| Basic Information | |
|---|---|
| Family ID | F013928 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 267 |
| Average Sequence Length | 41 residues |
| Representative Sequence | MGYSVVNVEEIEGAGPGGAVRFVRRELGLEAFGINWFEL |
| Number of Associated Samples | 221 |
| Number of Associated Scaffolds | 267 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 77.90 % |
| % of genes near scaffold ends (potentially truncated) | 97.38 % |
| % of genes from short scaffolds (< 2000 bps) | 94.76 % |
| Associated GOLD sequencing projects | 212 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.57 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (65.169 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (16.479 % of family members) |
| Environment Ontology (ENVO) | Unclassified (26.592 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (50.562 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 16.42% β-sheet: 10.45% Coil/Unstructured: 73.13% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.57 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 267 Family Scaffolds |
|---|---|---|
| PF01039 | Carboxyl_trans | 56.93 |
| PF08327 | AHSA1 | 6.37 |
| PF02504 | FA_synthesis | 3.00 |
| PF04237 | YjbR | 3.00 |
| PF00324 | AA_permease | 2.25 |
| PF01022 | HTH_5 | 1.87 |
| PF00117 | GATase | 1.12 |
| PF00482 | T2SSF | 1.12 |
| PF00171 | Aldedh | 0.75 |
| PF01783 | Ribosomal_L32p | 0.75 |
| PF12840 | HTH_20 | 0.75 |
| PF13520 | AA_permease_2 | 0.75 |
| PF07676 | PD40 | 0.75 |
| PF02274 | ADI | 0.75 |
| PF00701 | DHDPS | 0.75 |
| PF00296 | Bac_luciferase | 0.75 |
| PF13365 | Trypsin_2 | 0.37 |
| PF04545 | Sigma70_r4 | 0.37 |
| PF01391 | Collagen | 0.37 |
| PF07883 | Cupin_2 | 0.37 |
| PF01872 | RibD_C | 0.37 |
| PF13649 | Methyltransf_25 | 0.37 |
| PF13738 | Pyr_redox_3 | 0.37 |
| PF01547 | SBP_bac_1 | 0.37 |
| PF13529 | Peptidase_C39_2 | 0.37 |
| PF00393 | 6PGD | 0.37 |
| PF01471 | PG_binding_1 | 0.37 |
| PF03176 | MMPL | 0.37 |
| PF06974 | WS_DGAT_C | 0.37 |
| PF08803 | ydhR | 0.37 |
| PF02311 | AraC_binding | 0.37 |
| PF04226 | Transgly_assoc | 0.37 |
| PF00027 | cNMP_binding | 0.37 |
| PF13646 | HEAT_2 | 0.37 |
| PF04542 | Sigma70_r2 | 0.37 |
| PF00353 | HemolysinCabind | 0.37 |
| PF00571 | CBS | 0.37 |
| PF00583 | Acetyltransf_1 | 0.37 |
| PF00614 | PLDc | 0.37 |
| PF00120 | Gln-synt_C | 0.37 |
| PF00756 | Esterase | 0.37 |
| COG ID | Name | Functional Category | % Frequency in 267 Family Scaffolds |
|---|---|---|---|
| COG4799 | Acetyl-CoA carboxylase, carboxyltransferase component | Lipid transport and metabolism [I] | 56.93 |
| COG0777 | Acetyl-CoA carboxylase beta subunit | Lipid transport and metabolism [I] | 56.93 |
| COG0825 | Acetyl-CoA carboxylase alpha subunit | Lipid transport and metabolism [I] | 56.93 |
| COG2315 | Predicted DNA-binding protein with ‘double-wing’ structural motif, MmcQ/YjbR family | Transcription [K] | 3.00 |
| COG0416 | Acyl-ACP:phosphate acyltransferase (fatty acid/phospholipid biosynthesis) | Lipid transport and metabolism [I] | 3.00 |
| COG0531 | Serine transporter YbeC, amino acid:H+ symporter family | Amino acid transport and metabolism [E] | 2.25 |
| COG0833 | Amino acid permease | Amino acid transport and metabolism [E] | 2.25 |
| COG1115 | Na+/alanine symporter | Amino acid transport and metabolism [E] | 2.25 |
| COG1113 | L-asparagine transporter or related permease | Amino acid transport and metabolism [E] | 2.25 |
| COG0329 | 4-hydroxy-tetrahydrodipicolinate synthase/N-acetylneuraminate lyase | Cell wall/membrane/envelope biogenesis [M] | 1.50 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 0.75 |
| COG1834 | N-Dimethylarginine dimethylaminohydrolase | Amino acid transport and metabolism [E] | 0.75 |
| COG2235 | Arginine deiminase | Amino acid transport and metabolism [E] | 0.75 |
| COG4230 | Delta 1-pyrroline-5-carboxylate dehydrogenase | Amino acid transport and metabolism [E] | 0.75 |
| COG1012 | Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenase | Lipid transport and metabolism [I] | 0.75 |
| COG4874 | Uncharacterized conserved protein | Function unknown [S] | 0.75 |
| COG0333 | Ribosomal protein L32 | Translation, ribosomal structure and biogenesis [J] | 0.75 |
| COG0014 | Gamma-glutamyl phosphate reductase | Amino acid transport and metabolism [E] | 0.75 |
| COG2409 | Predicted lipid transporter YdfJ, MMPL/SSD domain, RND superfamily | General function prediction only [R] | 0.37 |
| COG2261 | Uncharacterized membrane protein YeaQ/YmgE, transglycosylase-associated protein family | General function prediction only [R] | 0.37 |
| COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 0.37 |
| COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 0.37 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.37 |
| COG1502 | Phosphatidylserine/phosphatidylglycerophosphate/cardiolipin synthase | Lipid transport and metabolism [I] | 0.37 |
| COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 0.37 |
| COG1033 | Predicted exporter protein, RND superfamily | General function prediction only [R] | 0.37 |
| COG1023 | 6-phosphogluconate dehydrogenase (decarboxylating) | Carbohydrate transport and metabolism [G] | 0.37 |
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 0.37 |
| COG0362 | 6-phosphogluconate dehydrogenase | Carbohydrate transport and metabolism [G] | 0.37 |
| COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 0.37 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 70.41 % |
| Unclassified | root | N/A | 29.59 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2065487018|GPINP_F5MS3JC02IQTGS | Not Available | 513 | Open in IMG/M |
| 2067725001|GPWNP_F5MPXY301ECW5N | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 500 | Open in IMG/M |
| 2170459017|G14TP7Y02HCD7X | Not Available | 569 | Open in IMG/M |
