPL
Ga0182225_11353791	3300017684	Miscanthus Phyllosphere	LRAAIARQVRQLRFVEFDVWFPPRRDERAAKRFYTPL
Ga0182227_10875162	3300017685	Miscanthus Phyllosphere	VTHLDLRAAMAKQVRQLRFVEFEVWFPPRRDEKASEGFYTPL
Ga0182227_10917822	3300017685	Miscanthus Phyllosphere	VTHLDLRATTAKQVQQLRFMDFEVWFPHRRDERASEGFYTPL
Ga0182205_10606661	3300017686	Miscanthus Phyllosphere	LRAATAKQVQQLRFVQFEEWFLPRRDERVSEGFYTPL
Ga0182205_10664281	3300017686	Miscanthus Phyllosphere	VTHLDLRATTAKQVQQLRFVDFEVWFPPRRDERASEGFYTPLHED
Ga0182205_11198913	3300017686	Miscanthus Phyllosphere	VTHLDLRAVTAKQVQQLRFVDFEQWFLPRRDDRASEGFYTPLQEDFYN
Ga0182205_11219072	3300017686	Miscanthus Phyllosphere	MTHLDLRAATAKQVQQLRFVDFEQWFPPRRDEQASEGFYTPL
Ga0182205_11497512	3300017686	Miscanthus Phyllosphere	VTHLDLRGTTAKQVQQLRFVDFEQWFPMRRDERASEGFYTPL
Ga0182223_10746641	3300017690	Miscanthus Phyllosphere	PPLVVHLDLRATTTRQVQQLHLVEFEQWFPSRQDERASEQFYTVL
Ga0182223_11051401	3300017690	Miscanthus Phyllosphere	LRAATAKQVQQLRFVDFEVWFPPRRDERASEGFYTPL
Ga0182223_11055811	3300017690	Miscanthus Phyllosphere	VTHLDLRAATAKQVRELRFVEFEVWFPPMRDERATE
Ga0207687_118913501	3300025927	Miscanthus Rhizosphere	VTHLDLRAATAKQVQQLRFVDFEVWFPPRRDERASEGFYTPL

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.30
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.30
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome Family F014021

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign