| Basic Information | |
|---|---|
| Family ID | F014017 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 266 |
| Average Sequence Length | 46 residues |
| Representative Sequence | MDKIEDYLDEKHRKKIADEIRYLELPPEWRPYEVIRYIVRIIEKSNG |
| Number of Associated Samples | 142 |
| Number of Associated Scaffolds | 266 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 40.08 % |
| % of genes near scaffold ends (potentially truncated) | 20.68 % |
| % of genes from short scaffolds (< 2000 bps) | 69.92 % |
| Associated GOLD sequencing projects | 124 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.53 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (67.293 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (21.804 % of family members) |
| Environment Ontology (ENVO) | Unclassified (50.376 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (63.158 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 40.00% β-sheet: 0.00% Coil/Unstructured: 60.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.53 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 266 Family Scaffolds |
|---|---|---|
| PF00085 | Thioredoxin | 7.89 |
| PF00082 | Peptidase_S8 | 3.76 |
| PF04973 | NMN_transporter | 3.01 |
| PF09834 | DUF2061 | 1.88 |
| PF02675 | AdoMet_dc | 1.50 |
| PF02467 | Whib | 1.50 |
| PF13936 | HTH_38 | 1.13 |
| PF13640 | 2OG-FeII_Oxy_3 | 0.75 |
| PF00166 | Cpn10 | 0.75 |
| PF09360 | zf-CDGSH | 0.38 |
| PF05257 | CHAP | 0.38 |
| PF05099 | TerB | 0.38 |
| PF00210 | Ferritin | 0.38 |
| PF02796 | HTH_7 | 0.38 |
| PF12849 | PBP_like_2 | 0.38 |
| PF00296 | Bac_luciferase | 0.38 |
| PF00154 | RecA | 0.38 |
| PF13578 | Methyltransf_24 | 0.38 |
| PF00390 | malic | 0.38 |
| COG ID | Name | Functional Category | % Frequency in 266 Family Scaffolds |
|---|---|---|---|
| COG3201 | Nicotinamide riboside transporter PnuC | Coenzyme transport and metabolism [H] | 3.01 |
| COG1586 | S-adenosylmethionine decarboxylase | Amino acid transport and metabolism [E] | 1.50 |
| COG0234 | Co-chaperonin GroES (HSP10) | Posttranslational modification, protein turnover, chaperones [O] | 0.75 |
| COG0281 | Malic enzyme | Energy production and conversion [C] | 0.38 |
| COG0468 | RecA/RadA recombinase | Replication, recombination and repair [L] | 0.38 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 0.38 |
| COG3793 | Tellurite resistance protein TerB | Inorganic ion transport and metabolism [P] | 0.38 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 67.29 % |
| All Organisms | root | All Organisms | 32.71 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2035265000|ErSWdraf_F5BXKTZ02IPLEY | Not Available | 534 | Open in IMG/M |
| 2199352004|2199854231 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → unclassified Verrucomicrobiales → Verrucomicrobiales bacterium | 1097 | Open in IMG/M |
| 3300000736|JGI12547J11936_1001083 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 7618 | Open in IMG/M |
| 3300000736|JGI12547J11936_1003645 | All Organisms → cellular organisms → Bacteria | 4275 | Open in IMG/M |
| 3300000756|JGI12421J11937_10003086 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6699 | Open in IMG/M |
| 3300000756|JGI12421J11937_10014466 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2983 | Open in IMG/M |
| 3300000756|JGI12421J11937_10098202 | Not Available | 806 | Open in IMG/M |
| 3300000756|JGI12421J11937_10109993 | Not Available | 736 | Open in IMG/M |
| 3300002835|B570J40625_100000179 | Not Available | 98877 | Open in IMG/M |
| 3300002835|B570J40625_100013100 | Not Available | 14792 | Open in IMG/M |
| 3300003413|JGI25922J50271_10000832 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 9070 | Open in IMG/M |
| 3300003430|JGI25921J50272_10005855 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3840 | Open in IMG/M |
| 3300003430|JGI25921J50272_10013814 | Not Available | 2310 | Open in IMG/M |
| 3300003430|JGI25921J50272_10018549 | Not Available | 1906 | Open in IMG/M |
| 3300003491|JGI25924J51412_1038611 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 773 | Open in IMG/M |
| 3300003493|JGI25923J51411_1014017 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1692 | Open in IMG/M |
| 3300003493|JGI25923J51411_1050185 | Not Available | 754 | Open in IMG/M |
| 3300004096|Ga0066177_10202338 | Not Available | 815 | Open in IMG/M |
| 3300004112|Ga0065166_10030269 | Not Available | 1678 | Open in IMG/M |
| 3300004112|Ga0065166_10067476 | Not Available | 1233 | Open in IMG/M |
| 3300004112|Ga0065166_10265736 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → unclassified Verrucomicrobiales → Verrucomicrobiales bacterium | 693 | Open in IMG/M |
| 3300004112|Ga0065166_10292704 | Not Available | 663 | Open in IMG/M |
| 3300004124|Ga0066178_10066820 | Not Available | 938 | Open in IMG/M |
| 3300004240|Ga0007787_10308536 | Not Available | 783 | Open in IMG/M |
| 3300005517|Ga0070374_10090548 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1593 | Open in IMG/M |
| 3300005517|Ga0070374_10348841 | Not Available | 748 | Open in IMG/M |
| 3300005580|Ga0049083_10037384 | All Organisms → Viruses → Predicted Viral | 1727 | Open in IMG/M |
| 3300005580|Ga0049083_10324557 | Not Available | 514 | Open in IMG/M |
| 3300005582|Ga0049080_10087615 | Not Available | 1063 | Open in IMG/M |
| 3300005582|Ga0049080_10235103 | Not Available | 600 | Open in IMG/M |
| 3300005584|Ga0049082_10117021 | Not Available | 931 | Open in IMG/M |
| 3300005662|Ga0078894_10062870 | Not Available | 3184 | Open in IMG/M |
| 3300005662|Ga0078894_10103287 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2518 | Open in IMG/M |
| 3300005662|Ga0078894_10109398 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → unclassified Verrucomicrobiales → Verrucomicrobiales bacterium | 2448 | Open in IMG/M |
| 3300005662|Ga0078894_10264731 | Not Available | 1559 | Open in IMG/M |
| 3300005662|Ga0078894_10264774 | Not Available | 1559 | Open in IMG/M |
| 3300005662|Ga0078894_10372321 | Not Available | 1292 | Open in IMG/M |
| 3300005662|Ga0078894_10499574 | Not Available | 1092 | Open in IMG/M |
| 3300005662|Ga0078894_10504790 | Not Available | 1085 | Open in IMG/M |
| 3300005662|Ga0078894_10597134 | Not Available | 983 | Open in IMG/M |
| 3300005662|Ga0078894_10658704 | Not Available | 927 | Open in IMG/M |
| 3300005662|Ga0078894_10680742 | Not Available | 909 | Open in IMG/M |
| 3300005662|Ga0078894_10689402 | Not Available | 902 | Open in IMG/M |
| 3300005662|Ga0078894_10690877 | Not Available | 901 | Open in IMG/M |
| 3300005662|Ga0078894_10715875 | Not Available | 882 | Open in IMG/M |
| 3300005662|Ga0078894_11283810 | Not Available | 616 | Open in IMG/M |
| 3300005662|Ga0078894_11611101 | Not Available | 535 | Open in IMG/M |
| 3300005662|Ga0078894_11772754 | Not Available | 504 | Open in IMG/M |
| 3300005941|Ga0070743_10000273 | Not Available | 20006 | Open in IMG/M |
| 3300005941|Ga0070743_10197477 | Not Available | 661 | Open in IMG/M |
| 3300005955|Ga0073922_1045949 | Not Available | 553 | Open in IMG/M |
| 3300006484|Ga0070744_10002116 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5989 | Open in IMG/M |
| 3300006484|Ga0070744_10003556 | All Organisms → Viruses → Predicted Viral | 4687 | Open in IMG/M |
| 3300006484|Ga0070744_10043990 | Not Available | 1311 | Open in IMG/M |
| 3300006484|Ga0070744_10055938 | Not Available | 1153 | Open in IMG/M |
| 3300006484|Ga0070744_10087910 | Not Available | 900 | Open in IMG/M |
| 3300006484|Ga0070744_10130297 | Not Available | 723 | Open in IMG/M |
| 3300006484|Ga0070744_10147354 | Not Available | 675 | Open in IMG/M |
| 3300006875|Ga0075473_10001925 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 8583 | Open in IMG/M |
| 3300006875|Ga0075473_10015991 | All Organisms → Viruses → Predicted Viral | 2890 | Open in IMG/M |
| 3300007546|Ga0102874_1002449 | Not Available | 6342 | Open in IMG/M |
| 3300007546|Ga0102874_1038109 | Not Available | 1561 | Open in IMG/M |
| 3300007549|Ga0102879_1038496 | Not Available | 1552 | Open in IMG/M |
| 3300007549|Ga0102879_1100841 | Not Available | 898 | Open in IMG/M |
| 3300007550|Ga0102880_1107029 | Not Available | 734 | Open in IMG/M |
| 3300007559|Ga0102828_1016665 | All Organisms → Viruses → Predicted Viral | 1561 | Open in IMG/M |
| 3300007559|Ga0102828_1044676 | Not Available | 1020 | Open in IMG/M |
| 3300007559|Ga0102828_1058409 | Not Available | 905 | Open in IMG/M |
| 3300007560|Ga0102913_1059435 | Not Available | 1245 | Open in IMG/M |
| 3300007585|Ga0102916_1152941 | Not Available | 623 | Open in IMG/M |
| 3300007606|Ga0102923_1282342 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → unclassified Verrucomicrobiales → Verrucomicrobiales bacterium | 512 | Open in IMG/M |
| 3300007606|Ga0102923_1283186 | Not Available | 511 | Open in IMG/M |
| 3300007617|Ga0102897_1112481 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → unclassified Verrucomicrobiales → Verrucomicrobiales bacterium | 839 | Open in IMG/M |
| 3300007620|Ga0102871_1032921 | Not Available | 1548 | Open in IMG/M |
| 3300007621|Ga0102872_1146159 | Not Available | 627 | Open in IMG/M |
| 3300007622|Ga0102863_1049053 | All Organisms → Viruses → Predicted Viral | 1230 | Open in IMG/M |
| 3300007627|Ga0102869_1025151 | Not Available | 1677 | Open in IMG/M |
| 3300007636|Ga0102856_1062108 | Not Available | 601 | Open in IMG/M |
| 3300007644|Ga0102902_1038718 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → unclassified Verrucomicrobiales → Verrucomicrobiales bacterium | 1430 | Open in IMG/M |
| 3300007647|Ga0102855_1099010 | Not Available | 782 | Open in IMG/M |
| 3300007653|Ga0102868_1151015 | Not Available | 553 | Open in IMG/M |
| 3300007706|Ga0102899_1096586 | Not Available | 719 | Open in IMG/M |
| 3300007708|Ga0102859_1221204 | Not Available | 565 | Open in IMG/M |
| 3300007718|Ga0102852_1075679 | Not Available | 651 | Open in IMG/M |
| 3300007860|Ga0105735_1098813 | Not Available | 616 | Open in IMG/M |
| 3300007860|Ga0105735_1125662 | Not Available | 557 | Open in IMG/M |
| 3300007862|Ga0105737_1180985 | Not Available | 554 | Open in IMG/M |
| 3300007973|Ga0105746_1096220 | Not Available | 969 | Open in IMG/M |
| 3300008055|Ga0108970_10158717 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3256 | Open in IMG/M |
| 3300008107|Ga0114340_1017323 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3433 | Open in IMG/M |
| 3300008107|Ga0114340_1049495 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1844 | Open in IMG/M |
| 3300008107|Ga0114340_1052035 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2655 | Open in IMG/M |
| 3300008107|Ga0114340_1102931 | Not Available | 1139 | Open in IMG/M |
| 3300008107|Ga0114340_1152761 | Not Available | 848 | Open in IMG/M |
| 3300008107|Ga0114340_1174106 | Not Available | 761 | Open in IMG/M |
| 3300008107|Ga0114340_1240759 | Not Available | 562 | Open in IMG/M |
| 3300008110|Ga0114343_1018750 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5448 | Open in IMG/M |
| 3300008110|Ga0114343_1021586 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3635 | Open in IMG/M |
| 3300008111|Ga0114344_1000847 | Not Available | 28581 | Open in IMG/M |
| 3300008113|Ga0114346_1020424 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3574 | Open in IMG/M |
| 3300008113|Ga0114346_1125823 | Not Available | 1133 | Open in IMG/M |
| 3300008261|Ga0114336_1006646 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 7714 | Open in IMG/M |
| 3300008261|Ga0114336_1050846 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2536 | Open in IMG/M |
| 3300008261|Ga0114336_1089406 | Not Available | 1472 | Open in IMG/M |
| 3300008262|Ga0114337_1085045 | Not Available | 1519 | Open in IMG/M |
| 3300008950|Ga0102891_1088183 | Not Available | 942 | Open in IMG/M |
| 3300008953|Ga0104241_1014962 | Not Available | 528 | Open in IMG/M |
| 3300008961|Ga0102887_1268477 | Not Available | 514 | Open in IMG/M |
| 3300008962|Ga0104242_1015158 | Not Available | 1347 | Open in IMG/M |
| 3300008996|Ga0102831_1038475 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1613 | Open in IMG/M |
| 3300008996|Ga0102831_1132607 | Not Available | 827 | Open in IMG/M |
| 3300008996|Ga0102831_1220181 | Not Available | 627 | Open in IMG/M |
| 3300009026|Ga0102829_1041242 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1370 | Open in IMG/M |
| 3300009056|Ga0102860_1069103 | Not Available | 963 | Open in IMG/M |
| 3300009058|Ga0102854_1039207 | Not Available | 1365 | Open in IMG/M |
| 3300009080|Ga0102815_10241854 | Not Available | 995 | Open in IMG/M |
| 3300009152|Ga0114980_10557568 | Not Available | 649 | Open in IMG/M |
| 3300009155|Ga0114968_10054079 | Not Available | 2575 | Open in IMG/M |
| 3300009155|Ga0114968_10090891 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1880 | Open in IMG/M |
| 3300009158|Ga0114977_10069951 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2153 | Open in IMG/M |
| 3300009159|Ga0114978_10381981 | Not Available | 847 | Open in IMG/M |
| 3300009159|Ga0114978_10830493 | Not Available | 519 | Open in IMG/M |
| 3300009161|Ga0114966_10128969 | Not Available | 1668 | Open in IMG/M |
| 3300009161|Ga0114966_10247252 | Not Available | 1103 | Open in IMG/M |
| 3300009164|Ga0114975_10559494 | Not Available | 613 | Open in IMG/M |
| 3300009183|Ga0114974_10065968 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2386 | Open in IMG/M |
| 3300009183|Ga0114974_10270152 | Not Available | 1010 | Open in IMG/M |
| 3300009183|Ga0114974_10436755 | Not Available | 744 | Open in IMG/M |
| 3300009183|Ga0114974_10543224 | Not Available | 647 | Open in IMG/M |
| 3300009183|Ga0114974_10629434 | Not Available | 589 | Open in IMG/M |
| 3300009194|Ga0114983_1050585 | Not Available | 983 | Open in IMG/M |
| 3300009194|Ga0114983_1071791 | Not Available | 786 | Open in IMG/M |
| 3300009419|Ga0114982_1002157 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 8814 | Open in IMG/M |
| 3300009419|Ga0114982_1007609 | Not Available | 3966 | Open in IMG/M |
| 3300009419|Ga0114982_1039264 | Not Available | 1516 | Open in IMG/M |
| 3300009419|Ga0114982_1041086 | Not Available | 1476 | Open in IMG/M |
| 3300010312|Ga0102883_1023921 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1845 | Open in IMG/M |
| 3300010374|Ga0114986_1056852 | Not Available | 708 | Open in IMG/M |
| 3300010374|Ga0114986_1075378 | Not Available | 608 | Open in IMG/M |
| 3300010374|Ga0114986_1093012 | Not Available | 546 | Open in IMG/M |
| 3300011116|Ga0151516_11107 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 11507 | Open in IMG/M |
| 3300012000|Ga0119951_1009102 | All Organisms → Viruses → Predicted Viral | 4222 | Open in IMG/M |
| 3300012017|Ga0153801_1036136 | Not Available | 873 | Open in IMG/M |
| 3300012663|Ga0157203_1001838 | All Organisms → Viruses → Predicted Viral | 4978 | Open in IMG/M |
| 3300012663|Ga0157203_1023446 | Not Available | 890 | Open in IMG/M |
| 3300012707|Ga0157623_1100414 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → unclassified Verrucomicrobiales → Verrucomicrobiales bacterium | 622 | Open in IMG/M |
| 3300012724|Ga0157611_1030798 | Not Available | 627 | Open in IMG/M |
| 3300013004|Ga0164293_10442051 | Not Available | 868 | Open in IMG/M |
| 3300013005|Ga0164292_10424615 | Not Available | 883 | Open in IMG/M |
| 3300017766|Ga0181343_1091423 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 868 | Open in IMG/M |
| 3300017774|Ga0181358_1191878 | Not Available | 673 | Open in IMG/M |
| 3300017780|Ga0181346_1170373 | Not Available | 803 | Open in IMG/M |
| 3300019784|Ga0181359_1161700 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 758 | Open in IMG/M |
| 3300019784|Ga0181359_1202895 | Not Available | 637 | Open in IMG/M |
| 3300020048|Ga0207193_1016430 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 9703 | Open in IMG/M |
| 3300020141|Ga0211732_1039602 | All Organisms → Viruses → Predicted Viral | 1827 | Open in IMG/M |
| 3300020141|Ga0211732_1061301 | Not Available | 44174 | Open in IMG/M |
| 3300020141|Ga0211732_1391907 | Not Available | 524 | Open in IMG/M |
| 3300020151|Ga0211736_10348651 | Not Available | 1027 | Open in IMG/M |
| 3300020159|Ga0211734_10985635 | Not Available | 671 | Open in IMG/M |
| 3300020159|Ga0211734_11051844 | Not Available | 1146 | Open in IMG/M |
| 3300020160|Ga0211733_10586387 | Not Available | 1900 | Open in IMG/M |
| 3300020161|Ga0211726_10095941 | Not Available | 1495 | Open in IMG/M |
| 3300020161|Ga0211726_10209447 | Not Available | 1443 | Open in IMG/M |
| 3300020172|Ga0211729_10306504 | Not Available | 1443 | Open in IMG/M |
| 3300020172|Ga0211729_10306787 | Not Available | 655 | Open in IMG/M |
| 3300020172|Ga0211729_10668333 | Not Available | 788 | Open in IMG/M |
| 3300020487|Ga0208200_100440 | Not Available | 4043 | Open in IMG/M |
| 3300020519|Ga0208223_1008137 | All Organisms → Viruses → Predicted Viral | 1754 | Open in IMG/M |
| 3300021519|Ga0194048_10042717 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1858 | Open in IMG/M |
| 3300021602|Ga0194060_10151544 | Not Available | 1229 | Open in IMG/M |
| 3300021961|Ga0222714_10503820 | Not Available | 621 | Open in IMG/M |
| 3300021962|Ga0222713_10020788 | Not Available | 5518 | Open in IMG/M |
| 3300021962|Ga0222713_10031424 | All Organisms → Viruses → Predicted Viral | 4275 | Open in IMG/M |
| 3300021962|Ga0222713_10096634 | All Organisms → Viruses → Predicted Viral | 2125 | Open in IMG/M |
| 3300021962|Ga0222713_10294712 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1036 | Open in IMG/M |
| 3300021962|Ga0222713_10391327 | Not Available | 858 | Open in IMG/M |
| 3300021963|Ga0222712_10501922 | Not Available | 717 | Open in IMG/M |
| 3300022407|Ga0181351_1221910 | Not Available | 613 | Open in IMG/M |
| 3300022407|Ga0181351_1235789 | Not Available | 582 | Open in IMG/M |
| 3300023174|Ga0214921_10001452 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 40427 | Open in IMG/M |
| 3300023174|Ga0214921_10011203 | Not Available | 10937 | Open in IMG/M |
| 3300023174|Ga0214921_10015522 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 8679 | Open in IMG/M |
| 3300023174|Ga0214921_10016337 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8361 | Open in IMG/M |
| 3300023174|Ga0214921_10017015 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8131 | Open in IMG/M |
| 3300023174|Ga0214921_10026028 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 5952 | Open in IMG/M |
| 3300023174|Ga0214921_10032112 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5099 | Open in IMG/M |
| 3300023174|Ga0214921_10082052 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2542 | Open in IMG/M |
| 3300023174|Ga0214921_10098187 | Not Available | 2213 | Open in IMG/M |
| 3300023174|Ga0214921_10111791 | Not Available | 2001 | Open in IMG/M |
| 3300023174|Ga0214921_10270763 | Not Available | 975 | Open in IMG/M |
| 3300023174|Ga0214921_10478949 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 601 | Open in IMG/M |
| 3300024343|Ga0244777_10000080 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 71570 | Open in IMG/M |
| 3300024343|Ga0244777_10065269 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → unclassified Verrucomicrobiales → Verrucomicrobiales bacterium | 2335 | Open in IMG/M |
| 3300024343|Ga0244777_10692646 | Not Available | 610 | Open in IMG/M |
| 3300024346|Ga0244775_10007085 | Not Available | 11060 | Open in IMG/M |
| 3300024346|Ga0244775_10023713 | Not Available | 5528 | Open in IMG/M |
| 3300024346|Ga0244775_10025536 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5304 | Open in IMG/M |
| 3300024346|Ga0244775_10030302 | All Organisms → Viruses → Predicted Viral | 4821 | Open in IMG/M |
| 3300024346|Ga0244775_10045098 | All Organisms → Viruses → Predicted Viral | 3864 | Open in IMG/M |
| 3300024346|Ga0244775_10179368 | All Organisms → Viruses → Predicted Viral | 1782 | Open in IMG/M |
| 3300024346|Ga0244775_10279495 | Not Available | 1387 | Open in IMG/M |
| 3300024346|Ga0244775_10462080 | Not Available | 1039 | Open in IMG/M |
| 3300024346|Ga0244775_10630117 | Not Available | 868 | Open in IMG/M |
| 3300024348|Ga0244776_10854874 | Not Available | 544 | Open in IMG/M |
| 3300025635|Ga0208147_1014896 | Not Available | 2118 | Open in IMG/M |
| 3300027121|Ga0255074_1016979 | Not Available | 938 | Open in IMG/M |
| 3300027121|Ga0255074_1044051 | Not Available | 554 | Open in IMG/M |
| 3300027127|Ga0255071_1020893 | Not Available | 1028 | Open in IMG/M |
| 3300027131|Ga0255066_1004051 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2461 | Open in IMG/M |
| 3300027131|Ga0255066_1010117 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1452 | Open in IMG/M |
| 3300027134|Ga0255069_1033705 | Not Available | 580 | Open in IMG/M |
| 3300027140|Ga0255080_1068337 | Not Available | 541 | Open in IMG/M |
| 3300027212|Ga0208554_1003153 | All Organisms → Viruses → Predicted Viral | 2638 | Open in IMG/M |
| 3300027242|Ga0208806_1021792 | Not Available | 1345 | Open in IMG/M |
| 3300027244|Ga0208173_1066528 | Not Available | 629 | Open in IMG/M |
| 3300027261|Ga0208933_1009948 | Not Available | 1518 | Open in IMG/M |
| 3300027278|Ga0208439_1027208 | Not Available | 1159 | Open in IMG/M |
| 3300027293|Ga0255132_1035894 | Not Available | 1151 | Open in IMG/M |
| 3300027311|Ga0208812_1117688 | Not Available | 502 | Open in IMG/M |
| 3300027531|Ga0208682_1030791 | Not Available | 1433 | Open in IMG/M |
| 3300027563|Ga0209552_1039018 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1374 | Open in IMG/M |
| 3300027581|Ga0209651_1022635 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1969 | Open in IMG/M |
| 3300027581|Ga0209651_1057716 | All Organisms → Viruses → Predicted Viral | 1144 | Open in IMG/M |
| 3300027586|Ga0208966_1025015 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1754 | Open in IMG/M |
| 3300027594|Ga0255120_1073357 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 598 | Open in IMG/M |
| 3300027597|Ga0255088_1034864 | Not Available | 1070 | Open in IMG/M |
| 3300027631|Ga0208133_1082496 | Not Available | 756 | Open in IMG/M |
| 3300027644|Ga0209356_1008547 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 3668 | Open in IMG/M |
| 3300027644|Ga0209356_1025795 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1956 | Open in IMG/M |
| 3300027656|Ga0209357_1013039 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 3037 | Open in IMG/M |
| 3300027689|Ga0209551_1043180 | Not Available | 1501 | Open in IMG/M |
| 3300027708|Ga0209188_1041367 | Not Available | 2110 | Open in IMG/M |
| 3300027710|Ga0209599_10001317 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 12131 | Open in IMG/M |
| 3300027710|Ga0209599_10001951 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 9085 | Open in IMG/M |
| 3300027710|Ga0209599_10004383 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 5155 | Open in IMG/M |
| 3300027710|Ga0209599_10005470 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4410 | Open in IMG/M |
| 3300027734|Ga0209087_1296154 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 579 | Open in IMG/M |
| 3300027754|Ga0209596_1001657 | Not Available | 18940 | Open in IMG/M |
| 3300027756|Ga0209444_10145497 | Not Available | 913 | Open in IMG/M |
| 3300027756|Ga0209444_10282376 | Not Available | 564 | Open in IMG/M |
| 3300027759|Ga0209296_1013072 | Not Available | 4904 | Open in IMG/M |
| 3300027759|Ga0209296_1021214 | Not Available | 3700 | Open in IMG/M |
| 3300027759|Ga0209296_1075862 | Not Available | 1670 | Open in IMG/M |
| 3300027759|Ga0209296_1248040 | Not Available | 734 | Open in IMG/M |
| 3300027769|Ga0209770_10137107 | Not Available | 991 | Open in IMG/M |
| 3300027769|Ga0209770_10173795 | Not Available | 860 | Open in IMG/M |
| 3300027770|Ga0209086_10042604 | Not Available | 2605 | Open in IMG/M |
| 3300027770|Ga0209086_10067514 | Not Available | 1930 | Open in IMG/M |
| 3300027770|Ga0209086_10385274 | Not Available | 568 | Open in IMG/M |
| 3300027805|Ga0209229_10189094 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 923 | Open in IMG/M |
| 3300027805|Ga0209229_10399077 | Not Available | 597 | Open in IMG/M |
| 3300027892|Ga0209550_10059860 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 3023 | Open in IMG/M |
| 3300027892|Ga0209550_10080019 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2510 | Open in IMG/M |
| 3300027892|Ga0209550_10256458 | Not Available | 1151 | Open in IMG/M |
| 3300027892|Ga0209550_10516480 | Not Available | 714 | Open in IMG/M |
| 3300027892|Ga0209550_10590342 | Not Available | 653 | Open in IMG/M |
| 3300027892|Ga0209550_10805057 | Not Available | 527 | Open in IMG/M |
| 3300027963|Ga0209400_1010842 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5765 | Open in IMG/M |
| 3300028025|Ga0247723_1000576 | Not Available | 24538 | Open in IMG/M |
| 3300034061|Ga0334987_0160740 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1631 | Open in IMG/M |
| 3300034102|Ga0335029_0663753 | Not Available | 572 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 21.80% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 16.92% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 9.40% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 7.14% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 7.14% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 6.39% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 6.02% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 4.89% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 4.51% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 2.63% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 2.26% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 1.88% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment | 1.50% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 1.50% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 1.13% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater And Sediment | 0.75% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 0.75% |
| Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 0.75% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 0.75% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 0.38% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment | 0.38% |
| Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Sand | 0.38% |
| Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 0.38% |
| Estuary | Host-Associated → Plants → Leaf → Unclassified → Unclassified → Estuary | 0.38% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2035265000 | Freshwater microbial communities from Swedish Lakes - surface of Lake Erken | Environmental | Open in IMG/M |
| 2199352004 | Freshwater microbial communities from Lake Mendota, WI - Practice 15JUN2010 epilimnion | Environmental | Open in IMG/M |
| 3300000736 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB epilimnion July 2011 | Environmental | Open in IMG/M |
| 3300000756 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 | Environmental | Open in IMG/M |
| 3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
| 3300003413 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD | Environmental | Open in IMG/M |
| 3300003430 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD | Environmental | Open in IMG/M |
| 3300003491 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SD | Environmental | Open in IMG/M |
| 3300003493 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SN | Environmental | Open in IMG/M |
| 3300004096 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 2) | Environmental | Open in IMG/M |
| 3300004112 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 2) | Environmental | Open in IMG/M |
| 3300004124 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SD (version 2) | Environmental | Open in IMG/M |
| 3300004240 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN | Environmental | Open in IMG/M |
| 3300005517 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 4) | Environmental | Open in IMG/M |
| 3300005580 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF | Environmental | Open in IMG/M |
| 3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
| 3300005584 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF | Environmental | Open in IMG/M |
| 3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
| 3300005941 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.697 | Environmental | Open in IMG/M |
| 3300005955 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T2_23-Sept-14 | Environmental | Open in IMG/M |
| 3300006484 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 | Environmental | Open in IMG/M |
| 3300006875 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA | Environmental | Open in IMG/M |
| 3300007546 | Estuarine microbial communities from the Columbia River estuary - metaG 1547A-02 | Environmental | Open in IMG/M |
| 3300007549 | Estuarine microbial communities from the Columbia River estuary - metaG 1548B-02 | Environmental | Open in IMG/M |
| 3300007550 | Estuarine microbial communities from the Columbia River estuary - metaG 1549A-3 | Environmental | Open in IMG/M |
| 3300007559 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541 | Environmental | Open in IMG/M |
| 3300007560 | Estuarine microbial communities from the Columbia River estuary - metaG 1560A-02 | Environmental | Open in IMG/M |
| 3300007585 | Estuarine microbial communities from the Columbia River estuary - metaG 1562A-3 | Environmental | Open in IMG/M |
| 3300007606 | Estuarine microbial communities from the Columbia River estuary - metaG 1569-02 | Environmental | Open in IMG/M |
| 3300007617 | Estuarine microbial communities from the Columbia River estuary - metaG 1554B-02 | Environmental | Open in IMG/M |
| 3300007620 | Estuarine microbial communities from the Columbia River estuary - metaG 1546C-02 | Environmental | Open in IMG/M |
| 3300007621 | Estuarine microbial communities from the Columbia River estuary - metaG 1547A-3 | Environmental | Open in IMG/M |
| 3300007622 | Estuarine microbial communities from the Columbia River estuary - metaG 1449A-02 | Environmental | Open in IMG/M |
| 3300007627 | Estuarine microbial communities from the Columbia River estuary - metaG 1546A-02 | Environmental | Open in IMG/M |
| 3300007636 | Estuarine microbial communities from the Columbia River estuary - metaG 1371A-3 | Environmental | Open in IMG/M |
| 3300007644 | Estuarine microbial communities from the Columbia River estuary - metaG 1555B-02 | Environmental | Open in IMG/M |
| 3300007647 | Estuarine microbial communities from the Columbia River estuary - metaG 1370B-02 | Environmental | Open in IMG/M |
| 3300007653 | Estuarine microbial communities from the Columbia River estuary - metaG 1546C-3 | Environmental | Open in IMG/M |
| 3300007706 | Estuarine microbial communities from the Columbia River estuary - metaG 1555B-3 | Environmental | Open in IMG/M |
| 3300007708 | Estuarine microbial communities from the Columbia River estuary - metaG 1371B-02 | Environmental | Open in IMG/M |
| 3300007718 | Estuarine microbial communities from the Columbia River estuary - metaG 1370A-3 | Environmental | Open in IMG/M |
| 3300007860 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1372A_3um | Environmental | Open in IMG/M |
| 3300007862 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1373A_0.2um | Environmental | Open in IMG/M |
| 3300007973 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460A_0.2um | Environmental | Open in IMG/M |
| 3300008055 | Metatranscriptomes of the Eelgrass leaves and roots. Combined Assembly of Gp0128390, Gp0128391, Gp0128392, and Gp0128393 | Host-Associated | Open in IMG/M |
| 3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
| 3300008110 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NA | Environmental | Open in IMG/M |
| 3300008111 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-C-NA | Environmental | Open in IMG/M |
| 3300008113 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA | Environmental | Open in IMG/M |
| 3300008261 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-C-NA | Environmental | Open in IMG/M |
| 3300008262 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-C-NA | Environmental | Open in IMG/M |
| 3300008950 | Estuarine microbial communities from the Columbia River estuary - metaG 1552A-02 | Environmental | Open in IMG/M |
| 3300008953 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007_MT4 | Environmental | Open in IMG/M |
| 3300008961 | Estuarine microbial communities from the Columbia River estuary - metaG 1550B-02 | Environmental | Open in IMG/M |
| 3300008962 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007_MT5 | Environmental | Open in IMG/M |
| 3300008996 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.747 | Environmental | Open in IMG/M |
| 3300009026 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575 | Environmental | Open in IMG/M |
| 3300009056 | Estuarine microbial communities from the Columbia River estuary - metaG 1449A-3 | Environmental | Open in IMG/M |
| 3300009058 | Estuarine microbial communities from the Columbia River estuary - metaG 1370A-02 | Environmental | Open in IMG/M |
| 3300009080 | Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.759 | Environmental | Open in IMG/M |
| 3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
| 3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
| 3300009158 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG | Environmental | Open in IMG/M |
| 3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
| 3300009161 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG | Environmental | Open in IMG/M |
| 3300009164 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG | Environmental | Open in IMG/M |
| 3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
| 3300009194 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 RT | Environmental | Open in IMG/M |
| 3300009419 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT | Environmental | Open in IMG/M |