| 3300000579|AP72_2010_repI_A01DRAFT_1018163 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1054 | Open in IMG/M |
| 3300000837|AP72_2010_repI_A100DRAFT_1029403 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 770 | Open in IMG/M |
| 3300000880|AL20A1W_1262663 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 525 | Open in IMG/M |
| 3300000956|JGI10216J12902_111822639 | Not Available | 636 | Open in IMG/M |
| 3300001535|A3PFW1_10059829 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 604 | Open in IMG/M |
| 3300001538|A10PFW1_12429451 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 568 | Open in IMG/M |
| 3300001686|C688J18823_10811811 | Not Available | 594 | Open in IMG/M |
| 3300002568|C688J35102_118606448 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 576 | Open in IMG/M |
| 3300002568|C688J35102_119402691 | All Organisms → cellular organisms → Eukaryota | 688 | Open in IMG/M |
| 3300004081|Ga0063454_100953505 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 684 | Open in IMG/M |
| 3300004081|Ga0063454_101173517 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 633 | Open in IMG/M |
| 3300004114|Ga0062593_100551342 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1085 | Open in IMG/M |
| 3300004114|Ga0062593_101208803 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 794 | Open in IMG/M |
| 3300004153|Ga0063455_100988708 | Not Available | 608 | Open in IMG/M |
| 3300004153|Ga0063455_101448357 | Not Available | 533 | Open in IMG/M |
| 3300004156|Ga0062589_101853493 | Not Available | 607 | Open in IMG/M |
| 3300004156|Ga0062589_102839058 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 506 | Open in IMG/M |
| 3300004479|Ga0062595_101518981 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 619 | Open in IMG/M |
| 3300005093|Ga0062594_100674790 | All Organisms → cellular organisms → Bacteria | 926 | Open in IMG/M |
| 3300005158|Ga0066816_1027519 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 508 | Open in IMG/M |
| 3300005175|Ga0066673_10562319 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 667 | Open in IMG/M |
| 3300005175|Ga0066673_10888019 | Not Available | 507 | Open in IMG/M |
| 3300005176|Ga0066679_10688703 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 663 | Open in IMG/M |
| 3300005327|Ga0070658_11462750 | Not Available | 593 | Open in IMG/M |
| 3300005332|Ga0066388_102277662 | Not Available | 980 | Open in IMG/M |
| 3300005334|Ga0068869_101972530 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 524 | Open in IMG/M |
| 3300005339|Ga0070660_100557184 | Not Available | 956 | Open in IMG/M |
| 3300005339|Ga0070660_101598942 | Not Available | 555 | Open in IMG/M |
| 3300005345|Ga0070692_10550797 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 756 | Open in IMG/M |
| 3300005356|Ga0070674_100458328 | Not Available | 1054 | Open in IMG/M |
| 3300005436|Ga0070713_101376923 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 684 | Open in IMG/M |
| 3300005457|Ga0070662_100978933 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 724 | Open in IMG/M |
| 3300005468|Ga0070707_100299908 | All Organisms → cellular organisms → Eukaryota | 1561 | Open in IMG/M |
| 3300005471|Ga0070698_101371837 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 657 | Open in IMG/M |
| 3300005471|Ga0070698_101421598 | All Organisms → cellular organisms → Bacteria | 645 | Open in IMG/M |
| 3300005535|Ga0070684_100086530 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2781 | Open in IMG/M |
| 3300005542|Ga0070732_10338888 | All Organisms → cellular organisms → Bacteria | 904 | Open in IMG/M |
| 3300005553|Ga0066695_10245472 | Not Available | 1130 | Open in IMG/M |
| 3300005553|Ga0066695_10549622 | Not Available | 702 | Open in IMG/M |
| 3300005557|Ga0066704_10289804 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1108 | Open in IMG/M |
| 3300005564|Ga0070664_101093300 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 751 | Open in IMG/M |
| 3300005564|Ga0070664_101122964 | Not Available | 741 | Open in IMG/M |
| 3300005564|Ga0070664_101556494 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → Pseudonocardia spinosispora | 626 | Open in IMG/M |
| 3300005574|Ga0066694_10281724 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 790 | Open in IMG/M |
| 3300005575|Ga0066702_10309601 | Not Available | 963 | Open in IMG/M |
| 3300005576|Ga0066708_10701124 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 641 | Open in IMG/M |
| 3300005578|Ga0068854_102151903 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 516 | Open in IMG/M |
| 3300005764|Ga0066903_100370715 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2332 | Open in IMG/M |
| 3300005764|Ga0066903_101133362 | Not Available | 1446 | Open in IMG/M |
| 3300005764|Ga0066903_106816482 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 593 | Open in IMG/M |
| 3300005764|Ga0066903_108851019 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 511 | Open in IMG/M |
| 3300005883|Ga0075299_1033513 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 562 | Open in IMG/M |
| 3300005897|Ga0075281_1064900 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 592 | Open in IMG/M |
| 3300006034|Ga0066656_10827850 | Not Available | 593 | Open in IMG/M |
| 3300006173|Ga0070716_101295521 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 589 | Open in IMG/M |
| 3300006175|Ga0070712_100046516 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 3000 | Open in IMG/M |
| 3300006196|Ga0075422_10006059 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 3815 | Open in IMG/M |
| 3300006573|Ga0074055_11654416 | Not Available | 714 | Open in IMG/M |
| 3300006579|Ga0074054_12125813 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → environmental samples → uncultured Corynebacteriales bacterium | 1058 | Open in IMG/M |
| 3300006580|Ga0074049_12566081 | All Organisms → cellular organisms → Bacteria | 899 | Open in IMG/M |
| 3300006580|Ga0074049_12834355 | Not Available | 587 | Open in IMG/M |
| 3300006580|Ga0074049_13100050 | Not Available | 532 | Open in IMG/M |
| 3300006755|Ga0079222_10473593 | Not Available | 905 | Open in IMG/M |
| 3300006796|Ga0066665_11196379 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 580 | Open in IMG/M |
| 3300006804|Ga0079221_11014692 | Not Available | 624 | Open in IMG/M |
| 3300006804|Ga0079221_11374767 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
| 3300006806|Ga0079220_11096754 | Not Available | 644 | Open in IMG/M |
| 3300006853|Ga0075420_101802396 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 524 | Open in IMG/M |
| 3300006871|Ga0075434_101560768 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 669 | Open in IMG/M |
| 3300006871|Ga0075434_102337138 | Not Available | 537 | Open in IMG/M |
| 3300006903|Ga0075426_11022395 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 625 | Open in IMG/M |
| 3300006903|Ga0075426_11465788 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Paraconexibacteraceae → Paraconexibacter → Paraconexibacter antarcticus | 519 | Open in IMG/M |
| 3300006954|Ga0079219_10322935 | Not Available | 972 | Open in IMG/M |
| 3300007076|Ga0075435_101583536 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 575 | Open in IMG/M |
| 3300007543|Ga0102853_1098342 | Not Available | 549 | Open in IMG/M |
| 3300009012|Ga0066710_101860815 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 904 | Open in IMG/M |
| 3300009093|Ga0105240_10839433 | Not Available | 992 | Open in IMG/M |
| 3300009098|Ga0105245_12996528 | Not Available | 523 | Open in IMG/M |
| 3300009137|Ga0066709_100246267 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 2389 | Open in IMG/M |
| 3300009137|Ga0066709_100378730 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1955 | Open in IMG/M |
| 3300009137|Ga0066709_103031396 | Not Available | 616 | Open in IMG/M |
| 3300009147|Ga0114129_12195354 | Not Available | 664 | Open in IMG/M |
| 3300009156|Ga0111538_11768943 | Not Available | 778 | Open in IMG/M |
| 3300009162|Ga0075423_12326310 | Not Available | 583 | Open in IMG/M |
| 3300009174|Ga0105241_10325792 | All Organisms → cellular organisms → Bacteria | 1326 | Open in IMG/M |
| 3300009792|Ga0126374_11431141 | All Organisms → cellular organisms → Eukaryota → Amoebozoa → Evosea → Eumycetozoa → Dictyostelia → Dictyosteliales → Raperosteliaceae → Tieghemostelium → Tieghemostelium lacteum | 564 | Open in IMG/M |
| 3300009821|Ga0105064_1107261 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 576 | Open in IMG/M |
| 3300010036|Ga0126305_10029125 | All Organisms → cellular organisms → Bacteria | 2992 | Open in IMG/M |
| 3300010040|Ga0126308_10274824 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Tunicata → Appendicularia → Copelata → Oikopleuridae → Oikopleura → Oikopleura dioica | 1101 | Open in IMG/M |
| 3300010046|Ga0126384_12099304 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 542 | Open in IMG/M |
| 3300010303|Ga0134082_10210099 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 799 | Open in IMG/M |
| 3300010325|Ga0134064_10398410 | Not Available | 549 | Open in IMG/M |
| 3300010337|Ga0134062_10750058 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300010361|Ga0126378_12857768 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 551 | Open in IMG/M |
| 3300010366|Ga0126379_11281122 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 839 | Open in IMG/M |
| 3300010375|Ga0105239_10756535 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1112 | Open in IMG/M |
| 3300010375|Ga0105239_11026844 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 948 | Open in IMG/M |
| 3300010396|Ga0134126_10687713 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1164 | Open in IMG/M |
| 3300010396|Ga0134126_12236480 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 596 | Open in IMG/M |
| 3300010399|Ga0134127_10152909 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae | 2097 | Open in IMG/M |
| 3300010400|Ga0134122_10293849 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1392 | Open in IMG/M |
| 3300012198|Ga0137364_10625125 | Not Available | 812 | Open in IMG/M |
| 3300012200|Ga0137382_10964414 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 613 | Open in IMG/M |
| 3300012205|Ga0137362_11113951 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 671 | Open in IMG/M |
| 3300012212|Ga0150985_117053272 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 512 | Open in IMG/M |
| 3300012354|Ga0137366_10381368 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1028 | Open in IMG/M |
| 3300012356|Ga0137371_10005657 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 9752 | Open in IMG/M |
| 3300012484|Ga0157333_1028411 | Not Available | 543 | Open in IMG/M |
| 3300012532|Ga0137373_10701903 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 754 | Open in IMG/M |
| 3300012902|Ga0157291_10280885 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 568 | Open in IMG/M |
| 3300012906|Ga0157295_10324981 | Not Available | 547 | Open in IMG/M |
| 3300012908|Ga0157286_10128750 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 781 | Open in IMG/M |
| 3300012912|Ga0157306_10270280 | Not Available | 609 | Open in IMG/M |
| 3300012913|Ga0157298_10345750 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 546 | Open in IMG/M |
| 3300012915|Ga0157302_10146080 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 799 | Open in IMG/M |
| 3300012915|Ga0157302_10482104 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 531 | Open in IMG/M |
| 3300012955|Ga0164298_10196231 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1176 | Open in IMG/M |
| 3300012955|Ga0164298_11123178 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 590 | Open in IMG/M |