| 3300010312 | Estuarine microbial communities from the Columbia River estuary - metaG 1549B-02 | Environmental | Open in IMG/M |
| 3300010374 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S-1-Day17 | Environmental | Open in IMG/M |
| 3300011116 | Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea - SYL_2015Nov | Environmental | Open in IMG/M |
| 3300012000 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007A | Environmental | Open in IMG/M |
| 3300012017 | Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Top - Depth 1m | Environmental | Open in IMG/M |
| 3300012663 | Freshwater microbial communities from Indian River, Ontario, Canada - S50 | Environmental | Open in IMG/M |
| 3300012707 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES154 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012724 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES138 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
| 3300013005 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG | Environmental | Open in IMG/M |
| 3300017766 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D | Environmental | Open in IMG/M |
| 3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020048 | Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915 | Environmental | Open in IMG/M |
| 3300020141 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_104 megahit1 | Environmental | Open in IMG/M |
| 3300020151 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1 | Environmental | Open in IMG/M |
| 3300020159 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1 | Environmental | Open in IMG/M |
| 3300020160 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_105 megahit1 | Environmental | Open in IMG/M |
| 3300020161 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1 | Environmental | Open in IMG/M |
| 3300020172 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1 | Environmental | Open in IMG/M |
| 3300020487 | Freshwater microbial communities from Lake Mendota, WI - 13AUG2008 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020519 | Freshwater microbial communities from Lake Mendota, WI - 07OCT2009 deep hole epilimnion ns (SPAdes) | Environmental | Open in IMG/M |
| 3300021519 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L222-5m | Environmental | Open in IMG/M |
| 3300021602 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Sep2016-L222-5m | Environmental | Open in IMG/M |
| 3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
| 3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
| 3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
| 3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300023174 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505 | Environmental | Open in IMG/M |
| 3300024343 | Combined assembly of estuarine microbial communities from Columbia River, Washington, USA >3um size fraction | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300024348 | 0.2um to 3um size fraction coassembly | Environmental | Open in IMG/M |
| 3300025635 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027121 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepC_8h | Environmental | Open in IMG/M |
| 3300027127 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Miss_RepC_8h | Environmental | Open in IMG/M |
| 3300027131 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepA_8h | Environmental | Open in IMG/M |
| 3300027134 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Miss_RepA_8h | Environmental | Open in IMG/M |
| 3300027140 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Atlam_RepC_8h | Environmental | Open in IMG/M |
| 3300027154 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Yuk_RepA_8h | Environmental | Open in IMG/M |
| 3300027212 | Estuarine microbial communities from the Columbia River estuary - metaG 1371B-02 (SPAdes) | Environmental | Open in IMG/M |
| 3300027242 | Estuarine microbial communities from the Columbia River estuary - metaG 1554B-02 (SPAdes) | Environmental | Open in IMG/M |
| 3300027244 | Estuarine microbial communities from the Columbia River estuary - metaG 1555C-02 (SPAdes) | Environmental | Open in IMG/M |
| 3300027261 | Estuarine microbial communities from the Columbia River estuary - metaG 1563A-3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027278 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.703 (SPAdes) | Environmental | Open in IMG/M |
| 3300027286 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Yuk_RepA_8d | Environmental | Open in IMG/M |
| 3300027293 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Law_RepA_8d | Environmental | Open in IMG/M |
| 3300027311 | Estuarine microbial communities from the Columbia River estuary - metaG 1569-02 (SPAdes) | Environmental | Open in IMG/M |
| 3300027531 | Estuarine microbial communities from the Columbia River estuary - metaG 1568-02 (SPAdes) | Environmental | Open in IMG/M |
| 3300027563 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027581 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027586 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027594 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Colum_RepA_8h | Environmental | Open in IMG/M |
| 3300027597 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Miss_RepB_8d | Environmental | Open in IMG/M |
| 3300027631 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 (SPAdes) | Environmental | Open in IMG/M |
| 3300027644 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027656 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027689 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027708 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027710 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT (SPAdes) | Environmental | Open in IMG/M |
| 3300027734 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027754 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027756 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.DN (SPAdes) | Environmental | Open in IMG/M |
| 3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027769 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300027770 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027805 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes) | Environmental | Open in IMG/M |
| 3300027892 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027963 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
| 3300034061 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028 | Environmental | Open in IMG/M |
| 3300034102 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112 | Environmental | Open in IMG/M |
| 3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| ErSWdraft_12842580 | 2035265000 | Freshwater | VSIEEYQDERIRRQISNEISGLELPPEWRPYEVIRYIVRIIERSNG |
| 2200040705 | 2199352004 | Freshwater | VSIEEYQDERIRRQISNEISGLELPPEWRPNEVIRYIVRIIEKSNG |
| JGI12547J11936_100108312 | 3300000736 | Freshwater And Sediment | MDKLIEYLDENHRRKIADEIRYLELPPEWRPYEVIRYIVGIIEKKNGQASRQN* |
| JGI12547J11936_10036452 | 3300000736 | Freshwater And Sediment | VSIEEYQDERIRRQISNEISGLELPPEWRPYEVIRYIVRIIEKSNG* |
| JGI12421J11937_1000308617 | 3300000756 | Freshwater And Sediment | MDKLVEYLDESYRKKIADQIRYLELPPDWKPYEVIRYIVRIIEKNNG* |
| JGI12421J11937_100144662 | 3300000756 | Freshwater And Sediment | MDKLIEYLDENHRRKIADEIRYLELPPEWRPYEVIRYIVGIIEKKNGQTSRQN* |
| JGI12421J11937_100982022 | 3300000756 | Freshwater And Sediment | MDKIVDYLDESHRKKIADEIRYLELPPEWRPHEVIRYIVRIIEKNNG* |
| JGI12421J11937_101099934 | 3300000756 | Freshwater And Sediment | MDKIEDYLDERHRKQIADEIRYLELPPEWRPNEVIRYIVRIIEKSNG** |
| B570J40625_10000017919 | 3300002835 | Freshwater | VSIEEYQDERIRRQISNEISGLELPPEWRPNEVIRYIVRIIEKSNG* |
| B570J40625_10001310022 | 3300002835 | Freshwater | MDKLIEYLDENHRKKIADEIRYLELPPEWRPHEVIRYIVRIIEKQNGQTPR* |
| JGI25922J50271_100008324 | 3300003413 | Freshwater Lake | MDDLGLYLDEKLRQEIADEIRYLELPPEWRPFEVIRYIVRIIEKNNGQTPR* |
| JGI25921J50272_100058553 | 3300003430 | Freshwater Lake | MEQLEKYLDERFRKQVADEIRYLELPPEWRPHEVIRYIVRIIENG* |
| JGI25921J50272_100138142 | 3300003430 | Freshwater Lake | MEDLGLYLDEKLRRQIADEIRYLELPPEWRPFEVIRHIVRIIEKNNG* |
| JGI25921J50272_100185493 | 3300003430 | Freshwater Lake | MDDLGLYLDEKLRQEIADEIRYLELPPEWRPFEVIRYIVRIIEKN |
| JGI25924J51412_10386111 | 3300003491 | Freshwater Lake | MDKLVEYLDENHRKKIADEIRYLELPPEWKPYEVIRYIVRVIEKQNG* |
| JGI25923J51411_10140177 | 3300003493 | Freshwater Lake | MADLNLYLDEKIRHQIADEIKYLELPPEWRPYEVIRYIVRIIEKNNG* |