| 3300012985|Ga0164308_10606510 | All Organisms → cellular organisms → Bacteria | 932 | Open in IMG/M |
| 3300012989|Ga0164305_10093174 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1912 | Open in IMG/M |
| 3300013296|Ga0157374_10260746 | All Organisms → cellular organisms → Bacteria | 1707 | Open in IMG/M |
| 3300013307|Ga0157372_10209461 | All Organisms → cellular organisms → Bacteria | 2259 | Open in IMG/M |
| 3300013764|Ga0120111_1050031 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1051 | Open in IMG/M |
| 3300013765|Ga0120172_1144659 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 565 | Open in IMG/M |
| 3300014272|Ga0075327_1153440 | Not Available | 719 | Open in IMG/M |
| 3300014302|Ga0075310_1030678 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1003 | Open in IMG/M |
| 3300014325|Ga0163163_11951192 | All Organisms → cellular organisms → Eukaryota | 647 | Open in IMG/M |
| 3300014745|Ga0157377_10070487 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2019 | Open in IMG/M |
| 3300014969|Ga0157376_11051634 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 838 | Open in IMG/M |
| 3300015077|Ga0173483_10270274 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 818 | Open in IMG/M |
| 3300015371|Ga0132258_11129050 | All Organisms → cellular organisms → Bacteria | 1981 | Open in IMG/M |
| 3300015373|Ga0132257_101109219 | All Organisms → cellular organisms → Bacteria | 999 | Open in IMG/M |
| 3300015373|Ga0132257_101330789 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 913 | Open in IMG/M |
| 3300015373|Ga0132257_103568755 | Not Available | 566 | Open in IMG/M |
| 3300015374|Ga0132255_104814079 | Not Available | 572 | Open in IMG/M |
| 3300016341|Ga0182035_11186027 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Asanoa → Asanoa siamensis | 681 | Open in IMG/M |
| 3300017924|Ga0187820_1143761 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Hydrogenophaga → unclassified Hydrogenophaga → Hydrogenophaga sp. T4 | 714 | Open in IMG/M |
| 3300017944|Ga0187786_10285435 | Not Available | 670 | Open in IMG/M |
| 3300017959|Ga0187779_10107590 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1685 | Open in IMG/M |
| 3300018032|Ga0187788_10553355 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| 3300018060|Ga0187765_10006019 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5200 | Open in IMG/M |
| 3300018066|Ga0184617_1089197 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 847 | Open in IMG/M |
| 3300018089|Ga0187774_10305091 | Not Available | 928 | Open in IMG/M |
| 3300018468|Ga0066662_11958972 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 613 | Open in IMG/M |
| 3300018468|Ga0066662_12814313 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 516 | Open in IMG/M |
| 3300018482|Ga0066669_11130495 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 707 | Open in IMG/M |
| 3300019356|Ga0173481_10616062 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 573 | Open in IMG/M |
| 3300019361|Ga0173482_10449736 | Not Available | 612 | Open in IMG/M |
| 3300019361|Ga0173482_10711031 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 521 | Open in IMG/M |
| 3300019361|Ga0173482_10727710 | Not Available | 517 | Open in IMG/M |
| 3300019362|Ga0173479_10154252 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 921 | Open in IMG/M |
| 3300019890|Ga0193728_1004002 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 7505 | Open in IMG/M |
| 3300020000|Ga0193692_1126257 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium | 513 | Open in IMG/M |
| 3300021445|Ga0182009_10563093 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 606 | Open in IMG/M |
| 3300021560|Ga0126371_11797334 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 734 | Open in IMG/M |
| 3300021560|Ga0126371_12464272 | Not Available | 629 | Open in IMG/M |
| 3300023064|Ga0247801_1021464 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 876 | Open in IMG/M |
| 3300024055|Ga0247794_10115635 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 811 | Open in IMG/M |
| 3300024181|Ga0247693_1056234 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 575 | Open in IMG/M |
| 3300024232|Ga0247664_1119829 | Not Available | 613 | Open in IMG/M |
| 3300024283|Ga0247670_1087156 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
| 3300024288|Ga0179589_10293707 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina → Panagrolaimomorpha → Strongyloidoidea → Strongyloididae → Parastrongyloides → Parastrongyloides trichosuri | 730 | Open in IMG/M |
| 3300025551|Ga0210131_1007594 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → environmental samples → uncultured Solirubrobacteraceae bacterium | 1415 | Open in IMG/M |
| 3300025900|Ga0207710_10484474 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 641 | Open in IMG/M |
| 3300025905|Ga0207685_10472857 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Hydrogenophaga → unclassified Hydrogenophaga → Hydrogenophaga sp. T4 | 655 | Open in IMG/M |
| 3300025908|Ga0207643_11088126 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 516 | Open in IMG/M |
| 3300025911|Ga0207654_10900682 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 641 | Open in IMG/M |
| 3300025914|Ga0207671_10164963 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae | 1717 | Open in IMG/M |
| 3300025916|Ga0207663_11051559 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 654 | Open in IMG/M |
| 3300025923|Ga0207681_11352935 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 598 | Open in IMG/M |
| 3300025924|Ga0207694_10508042 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1009 | Open in IMG/M |
| 3300025925|Ga0207650_11358465 | Not Available | 605 | Open in IMG/M |
| 3300025931|Ga0207644_11000265 | Not Available | 702 | Open in IMG/M |