| JGI25923J51411_10501852 | 3300003493 | Freshwater Lake | MDKIEDYLDEKHRRKIADEIRYLELPPEWRPHEVIRYIVRIIEKSNG* |
| Ga0066177_102023382 | 3300004096 | Freshwater Lake | MDDLSIYLDEKIRQQIADEIRYLELPSEWRPFEVIRYIVRIIEKNNGQTPR* |
| Ga0065166_100302697 | 3300004112 | Freshwater Lake | MDKIEDYLDERHRKQIADEIRYLELPPEWRPHEVIRYIVRIIEKNNG* |
| Ga0065166_100674762 | 3300004112 | Freshwater Lake | MEGLEKYLDERFRKQIADEIRYLELPPEWRPHEVIRYIVRMIENG* |
| Ga0065166_102657361 | 3300004112 | Freshwater Lake | VSIEEYQDERIRRQICNEISGLELPPEWRPYEVIRYIVRIIEKSNG* |
| Ga0065166_102927042 | 3300004112 | Freshwater Lake | MDDLGLYLDEKLRRQIADEIRYLELPPEWRPFEVIRYIVRIIEKNNG* |
| Ga0066178_100668205 | 3300004124 | Freshwater Lake | LYLDEKIRHQIADEIKYLELPPEWRPYEVIRYIVRIIEKNNG* |
| Ga0007787_103085361 | 3300004240 | Freshwater Lake | MDNLIEYLDENHRKKIADEIRYLELPPEWRPNEVIRYIVRIIEKNNG* |
| Ga0070374_100905481 | 3300005517 | Freshwater Lake | LGLYLDEKLRQEIADEIRYLELPPEWRPFEVIRYIVRIIEKK* |
| Ga0070374_103488411 | 3300005517 | Freshwater Lake | LNLYLDEKIRHQIADEIKYLELPPEWRPYEVIRYIVRIIEKNNG* |
| Ga0049083_100373842 | 3300005580 | Freshwater Lentic | MDKIEDYLDEKHRRKIADEIRYLELPPEWRPNEVIRYIVRIIEKSNG* |
| Ga0049083_103245572 | 3300005580 | Freshwater Lentic | MDKIVDYLDESHRKKIADEIRYLELPPEWRPNEVIRYIVRIIEK |
| Ga0049080_100876151 | 3300005582 | Freshwater Lentic | MDKIEDYLDERHRKQIVDEIRYLELPPEWRPNEVIRYIVRIIEKSNG* |
| Ga0049080_102351033 | 3300005582 | Freshwater Lentic | NRSMDKIEDYLDERHRKQIADEIRYLELPPEWRPNEVIRYIVRIIEKSNG* |
| Ga0049082_101170214 | 3300005584 | Freshwater Lentic | MDKLVEYLDENHRKKIADEIRYLELPPEWRPNEVIRYIVRIIEKSNG* |
| Ga0078894_100628706 | 3300005662 | Freshwater Lake | MDDLGLYLDEKLRRQIADEIRYLELPPEWRPFEVIRHIVRIIEKNNG* |
| Ga0078894_101032874 | 3300005662 | Freshwater Lake | VDYIKDKIRKDIADEIRYLELPPDWRPYEVIRYIVSKIEKGEQ* |
| Ga0078894_101093983 | 3300005662 | Freshwater Lake | MEELGLYLDEKLRRQIADEIRHLELPSEWRPFEVIRYIVRIIEKNNG* |
| Ga0078894_102647313 | 3300005662 | Freshwater Lake | MMDDLSIYLDEKIRQQIADEIRYLELPSEWRPFEVIRYIVRIIEKNNGQTPR* |
| Ga0078894_102647743 | 3300005662 | Freshwater Lake | MDGLEKYLDERFRKQIADEIRYLELPPEWRPQEVIRYIVRIIENG* |
| Ga0078894_103723211 | 3300005662 | Freshwater Lake | VEDIGLYLDEKLRRQIADEIRYLELPPEWRPFEVIRHI |
| Ga0078894_104995743 | 3300005662 | Freshwater Lake | MDDLGLYLDEKIRQEIADEIRYLELPPEWRPFEVIRYIVRIIEKNNGQTPR |
| Ga0078894_105047901 | 3300005662 | Freshwater Lake | MNDLIKYLDENHRKKIADEIRYLELPPEWRPNEVIRYIVRIIEKSNG* |
| Ga0078894_105971345 | 3300005662 | Freshwater Lake | MSIEEYQDERIRRQIANEIRGLELPPEWRPNEVIRYIVRIIEKNNG* |
| Ga0078894_106587041 | 3300005662 | Freshwater Lake | MDDLIKYLDENHRKKIADEIRYLELPPEWRPSEVIRYIVRIIEKNNG* |
| Ga0078894_106807422 | 3300005662 | Freshwater Lake | MNDLGLYLDEKLRQEIADEIRYLELPPEWRPFEVIRYIV |
| Ga0078894_106894025 | 3300005662 | Freshwater Lake | VSIEEYQDERIRRQISNEIKGLELPPEWRPNEVIRYIVRIIEKNNG* |
| Ga0078894_106908772 | 3300005662 | Freshwater Lake | MDDLGLYLDEKLRRQIADEIRYLELPPEWRPFEVIRYIVRIIEKQNG* |
| Ga0078894_107158753 | 3300005662 | Freshwater Lake | MDDLIKYLDENHRKKIADEIRYLELPPEWKPYEVIRYVVRIIEKQNG* |
| Ga0078894_112838102 | 3300005662 | Freshwater Lake | MDQLEKYLDERFRKQVADEIRYLELPPEWRPHEVIRYIVRIIENG* |
| Ga0078894_116111011 | 3300005662 | Freshwater Lake | MDDLGLYLDEKLRRQIADEIRYLELPPEWRPFEVIRYIVRIIEKK* |
| Ga0078894_117727542 | 3300005662 | Freshwater Lake | LGLYLDEKLRRQIADEIRYLELPPEWRPFEVIRHIVRIIEKNNGQAPR* |
| Ga0070743_1000027313 | 3300005941 | Estuarine | MGDLSTYLDEKIRQQIADEIRYLELPPEWRPFEVIRYIVRIIEKSNG* |
| Ga0070743_101974772 | 3300005941 | Estuarine | MEGLEKYLDERFRKQIADEIRYLELPPEWRPHEVIRYIVRIIENG* |
| Ga0073922_10459491 | 3300005955 | Sand | MDKIEDYLDERHRKEIADEIRYLELPPEWRPHEVIRYVVRIIEKSNG* |
| Ga0070744_100021162 | 3300006484 | Estuarine | MDDLIKYLDENHRKKIADEIRYLELPPEWRPNEVIRYIVRIIEKNNG* |
| Ga0070744_1000355613 | 3300006484 | Estuarine | MDKLAEYLDENHRKKIADEIRYLELPPEWKPYQVIRYIVRIIEKQNG* |
| Ga0070744_100439902 | 3300006484 | Estuarine | MDKIVDYLDESHRKKIADEIRYLELPPEWRPNEVIRYIVRIIEKNNG* |
| Ga0070744_100559381 | 3300006484 | Estuarine | MDNIEDYLDEKHRKKIADEIRYLELPPEWRPQEVIRYIVRIIEKSNG* |
| Ga0070744_100879101 | 3300006484 | Estuarine | VSMDKIEEYLDGSHRKKIADEIRYLELPPEWRPNEVIRYIVRIIEKNNG* |
| Ga0070744_101302972 | 3300006484 | Estuarine | MDKIEDYLDEKHRKKIADEIRYLELPPEWRPHEVIRYIVRIIEKSNG* |
| Ga0070744_101473541 | 3300006484 | Estuarine | MDKIEDYLDERHRKQIADEIRYLELPPEWRPHEVIRYIVRIIEKQNG* |
| Ga0075473_1000192514 | 3300006875 | Aqueous | MDYVQDIVRQKLADEIKYLELPPDWRPYEVIRYIVRIIENGQAPRQD* |
| Ga0075473_100159914 | 3300006875 | Aqueous | MDYIKDLLREQIADEVRYLELPPDWRPHEVIRYIVRMIEDGQAPRQN* |
| Ga0102874_10024495 | 3300007546 | Estuarine | MDDLGLYLDEKLRRQIADEIRHLELPPEWRPSEVIRYIVRIIEKNNGQTPR* |
| Ga0102874_10381093 | 3300007546 | Estuarine | MDKIEDYLDEKHRKKIADEIRYLELPPEWRPQEVIRYVVRIIEKSNG* |
| Ga0102879_10384962 | 3300007549 | Estuarine | MDKIEDYLDEKHRRKIADEIRYLELPPEWRPYEVIRYIVRIIEKSNG* |
| Ga0102879_11008412 | 3300007549 | Estuarine | MDKLAEYLDENHRKKIADEIRYLELPPEWKPYQVIRYIVRVIEKQNG* |
| Ga0102880_11070292 | 3300007550 | Estuarine | MDKIEDYLDEKHKKKIADEIRYLELPPEWRPQEVIRYVVRIIEKSNG* |
| Ga0102828_10166653 | 3300007559 | Estuarine | MYKIEDYLDEKHRKKIADEIRYLELPPEWRPNEVIRYVVRIIEKSNG* |
| Ga0102828_10446761 | 3300007559 | Estuarine | NRSMDKIEDYLDEKHRKKIADEIRYLELPPEWRPHEVIRYIVRIIEKSNG* |
| Ga0102828_10584091 | 3300007559 | Estuarine | MDKIEEYLDGSHRKKIADEIRYLELPPEWRPNEVIRYIVRIIEKNNG* |
| Ga0102913_10594352 | 3300007560 | Estuarine | MDKLAEYLDENHRKKIADEIRYLELPPEWKPYQVIRYIVRIIEKQNGKTPL* |
| Ga0102916_11529413 | 3300007585 | Estuarine | EDYLDEKHRRKIADEIRYLELPPEWRPYEVIRYIVRIIEKSNG* |
| Ga0102923_12823422 | 3300007606 | Estuarine | MGDLSTYLDEKIRQQIADEIRYLELPPEWRPFEVIRYIVR |
| Ga0102923_12831861 | 3300007606 | Estuarine | MDKLAEYLDENHRKKIADEIRYLELPPEWRPHEVIRYIVRIIEKSNG* |
| Ga0102897_11124812 | 3300007617 | Estuarine | MDDLGLYLDEKLRRQIADEIRHLELPPEWRPSEVIRYIVRIIEKNNG* |
| Ga0102871_10329212 | 3300007620 | Estuarine | MGDLSTYLDEKIRQQIADEIRYLELPPEWRPNEVIRYIVRIIEKSNG* |
| Ga0102872_11461591 | 3300007621 | Estuarine | MDKLAEYLDENHRKKIADEIRYLELPPEWKPYEVIRYIVRVIEKQNG* |
| Ga0102863_10490531 | 3300007622 | Estuarine | MDKIEDYLDEKHRKEIADEIRYLELPPEWRPHEVIRYVVRIIEQSNG* |
| Ga0102869_10251512 | 3300007627 | Estuarine | MDKIEDYLDEKHRKKIADEIRYLELPPEWRPHEVIRYVVRIIEKSNG* |
| Ga0102856_10621081 | 3300007636 | Estuarine | MDKIEDYLDERHRKKIADEIRYLELPPEWRPHEVIRYIVRIIEKSNG* |
| Ga0102902_10387182 | 3300007644 | Estuarine | MGDLSTYLDEKIRQQIANEIRYLELPPEWRPFEVIRYIVRIIEKSNG* |
| Ga0102855_10990101 | 3300007647 | Estuarine | MDKIEDYLDERHRKKIADEIRYLELPPEWRPHEVIRYIVRIIEKQNG* |
| Ga0102868_11510151 | 3300007653 | Estuarine | MDKIVEYLDENYRKKIADQIRYLELPPEWKPYEVIRYIVRIKEKQNG* |
| Ga0102899_10965862 | 3300007706 | Estuarine | MDKIEDYLDEKHRRKIADEIRYLELPPEWRPQEVIRYVVRIIEKSNG* |
| Ga0102859_12212041 | 3300007708 | Estuarine | VDFLEDHLRSKIADDIRYLELPPEWRPYEVIRYIVRKIEKKVEEDVKED* |
| Ga0102852_10756792 | 3300007718 | Estuarine | MDKIEDYLDEKHRKKIADEIRYLELPPEWRPHEVIRYIVRIIEKGNG* |
| Ga0105735_10988132 | 3300007860 | Estuary Water | MDKLVEYLDESYRKKIADQIRYLELPPEWKPYEVIRYIVRIIEKQNG* |
| Ga0105735_11256621 | 3300007860 | Estuary Water | MDKIEDYLDEKHRKKIADEIRYLELPPEWRPHEVIRYIVRIIEKSN |
| Ga0105737_11809851 | 3300007862 | Estuary Water | MDKLEEYLDGTHRKRIADEIRYLELPPEWRPHEVIRYIVRIIEKSNG* |
| Ga0105746_10962202 | 3300007973 | Estuary Water | MDKIVDYLDESHRKNIADEIRYLELPPEWRPNEVIRYIVRIIEKNNG* |
| Ga0108970_101587172 | 3300008055 | Estuary | MMDNLSLYLDEKLRSQIADEIRYLELPPEWRPFEVIRYIVRIIEKQNG* |
| Ga0114340_10173233 | 3300008107 | Freshwater, Plankton | MDELGLYLDEKLRRQIADEIRYLELPPEWRPFEVIRHIVRIIEKNNGQAPR* |
| Ga0114340_10494958 | 3300008107 | Freshwater, Plankton | VDYIKDKLRQQIADEIRYLELPPDWRPYEVIRYIVRKIEKGVQENVEEN* |
| Ga0114340_10520352 | 3300008107 | Freshwater, Plankton | MDKLIEYLDENHRRKIADEIRYLELPPEWRPYEVIRYIVGIIEKKNGQXXXXXXX* |
| Ga0114340_11029313 | 3300008107 | Freshwater, Plankton | MDNLEKYLDESHRKKIADEVRYLELPPEWRPQEVIRYIVRIIEKGTN* |
| Ga0114340_11527614 | 3300008107 | Freshwater, Plankton | MDYIEDRLRSKIADEIRYLELPPEWRPYEVIRYIVRMIEKNNGQAS* |
| Ga0114340_11741062 | 3300008107 | Freshwater, Plankton | MDDLGLYLDEKIRQEIADEIRYLELPPEWRPFEVIRYIVRIIEKNNGQT |
| Ga0114340_12407592 | 3300008107 | Freshwater, Plankton | MDDLGLYLDEKLRQEIADEIRYLELPPEWRPFEVIRYIVRIIEKNNGQT |
| Ga0114343_101875014 | 3300008110 | Freshwater, Plankton | MDDLGLYLDEKIRQKIADEIRYLELPPEWRPFEVIRYIVRIIEKNNGQTPR* |
| Ga0114343_10215863 | 3300008110 | Freshwater, Plankton | VSIEEYQDERIRRQISNEIRGLELPPEWRPSEVIRYIVRIIEKGV* |
| Ga0114344_100084721 | 3300008111 | Freshwater, Plankton | MDKLIEYLDESHRKKIADEIRYLELPPEWRPYEVIRYIVRIIEKQNG* |
| Ga0114346_10204242 | 3300008113 | Freshwater, Plankton | MDDLGLYLDEKIRRQIADEIRYLELPPEWRPFEVIRYIVRIIEKNNG* |
| Ga0114346_11258231 | 3300008113 | Freshwater, Plankton | MEDLGLYLDEKLRRQIADEIRYLELPSEWRPFEVIRYIVRIIEKNNGQTPR* |
| Ga0114336_100664616 | 3300008261 | Freshwater, Plankton | MDIEEYQDERIRRQISNEIRGLELPPEWRPHEVIRYIVRIIEKGV* |
| Ga0114336_10508462 | 3300008261 | Freshwater, Plankton | MDKLIEYLDENHRRKIADEIRYLELPPEWRPYEVIRYIVGIIEKKNGQTDVIISPLG* |
| Ga0114336_10894062 | 3300008261 | Freshwater, Plankton | VEDIGLYLDEKLRRQIADEIRYLELPPEWRPFEVIRHIVRIIEKNNG* |
| Ga0114337_10850452 | 3300008262 | Freshwater, Plankton | MDDLGLYLDEKIRQEIADEIRYLELPPEWRPFEVIRYIVRIIEKNNGQTPR* |
| Ga0102891_10881835 | 3300008950 | Estuarine | LDEKHRKKIADEIRYLELPPEWRPQEVIRYVVRIIEKSNG* |
| Ga0104241_10149623 | 3300008953 | Freshwater | MDNLTEYLHEKHRKKIADEIRYLELPPEWRPHEVIRYIVRIIEKNNG* |
| Ga0102887_12684772 | 3300008961 | Estuarine | MDKIEDYLDEKHRKKIADEIRYLELPPEWRPYEVIRYIVRIIEKSNG* |
| Ga0104242_10151582 | 3300008962 | Freshwater | MDDLSLYLDEKLRRQIADEIRYLELPPEWRPFEVIRHIVRIIEKHNG* |
| Ga0102831_10384752 | 3300008996 | Estuarine | MEDLGLYLDEKLRRQIADEIRHLELPSEWRPFEVIRYIVRIIEKNNG* |
| Ga0102831_11326072 | 3300008996 | Estuarine | MDGLEKYLDERFRKQIADEIRYLELPPEWRPHEVIRYIVRIIENG* |
| Ga0102831_12201811 | 3300008996 | Estuarine | RKFNMMDNLSLYLDEKLRSQIADEIRYLELPPEWRPFEVIRYIVRIIEKQNG* |
| Ga0102829_10412422 | 3300009026 | Estuarine | MDKIVDYLDESHRKKIADEIRYLELPPEWRPSEVIRYIVRIIEKNNG* |
| Ga0102860_10691032 | 3300009056 | Estuarine | MDKIEDYLDERHRKKIADEIRYLELPPEWRPHEVIRYIVRIIEKGNG* |
| Ga0102854_10392072 | 3300009058 | Estuarine | MDKIEDYLDEKHRRKIVDEIRYLELPPEWRPHEVIRYIVRIIEKSNG* |
| Ga0102815_102418541 | 3300009080 | Estuarine | MMDNLSLYLDEKLRSQIADEIRYLELPPEWRPFEVIRYIVRIIEKSNG* |
| Ga0114980_105575681 | 3300009152 | Freshwater Lake | MDKLVKYLDESYRKKIADQIRYLELPPDWKPYEVIRYIVRIIEKQNG* |
| Ga0114968_100540796 | 3300009155 | Freshwater Lake | MDKLVEYLDESYRKKIADQIRYLELPPDWKPYEVIRYIVRIIEKQNG* |
| Ga0114968_100908914 | 3300009155 | Freshwater Lake | MDKIVDYLDENHRKKIADEIRYLELPPEWRPYEVIRYIVRIIEKQNG* |
| Ga0114977_100699513 | 3300009158 | Freshwater Lake | MDKLAEYLDENHRKRIADEIRYLELPPEWKPYQVIRYIVRIIEKNNG* |
| Ga0114978_103819812 | 3300009159 | Freshwater Lake | MDKLAEYLDENHRKKIADEIRYLELPPEWKPYQVIRYIVRIIEKNNG* |
| Ga0114978_108304931 | 3300009159 | Freshwater Lake | EDYLDEKHRKKIADEIRYLELPPEWRPQEVIRYVVRIIEKSNG* |
| Ga0114966_101289692 | 3300009161 | Freshwater Lake | MDKIEEYLDGSHRKKIADEIRYLELPPEWKPYEVIRYIVRVIEKQNG* |
| Ga0114966_102472523 | 3300009161 | Freshwater Lake | MDDLIKYLDENHRKKIADEIRYLELPPEWRPYEVIRYIVRIIEKQNG* |
| Ga0114975_105594942 | 3300009164 | Freshwater Lake | MDKIVDYLDESHRKKIADEIRYLELPPEWRPHEVIRYIVRIIEKSNG* |
| Ga0114974_100659682 | 3300009183 | Freshwater Lake | MDKLVEYLDDNHRKKIADEIRYLELPPEWRPHEVIRYIVRIIEKNNG* |
| Ga0114974_102701521 | 3300009183 | Freshwater Lake | MDKLAEYLDENHRKKIADEIRYLELPPEWRPSEVIRYIVRIIEKNNG* |
| Ga0114974_104367552 | 3300009183 | Freshwater Lake | MGDLIKYLDENHRKKIADEIRYLELPPEWRPYEVIRYIVRIIEKNNG* |
| Ga0114974_105432241 | 3300009183 | Freshwater Lake | MDDLSIYLDEKIRQQIADEIRYLELPSEWRPFEVIRYIVWRIEKNNVQTPR* |
| Ga0114974_106294342 | 3300009183 | Freshwater Lake | MSIEEYQDERIRRQISNEISGLELPPEWRPYEVIRYIVRIIEKSNG* |
| Ga0114983_10505851 | 3300009194 | Deep Subsurface | MDNIEDYLDERHRKQIADEIRYLELPPEWRPHEVIRYI |
| Ga0114983_10717912 | 3300009194 | Deep Subsurface | MDKIQDYLDEKHRKKIADEIRYLELPPEWRPNEVIRYIVRIIEKNNG* |
| Ga0114982_100215716 | 3300009419 | Deep Subsurface | MEKIQDYLDEKHRKKIADEIRYLELPPEWRPYEVIRYIVRIIEKQNG* |
| Ga0114982_10076098 | 3300009419 | Deep Subsurface | MDSIEKYLDGSHRKKIADEIRYLELPPEWRPHEVIKYIVRIIEKNNGIN* |
| Ga0114982_10392642 | 3300009419 | Deep Subsurface | MDKIEDYLDERHRKQIADEIRYLELPPEWRPNEVIRYIVRIIEKSNG* |
| Ga0114982_10410862 | 3300009419 | Deep Subsurface | MDNIEDYLDERHRKQIADEIRYLELPPEWRPHEVIRYIVRIIEKQNG* |
| Ga0102883_10239211 | 3300010312 | Estuarine | IMDDLGLYLDEKLRRQIADEIRHLELPPEWRPSEVIRYIVRIIEKNNGQTPR* |
| Ga0114986_10568522 | 3300010374 | Deep Subsurface | MDKIEDYLDERHRKQIADEIRYLELPPEWRPNEVIRYIVR |
| Ga0114986_10753781 | 3300010374 | Deep Subsurface | MDNIEDYLDEGHRKQIADEIRYLELPPEWRPYEVIRYIVRKIENG* |
| Ga0114986_10930122 | 3300010374 | Deep Subsurface | MDKIQDYLDEKHRKKIADEIRYLELPPEWRPNEVIRYI |
| Ga0151516_1110714 | 3300011116 | Freshwater | MDKLADYLDENHRKKIADEIRYLELPPEWRPSEVIRYIVRIIEKNNG* |
| Ga0119951_100910213 | 3300012000 | Freshwater | MDDLIKYLDENHRKKIADEIRYLELPPEWRPYEVIRYIVRIIEKNNG* |
| Ga0153801_10361362 | 3300012017 | Freshwater | MDKIEDYLDENHRRKIVDEIRYLELPPEWRPHEVIRYIVRIIEKSNG* |
| Ga0157203_100183816 | 3300012663 | Freshwater | MDKLAEYLDESHRKKIADEVRYLELPPEWKPYQVIQYIVRIIEKQNG* |
| Ga0157203_10234463 | 3300012663 | Freshwater | MDKIEQYFDGSHRKRIADEIRHLELPPEWRPHEVIRYVVRIIEKNNG* |
| Ga0157623_11004141 | 3300012707 | Freshwater | VSIEEYQDERIRRQISNEISGLELPPEWRPNEVIRYIVR |
| Ga0157611_10307981 | 3300012724 | Freshwater | DYLDERHRKQIADEIRYLELPPEWRPNEVIRYIVRIIEKSNG* |
| Ga0164293_104420512 | 3300013004 | Freshwater | MDKIEDYLDERHRKQIADEIRYLELPPEWRPHEVIRYIVRIIEKSNG* |
| Ga0164292_104246152 | 3300013005 | Freshwater | MSIEEYQDERIRRQIANEIRGLELPPEWRPNEVIRYIVRIIE |
| Ga0181343_10914232 | 3300017766 | Freshwater Lake | VDYIKDKIRKDIADEIRYLELPPDWRPYEVIRYIVSKIEKG |
| Ga0181358_11918782 | 3300017774 | Freshwater Lake | MDKIEDYLDEKHRRKIADEIRYLELPPEWRPHEVIRYIVRIIEKK |
| Ga0181346_11703731 | 3300017780 | Freshwater Lake | LDEKHRRKIADEIRYLELPPEWRPNEVIRYIVRIIEKSNG |
| Ga0181359_11617002 | 3300019784 | Freshwater Lake | MDKLVEYLDESYRKKIADQIRYLELPPDWKPYEVIRYIVRIIEKNNG |
| Ga0181359_12028952 | 3300019784 | Freshwater Lake | MDKIEDYLDEKHRRKIADEIRYLELPPEWRPHEVIRYIVRIIEKSNG |
| Ga0207193_10164302 | 3300020048 | Freshwater Lake Sediment | MDNLIEYLDENHRKKIADEIRYLELPPEWRPNEVIRYIVRIIEKNNG |
| Ga0211732_10396024 | 3300020141 | Freshwater | MDDLIKYLDENHRKKIADEIRYLELPPEWKPYEVIRYIVRIIEKQNG |
| Ga0211732_106130161 | 3300020141 | Freshwater | MDSIEKYLDGSHRKKIADEIRYLELPPEWRPHEVIKYIVRIIEKNNGIN |
| Ga0211732_13919071 | 3300020141 | Freshwater | EKHRKKIADEIRYLELPPEWRPHEVIRYIVRIIEKGNG |
| Ga0211736_103486512 | 3300020151 | Freshwater | MDKLAEYLDENHRKKIADEIRYLELPPEWKPSQVIQYIVRVIEKK |
| Ga0211734_109856352 | 3300020159 | Freshwater | VSIEEYQDERIRRQISNEIKGLELPPEWRPNEVIRYIVRII |
| Ga0211734_110518445 | 3300020159 | Freshwater | MYLDEKVRKQIADEIRFLELPSEWRPFEVIRYIVRIIEKNNGQTPR |
| Ga0211733_105863873 | 3300020160 | Freshwater | MDNISEYLDGSHRKKIADEIRYLELPPEWRPHEVIRYVVRIIEKNNG |
| Ga0211726_100959416 | 3300020161 | Freshwater | VSIEEYQDERIRRQISNEIRGLELPPEWRPNEVIRYIVRIIERSNG |
| Ga0211726_102094472 | 3300020161 | Freshwater | VSIEEYQDERIRRQISNEIKGLELPPEWRPNEVIRYIVRIIEKSNG |
| Ga0211729_103065042 | 3300020172 | Freshwater | MDKLVEYLDENHRKKIADEIRYLELPPEWRPNEVIRYIVRIIEKNNG |
| Ga0211729_103067872 | 3300020172 | Freshwater | MDKLAEYLDENHRKKIADEIRYLELPPEWKPYEVIRYVVRIIEKQNG |
| Ga0211729_106683332 | 3300020172 | Freshwater | VSIEEYQDERIRRQISNEIKGLELPPEWRPNEVIRYIVRIIERSNG |
| Ga0208200_1004404 | 3300020487 | Freshwater | MDKLIEYLDENHRKKIADEIRYLELPPEWRPHEVIRYIVRIIEKQNGQTPR |
| Ga0208223_10081375 | 3300020519 | Freshwater | MDKIEDYLDERHRKQIADEIRYLELPPEWRPHEVIRYIVRIIEKSNG |
| Ga0194048_100427173 | 3300021519 | Anoxic Zone Freshwater | MDKIEKYLDGSHRKRIADEIRYLELPPEWRPSEVIKYIVRIIEKNNG |
| Ga0194060_101515441 | 3300021602 | Anoxic Zone Freshwater | MDDLIKYLDENHRKKIADEIRYLELPPEWRPSEVIRYIVRIIEKNNG |
| Ga0222714_105038202 | 3300021961 | Estuarine Water | MDNLEKYLDENHRKKIADEVRYLELPPEWRPQEVIRYIVRIIEKGTN |
| Ga0222713_100207889 | 3300021962 | Estuarine Water | LEDHLRAKIADEIRYLELPPEWRPYEVIRYIVRKIEKGVPQDVQED |
| Ga0222713_100314241 | 3300021962 | Estuarine Water | MDNLEKYLDESHRKKIADEVRYLELPPEWRPQEVIRYIVRIIEKGTN |
| Ga0222713_100966344 | 3300021962 | Estuarine Water | MDKIEEYLDGSHRKKIADEIRYLELPPEWRPHEVIRYIVRIIEKSNG |
| Ga0222713_102947123 | 3300021962 | Estuarine Water | MDKIEDYLDEKHRKKIADEIRYLELPPEWKPYQVIRYIVRIIEKQNG |
| Ga0222713_103913272 | 3300021962 | Estuarine Water | MDKLAEYLDENHRKKIADEIRYLELPPEWKPYQVIRYIVRVIEKQNG |
| Ga0222712_105019222 | 3300021963 | Estuarine Water | MDKIEDYLDEKHRRKIADEIRYLELPPEWRPNEVIRYIVRIIEKSNG |
| Ga0181351_12219103 | 3300022407 | Freshwater Lake | MDKIEDYLDERHRKQIADEIRYLELPPEWRPNEVIRYIVRIIEKSNG |
| Ga0181351_12357892 | 3300022407 | Freshwater Lake | MNDLGLYLDEKLRQEIADEIRYLELPPEWRPFEVIRYIVRIIEKNNGQTPR |
| Ga0214921_1000145265 | 3300023174 | Freshwater | MDNLTEYLHEKHRKKIADEIRYLELPPEWRPHEVIRYIVRIIEKNNG |
| Ga0214921_1001120317 | 3300023174 | Freshwater | MDKLIEYLDDTHRKKIADEIRYLELPPEWRPHEVIRYIVRIIEKNNG |