| 3300025939|Ga0207665_10241904 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1330 | Open in IMG/M |
| 3300025941|Ga0207711_10416307 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1249 | Open in IMG/M |
| 3300025941|Ga0207711_11055943 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 752 | Open in IMG/M |
| 3300025944|Ga0207661_11113629 | All Organisms → cellular organisms → Eukaryota | 727 | Open in IMG/M |
| 3300025945|Ga0207679_11733130 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 571 | Open in IMG/M |
| 3300025949|Ga0207667_12075532 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 527 | Open in IMG/M |
| 3300025952|Ga0210077_1135578 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 515 | Open in IMG/M |
| 3300025961|Ga0207712_10836950 | Not Available | 810 | Open in IMG/M |
| 3300025972|Ga0207668_11368345 | Not Available | 638 | Open in IMG/M |
| 3300026075|Ga0207708_11603098 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 572 | Open in IMG/M |
| 3300026078|Ga0207702_10312334 | All Organisms → cellular organisms → Bacteria | 1495 | Open in IMG/M |
| 3300026089|Ga0207648_12285472 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 501 | Open in IMG/M |
| 3300026116|Ga0207674_10172090 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2119 | Open in IMG/M |
| 3300026312|Ga0209153_1033080 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium microadriaticum | 1776 | Open in IMG/M |
| 3300026317|Ga0209154_1130240 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1060 | Open in IMG/M |
| 3300026550|Ga0209474_10131605 | All Organisms → cellular organisms → Bacteria | 1647 | Open in IMG/M |
| 3300026552|Ga0209577_10372533 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1042 | Open in IMG/M |
| 3300026929|Ga0207461_1001817 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium | 857 | Open in IMG/M |
| 3300027543|Ga0209999_1054109 | Not Available | 760 | Open in IMG/M |
| 3300027725|Ga0209178_1128952 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 862 | Open in IMG/M |
| 3300027765|Ga0209073_10115880 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 960 | Open in IMG/M |
| 3300027765|Ga0209073_10139096 | All Organisms → cellular organisms → Bacteria | 888 | Open in IMG/M |
| 3300027826|Ga0209060_10097055 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacteroides → Mycobacteroides abscessus → Mycobacteroides abscessus subsp. abscessus | 1380 | Open in IMG/M |
| 3300027882|Ga0209590_10866155 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
| 3300027909|Ga0209382_11682456 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium | 623 | Open in IMG/M |
| 3300027991|Ga0247683_1014405 | Not Available | 680 | Open in IMG/M |
| 3300028072|Ga0247675_1032813 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium | 759 | Open in IMG/M |
| 3300028708|Ga0307295_10208593 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 555 | Open in IMG/M |
| 3300028708|Ga0307295_10250640 | Not Available | 510 | Open in IMG/M |
| 3300028713|Ga0307303_10096580 | Not Available | 673 | Open in IMG/M |
| 3300028715|Ga0307313_10222724 | Not Available | 586 | Open in IMG/M |
| 3300028718|Ga0307307_10280834 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 534 | Open in IMG/M |
| 3300028719|Ga0307301_10085326 | Not Available | 993 | Open in IMG/M |
| 3300028755|Ga0307316_10108325 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 973 | Open in IMG/M |
| 3300028755|Ga0307316_10133826 | All Organisms → cellular organisms → Bacteria | 878 | Open in IMG/M |
| 3300028755|Ga0307316_10351494 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 542 | Open in IMG/M |
| 3300028768|Ga0307280_10001658 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 5387 | Open in IMG/M |
| 3300028768|Ga0307280_10065140 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1163 | Open in IMG/M |
| 3300028784|Ga0307282_10131532 | Not Available | 1177 | Open in IMG/M |
| 3300028784|Ga0307282_10213965 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 923 | Open in IMG/M |
| 3300028784|Ga0307282_10499380 | Not Available | 591 | Open in IMG/M |
| 3300028800|Ga0265338_11032800 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 555 | Open in IMG/M |
| 3300028876|Ga0307286_10221291 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina → Panagrolaimomorpha → Strongyloidoidea → Strongyloididae → Parastrongyloides → Parastrongyloides trichosuri | 689 | Open in IMG/M |
| 3300028876|Ga0307286_10224947 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 684 | Open in IMG/M |
| 3300028880|Ga0307300_10128439 | All Organisms → cellular organisms → Bacteria | 784 | Open in IMG/M |
| 3300028885|Ga0307304_10417619 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 607 | Open in IMG/M |
| 3300028889|Ga0247827_10986728 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 571 | Open in IMG/M |
| 3300030336|Ga0247826_10085819 | All Organisms → cellular organisms → Bacteria | 1907 | Open in IMG/M |
| 3300030336|Ga0247826_11325290 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 580 | Open in IMG/M |
| 3300030490|Ga0302184_10073582 | Not Available | 1597 | Open in IMG/M |
| 3300031027|Ga0302308_10850364 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 505 | Open in IMG/M |
| 3300031226|Ga0307497_10276411 | Not Available | 761 | Open in IMG/M |
| 3300031226|Ga0307497_10386089 | Not Available | 665 | Open in IMG/M |
| 3300031226|Ga0307497_10767926 | Not Available | 503 | Open in IMG/M |
| 3300031232|Ga0302323_101887587 | Not Available | 677 | Open in IMG/M |
| 3300031240|Ga0265320_10132212 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1133 | Open in IMG/M |
| 3300031543|Ga0318516_10111042 | Not Available | 1556 | Open in IMG/M |
| 3300031547|Ga0310887_10141538 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1249 | Open in IMG/M |