| Ga0214921_100155229 | 3300023174 | Freshwater | MDKIEDYLDEKHRKKIADEIRYLELPPEWRPHEVIGYIVRIIEKSNG |
| Ga0214921_100163372 | 3300023174 | Freshwater | MDKIEEYLDGSHRKKIADEIRYLELPPEWRPYEVIRYIVRIIEKNNG |
| Ga0214921_1001701515 | 3300023174 | Freshwater | MDDLIKYLDENHRKKIADEIRYLELPPEWRPYEVIRYILRIIEKNNG |
| Ga0214921_1002602817 | 3300023174 | Freshwater | MDKLTEYLHENHRKKIADEIRYLELPPEWRPSEVIRYIVRIIEKNNG |
| Ga0214921_1003211213 | 3300023174 | Freshwater | MDKIVDYLDESHRKKIADEIRYLELPPEWRPNEVIRYIVRIIEKNNG |
| Ga0214921_100820522 | 3300023174 | Freshwater | MDDLIKYLDENHRKKIADEIRYLELPPEWRPYEVIRYIVRIIEKNNG |
| Ga0214921_100981875 | 3300023174 | Freshwater | MNKIEDYLDERHRKQIADEIRYLELPPEWRPSEVIRYIVRIIEKNNG |
| Ga0214921_101117916 | 3300023174 | Freshwater | MDKIEDYLDEKHRKKIADEIRYLELPPEWRPNEVIRYIVRIIEKSNG |
| Ga0214921_102707632 | 3300023174 | Freshwater | MDDLINYLDENHRKKIADEIRYLELPPEWRPNEVIRYIVRIIEKNNG |
| Ga0214921_104789492 | 3300023174 | Freshwater | MDKLVEYLDESYRKKIADQIRYLELPPDWKPYEVIRYIVRIIEKQNG |
| Ga0244777_1000008093 | 3300024343 | Estuarine | MDDLGLYLDEKLRRQIADEIRHLELPPEWRPSEVIRYIVRIIEKNNGQTPR |
| Ga0244777_100652692 | 3300024343 | Estuarine | MGDLSTYLDEKIRQQIADEIRYLELPPEWRPFEVIRYIVRIIEKSNG |
| Ga0244777_106926461 | 3300024343 | Estuarine | MDKIEDYLDEKHRKKIADEIRYLELPPEWRPHEVIRYIVRIIEKSNG |
| Ga0244775_1000708519 | 3300024346 | Estuarine | MDDLIKYLDENHRKKIADEIRYLELPPEWRPNEVIRYIVRIIEKNNG |
| Ga0244775_100237134 | 3300024346 | Estuarine | MDKLAEYLDENHRKKIADEIRYLELPPEWKPYQVIRYIVRIIEKQNG |
| Ga0244775_100255364 | 3300024346 | Estuarine | MEDLGLYLDEKLRRQIADEIRHLELPSEWRPFEVIRYIVRIIEKNNG |
| Ga0244775_100303028 | 3300024346 | Estuarine | MDKIEDYLDEKHRKKIADEIRYLELPPEWRPQEVIRYVVRIIEKSNG |
| Ga0244775_100450982 | 3300024346 | Estuarine | MDKIEDYLDERHRKKIADEIRYLELPPEWRPYEVIRYIVRIIEKQNG |
| Ga0244775_101793681 | 3300024346 | Estuarine | MDGLEKYLDERFRKQIADEIRYLELPPEWRPHEVIRYIVRIIENG |
| Ga0244775_102794952 | 3300024346 | Estuarine | MDNLEKYLDENHRKKITDEIRYLELPPEWKPQEVIRYIVRIIEKGTN |
| Ga0244775_104620803 | 3300024346 | Estuarine | MDKLVEYLDENHRKKIADEIRYLELPPEWRPNEVIRYIVRIIEKSNG |
| Ga0244775_106301174 | 3300024346 | Estuarine | MDKIEDYLDERHRKQIADEIRYLELPPEWRPHEVIRYIVRIIEKQNG |
| Ga0244776_108548742 | 3300024348 | Estuarine | MDKIVEYLDENYRKKIADQIRYLELPPEWKPYEVIRYIVRIIEKQNG |
| Ga0208147_10148965 | 3300025635 | Aqueous | MDYIKDLLREQIADEVRYLELPPDWRPHEVIRYIVRMIEDGQAPRQN |
| Ga0255074_10169791 | 3300027121 | Freshwater | MMDNLSLYLDEKLRSQIADEIRYLELPPEWRPFEVIRYIVRIIEKQNG |
| Ga0255074_10440513 | 3300027121 | Freshwater | DKLVEYLDESYRKKIADQIRYLELPPEWKPYEVIRYIVRIIEKQNG |
| Ga0255071_10208936 | 3300027127 | Freshwater | SIEEYQDERIRRQISNEIRGLELPPEWRPHEVIRYIVRIIEKGNG |
| Ga0255066_10040511 | 3300027131 | Freshwater | EEYQDERIRRQISNEIRGLELPPEWRPHEVIRYIVRIIEKGNG |
| Ga0255066_10101172 | 3300027131 | Freshwater | MDKLVEYLDESYRKKIADQIRYLELPPEWKPYEVIRYIVRIIEKQNG |
| Ga0255069_10337053 | 3300027134 | Freshwater | IEEYQDERIRRQISNEIRGLELPPEWRPHEVIRYIVRIIEKGNG |
| Ga0255080_10683372 | 3300027140 | Freshwater | MSIEEYQDERIRRQISNEIRGLELPPEWRPHEVIRYIVRIIEKGNGX |
| Ga0255111_10061071 | 3300027154 | Freshwater | MDKLIEYLDENHRRKIADEIRYLELPPEWRPYEVIR |
| Ga0208554_10031535 | 3300027212 | Estuarine | MDKIEDYLDERHRKKIADEIRYLELPPEWRPHEVIRYIVRIIEKSNG |
| Ga0208806_10217922 | 3300027242 | Estuarine | MDKIEDYLDEKHRRKIADEIRYLELPPEWRPYEVIRYIVRIIEKSNG |
| Ga0208173_10665281 | 3300027244 | Estuarine | IMDDLGLYLDEKLRRQIADEIRHLELPPEWRPSEVIRYIVRIIEKNNGQTPR |
| Ga0208933_10099482 | 3300027261 | Estuarine | MDKIEDYLDERHRKEIADEIRYLELPPEWRPHEVIRYVVRIIEKSNG |
| Ga0208439_10272082 | 3300027278 | Estuarine | MEGLEKYLDERFRKQIADEIRYLELPPEWRPHEVIRYIVRMIENG |
| Ga0255129_10199252 | 3300027286 | Freshwater | MDKLIEYLDENHRRKIADEIRYLELPPEWRPYEVI |
| Ga0255132_10358941 | 3300027293 | Freshwater | MDKLIEYLDENHRRKIADEIRYLELPPEWRPYEVIRYIVGIIEKKNGQTSRQ |
| Ga0208812_11176881 | 3300027311 | Estuarine | ERHRKKIADEIRYLELPPEWRPHEVIRYIVRIIEKSNG |
| Ga0208682_10307911 | 3300027531 | Estuarine | YLDEKLRRQIADEIRHLELPPEWRPSEVIRYIVRIIEKNNGQTPR |
| Ga0209552_10268581 | 3300027563 | Freshwater Lake | MDKIEDYLDEKHRRKIADEIRYLELPPEWRPHEVIR |
| Ga0209552_10390184 | 3300027563 | Freshwater Lake | MDKLVEYLDENHRKKIADEIRYLELPPEWKPYEVIRYIVRVIEKQNG |
| Ga0209651_10226351 | 3300027581 | Freshwater Lake | LNLYLDEKIRHQIADEIKYLELPPEWRPYEVIRYIVRIIEKNNG |
| Ga0209651_10577161 | 3300027581 | Freshwater Lake | SNIMDDLGLYLDEKLRRQIADEIRYLELPPEWRPFEVIRYIVRIIEKQNG |
| Ga0208966_10250158 | 3300027586 | Freshwater Lentic | YLDEKHRRKIADEIRYLELPPEWRPHEVIRYIVRIIEKSNG |
| Ga0255120_10733571 | 3300027594 | Freshwater | YLDENHRRKIADEIRYLELPPEWRPYEVIRYIVGIIEKKNGQASRQN |
| Ga0255088_10348641 | 3300027597 | Freshwater | MDKIEDYLDERHRKQIVDEIRYLELPPEWRPNEVIRYI |
| Ga0208133_10824963 | 3300027631 | Estuarine | MDKLVEYLDESYRKKIADQIRYLELPPEWKPQEVIRYIVRIIEKGTN |
| Ga0209356_10085471 | 3300027644 | Freshwater Lake | MADLNLYLDEKIRHQIADEIKYLELPPEWRPYEVIRYIVRIIEKNNG |
| Ga0209356_10257952 | 3300027644 | Freshwater Lake | MDDLGLYLDEKLRRQIADEIRYLELPPEWRPFEVIRYIVRIIEKQNG |
| Ga0209357_10130391 | 3300027656 | Freshwater Lake | FNIMADLNLYLDEKIRHQIADEIKYLELPPEWRPYEVIRYIVRIIEKNNG |
| Ga0209551_10431802 | 3300027689 | Freshwater Lake | MNDLGLYLDEKLRQEIADEIRYLELPPEWRPFEVIRYIVRIIEKK |
| Ga0209188_10413674 | 3300027708 | Freshwater Lake | MDKIEDYLDEKHRKKIADEIRYLELPPEWRPYEVIRYIVRIIEKSNG |
| Ga0209599_1000131716 | 3300027710 | Deep Subsurface | MEKIQDYLDEKHRKKIADEIRYLELPPEWRPYEVIRYIVRIIEKQNG |
| Ga0209599_1000195119 | 3300027710 | Deep Subsurface | MDKIQDYLDEKHRKKIADEIRYLELPPEWRPNEVIRYIVRIIEKNNG |
| Ga0209599_1000438310 | 3300027710 | Deep Subsurface | MDNIEDYLDERHRKQIADEIRYLELPPEWRPHEVIRYIVRIIEKQNG |
| Ga0209599_100054702 | 3300027710 | Deep Subsurface | MDDLGLYLDEKLRQEIADEIRYLELPPEWRPFEVIRYIVRIIEKNNGQTPR |
| Ga0209087_12961541 | 3300027734 | Freshwater Lake | MDDLIKYLDENHRKKIADEIRYLQLPPEWRPSEVIRYIVRIIEKNNG |
| Ga0209596_100165731 | 3300027754 | Freshwater Lake | MDKIVDYLDENHRKKIADEIRYLELPPEWRPYEVIRYIVRIIEKQNG |
| Ga0209444_101454974 | 3300027756 | Freshwater Lake | MDNLAEYLDEKQRKKIADEIRYLELPPEWKPYEVIRYIVRIIEKNNG |
| Ga0209444_102823762 | 3300027756 | Freshwater Lake | MDKLVEYLDESYRKKIADQIRYLELPPEWKPYEVIRYI |
| Ga0209296_101307215 | 3300027759 | Freshwater Lake | MDKLAEYLDENHRKKIADEIRYLELPPEWKPYQVIRYIVRIIEKNNG |
| Ga0209296_10212146 | 3300027759 | Freshwater Lake | MDKLVEYLDDNHRKKIADEIRYLELPPEWRPHEVIRYIVRIIEKNNG |
| Ga0209296_10758622 | 3300027759 | Freshwater Lake | MDKIVDYLDESHRKKIADEIRYLELPPEWRPHEVIRYIVRIIEKNNG |
| Ga0209296_12480402 | 3300027759 | Freshwater Lake | MGDLIKYLDENHRKKIADEIRYLELPPEWRPYEVIRYIVRIIEKNNG |
| Ga0209770_101371072 | 3300027769 | Freshwater Lake | MSIEEYQDERIRRQIANEIRGLELPPEWRPNEVIRYIVRIIEKQNG |
| Ga0209770_101737953 | 3300027769 | Freshwater Lake | VDYIKDKIRKDIADEIRYLELPPDWRPYEVIRYIVSKIEKGEQ |
| Ga0209086_100426048 | 3300027770 | Freshwater Lake | IVDYLDENHRKKIADEIRYLELPPEWRPYEVIRYIVRIIEKQNG |
| Ga0209086_100675144 | 3300027770 | Freshwater Lake | MDDLIKYLDENHRKKIADEIRYLELPPEWRPYEVIRYIVRIIEKQNG |
| Ga0209086_103852742 | 3300027770 | Freshwater Lake | MDKIEEYLDGSHRKKIADEIRYLELPPEWKPYEVIRYIVRVIEKQNG |
| Ga0209229_101890941 | 3300027805 | Freshwater And Sediment | VDFLEDHLRSKIADDIRYLELPPEWRPYEVIRYIVRKIEKKVEQ |
| Ga0209229_103990773 | 3300027805 | Freshwater And Sediment | DFLEDHLRSKIADDIRYLELPPEWRPYEVIRYIVRKIEKKVEQDVKED |
| Ga0209550_100598601 | 3300027892 | Freshwater Lake | ADLNLYLDEKIRHQIADEIKYLELPPEWRPYEVIRYIVRIIEKNNG |
| Ga0209550_100800192 | 3300027892 | Freshwater Lake | MDNLEKYLDENHRKKIADEIRYLELPPEWKPQEVIRYIVRIIEKGTN |
| Ga0209550_102564582 | 3300027892 | Freshwater Lake | MEQLEKYLDERFRKQVADEIRYLELPPEWRPHEVIRYIVRIIENG |
| Ga0209550_105164802 | 3300027892 | Freshwater Lake | MSIEEYQDERIRRQIANEIRGLELPPEWRPNEVIRYIV |
| Ga0209550_105903422 | 3300027892 | Freshwater Lake | MDKIADYLDESHRKKIADEIRYLELPPEWRPHEVIRYVVRIIEKNNG |
| Ga0209550_108050572 | 3300027892 | Freshwater Lake | MDKLIEYLDENHRRKIADEIRYLELPPEWRPYEVIRYIVGIIEK |
| Ga0209400_101084213 | 3300027963 | Freshwater Lake | MDDLGLYLDEKLRRQIADEIRYLELPPEWRPFEVIRYIVRIIEKNNG |
| Ga0247723_100057646 | 3300028025 | Deep Subsurface Sediment | MNNIEDYLDERHRKQIADEIRYLELPPEWRPHEVIRYIVRIIEKQNG |
| Ga0334987_0160740_962_1117 | 3300034061 | Freshwater | MDKLIEYLDENHRKKIADEIKYLELPPEWRPHEVIRYIVRIIEKQNGQTPR |
| Ga0335029_0663753_97_237 | 3300034102 | Freshwater | MMDGLDKYLDERFRKQIADEVRYLELPPEWRPHEVIRYIVRIIENG |
| Ga0335036_0696999_495_602 | 3300034106 | Freshwater | MNKIEDYLDERHRKQIADEIRYLELPPEWTPSEVIR |
| ⦗Top⦘ |