| 3300031547|Ga0310887_10844664 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 577 | Open in IMG/M |
| 3300031640|Ga0318555_10447502 | All Organisms → cellular organisms → Bacteria | 700 | Open in IMG/M |
| 3300031716|Ga0310813_10706503 | All Organisms → cellular organisms → Bacteria | 901 | Open in IMG/M |
| 3300031719|Ga0306917_10736357 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium | 774 | Open in IMG/M |
| 3300031723|Ga0318493_10230757 | All Organisms → cellular organisms → Bacteria | 984 | Open in IMG/M |
| 3300031724|Ga0318500_10168833 | Not Available | 1037 | Open in IMG/M |
| 3300031747|Ga0318502_10807010 | Not Available | 569 | Open in IMG/M |
| 3300031771|Ga0318546_10408167 | Not Available | 949 | Open in IMG/M |
| 3300031858|Ga0310892_10425106 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 870 | Open in IMG/M |
| 3300031890|Ga0306925_10836346 | All Organisms → cellular organisms → Bacteria | 952 | Open in IMG/M |
| 3300031911|Ga0307412_11968557 | Not Available | 540 | Open in IMG/M |
| 3300031954|Ga0306926_10427152 | All Organisms → cellular organisms → Bacteria | 1634 | Open in IMG/M |
| 3300032025|Ga0318507_10334025 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 660 | Open in IMG/M |
| 3300032043|Ga0318556_10755471 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 506 | Open in IMG/M |
| 3300032064|Ga0318510_10467920 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
| 3300032065|Ga0318513_10276597 | Not Available | 814 | Open in IMG/M |
| 3300032065|Ga0318513_10381065 | All Organisms → cellular organisms → Bacteria | 688 | Open in IMG/M |
| 3300032074|Ga0308173_10410513 | Not Available | 1194 | Open in IMG/M |
| 3300032205|Ga0307472_101325421 | Not Available | 694 | Open in IMG/M |
| 3300032770|Ga0335085_12003639 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum → Tanacetum cinerariifolium | 587 | Open in IMG/M |
| 3300032782|Ga0335082_11713162 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 503 | Open in IMG/M |
| 3300032783|Ga0335079_12313895 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 510 | Open in IMG/M |
| 3300032893|Ga0335069_10928715 | Not Available | 971 | Open in IMG/M |
| 3300032954|Ga0335083_10186263 | All Organisms → cellular organisms → Eukaryota | 1915 | Open in IMG/M |
| 3300033412|Ga0310810_11299317 | Not Available | 573 | Open in IMG/M |
| 3300033475|Ga0310811_10785788 | All Organisms → cellular organisms → Bacteria | 893 | Open in IMG/M |
| 3300033501|Ga0326732_1063669 | Not Available | 605 | Open in IMG/M |
| 3300033550|Ga0247829_11055721 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 675 | Open in IMG/M |
| 3300033551|Ga0247830_10465952 | Not Available | 991 | Open in IMG/M |
| 3300033551|Ga0247830_10795135 | All Organisms → cellular organisms → Bacteria | 752 | Open in IMG/M |
| 3300033805|Ga0314864_0090738 | Not Available | 738 | Open in IMG/M |
| 3300034150|Ga0364933_149293 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacteroides → Mycobacteroides abscessus → Mycobacteroides abscessus subsp. abscessus | 604 | Open in IMG/M |
| 3300034690|Ga0364923_0213740 | Not Available | 521 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 16.48% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.99% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.99% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.12% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 4.12% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 3.75% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 3.37% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 3.00% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 3.00% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 3.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.62% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.62% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.62% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.62% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.25% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 1.87% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.87% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.87% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.87% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.87% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.50% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.50% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.50% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.50% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.50% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.12% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.12% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.12% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.75% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.75% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.75% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.75% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.75% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.75% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.75% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.75% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.75% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.75% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.75% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.37% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 0.37% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.37% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.37% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.37% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.37% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.37% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.37% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.37% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.37% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.37% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.37% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.37% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.37% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.37% |
| Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 0.37% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2065487018 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 2067725001 | Soil microbial communities from Great Prairies - Wisconsin Native Prairie soil | Environmental | Open in IMG/M |
| 2170459017 | Litter degradation ZMR4 | Engineered | Open in IMG/M |
| 3300000579 | Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A01 | Environmental | Open in IMG/M |
| 3300000837 | Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A100 | Environmental | Open in IMG/M |
| 3300000880 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A35-65cm-20A)- 1 week illumina | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001535 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A3-PF-15A)- 1 week illumina | Environmental | Open in IMG/M |
| 3300001538 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A10-PF 4A)- 1 week illumina | Environmental | Open in IMG/M |
| 3300001686 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300004081 | Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2) | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004153 | Grasslands soil microbial communities from Hopland, California, USA (version 2) | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005158 | Soil and rhizosphere microbial communities from Laval, Canada - mgHAA | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
| 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005883 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_80N_302 | Environmental | Open in IMG/M |
| 3300005897 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_80N_103 | Environmental | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006196 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 | Host-Associated | Open in IMG/M |
| 3300006573 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAC (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006579 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006580 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPC (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300007543 | Estuarine microbial communities from the Columbia River estuary - metaG 1370B-3 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300009821 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_20_30 | Environmental | Open in IMG/M |
| 3300010036 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26 | Environmental | Open in IMG/M |
| 3300010040 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
| 3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012484 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.2.old.190510 | Environmental | Open in IMG/M |
| 3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012902 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S169-409C-1 | Environmental | Open in IMG/M |
| 3300012906 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S212-509R-1 | Environmental | Open in IMG/M |
| 3300012908 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S089-202R-1 | Environmental | Open in IMG/M |
| 3300012912 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S163-409C-2 | Environmental | Open in IMG/M |
| 3300012913 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S043-104R-2 | Environmental | Open in IMG/M |
| 3300012915 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2 | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013764 | Permafrost microbial communities from Nunavut, Canada - A28_35cm_6M | Environmental | Open in IMG/M |
| 3300013765 | Permafrost microbial communities from Nunavut, Canada - A30_80cm_6M | Environmental | Open in IMG/M |
| 3300014272 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_CattailB_D1 | Environmental | Open in IMG/M |
| 3300014302 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailA_D2 | Environmental | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015077 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300017924 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5 | Environmental | Open in IMG/M |
| 3300017944 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_10_20_MG | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300018032 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP10_20_MG | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018066 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_b1 | Environmental | Open in IMG/M |
| 3300018089 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019356 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2) | Environmental | Open in IMG/M |
| 3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
| 3300019362 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2) | Environmental | Open in IMG/M |
| 3300019890 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1 | Environmental | Open in IMG/M |
| 3300020000 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3a1 | Environmental | Open in IMG/M |
| 3300021445 | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300023064 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S001-104B-6 | Environmental | Open in IMG/M |
| 3300024055 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S046-202B-6 | Environmental | Open in IMG/M |
| 3300024181 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK34 | Environmental | Open in IMG/M |
| 3300024232 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK05 | Environmental | Open in IMG/M |
| 3300024283 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK11 | Environmental | Open in IMG/M |
| 3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300025551 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqA_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025952 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_CattailNLB_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026312 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 (SPAdes) | Environmental | Open in IMG/M |
| 3300026317 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes) | Environmental | Open in IMG/M |
| 3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300026929 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G05.2A3w-12 (SPAdes) | Environmental | Open in IMG/M |
| 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027725 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes) | Environmental | Open in IMG/M |
| 3300027765 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes) | Environmental | Open in IMG/M |
| 3300027826 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027991 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK24 | Environmental | Open in IMG/M |
| 3300028072 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK16 | Environmental | Open in IMG/M |
| 3300028708 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_152 | Environmental | Open in IMG/M |
| 3300028713 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_184 | Environmental | Open in IMG/M |
| 3300028715 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_203 | Environmental | Open in IMG/M |
| 3300028718 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_194 | Environmental | Open in IMG/M |
| 3300028719 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_182 | Environmental | Open in IMG/M |
| 3300028755 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_356 | Environmental | Open in IMG/M |
| 3300028768 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_119 | Environmental | Open in IMG/M |
| 3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
| 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Host-Associated | Open in IMG/M |
| 3300028876 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_140 | Environmental | Open in IMG/M |
| 3300028880 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_181 | Environmental | Open in IMG/M |
| 3300028885 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185 | Environmental | Open in IMG/M |
| 3300028889 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day2 | Environmental | Open in IMG/M |
| 3300030336 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1 | Environmental | Open in IMG/M |
| 3300030490 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_3 | Environmental | Open in IMG/M |
| 3300031027 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_3 | Environmental | Open in IMG/M |
| 3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
| 3300031232 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3 | Environmental | Open in IMG/M |
| 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Host-Associated | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031547 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4 | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031858 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Host-Associated | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
| 3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
| 3300032064 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17 | Environmental | Open in IMG/M |
| 3300032065 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20 | Environmental | Open in IMG/M |
| 3300032074 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| 3300033475 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC | Environmental | Open in IMG/M |
| 3300033501 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF12FN SIP fraction | Environmental | Open in IMG/M |
| 3300033550 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4 | Environmental | Open in IMG/M |
| 3300033551 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5 | Environmental | Open in IMG/M |
| 3300033805 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_50_10 | Environmental | Open in IMG/M |
| 3300034150 | Sediment microbial communities from East River floodplain, Colorado, United States - 25_j17 | Environmental | Open in IMG/M |
| 3300034690 | Sediment microbial communities from East River floodplain, Colorado, United States - 60_j17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| GPINP_01655490 | 2065487018 | Soil | MGFSVVNVEEIEGSGPGGAVRFVRRELGLEAFGINWFE |
| GPWNP_03188850 | 2067725001 | Soil | VAYSIVHLDEIEPAGPGDAVRFVRRELGVKAFGINWYE |
| 4ZMR_05170710 | 2170459017 | Switchgrass, Maize And Mischanthus Litter | VSGYSAVHVDDVQASGPRGGVRFVRRELGVEAFGINWFEL |
| AP72_2010_repI_A01DRAFT_10181631 | 3300000579 | Forest Soil | MGYSKVNLNEIEPTGPGGMVRFVRRELDLQAFGINWFDLPP |
| AP72_2010_repI_A100DRAFT_10294032 | 3300000837 | Forest Soil | MGYSMVNVADIEGEGPGGAVRFVRRRLGCEAFGINWFEIP |
| AL20A1W_12626631 | 3300000880 | Permafrost | MGYSIVQVEEIDPAGPGGVVRFVRRELGVEAFGINW |
| JGI10216J12902_1118226391 | 3300000956 | Soil | MGYSVKNIEDIDGAGPGGAVRFVRRELGLEAFGINWFELP |
| A3PFW1_100598291 | 3300001535 | Permafrost | MGYSIVQVEEIDPAGPGGVVRFVRRELGVEAFGINWFELPPNA |
| A10PFW1_124294511 | 3300001538 | Permafrost | MGYSIVQVEEIDPAGPGGVVRFVRRELGVEAFGINWFELPPN |
| C688J18823_108118111 | 3300001686 | Soil | VGYSMVHVDDLPAEGPSGNVRFVRRHLGXDAFGVNWF |
| C688J35102_1186064481 | 3300002568 | Soil | MGYTKVNVNEIEPAGPGGAVRFVRRELDLQAFGINWFELPPNAEG |
| C688J35102_1194026911 | 3300002568 | Soil | MSYSIVRVDEIEGSGPGDAVHFVRRELGVEAFGINWFEFPPDTE |
| Ga0063454_1009535052 | 3300004081 | Soil | MGHRVVDVEQIEPAGPGGAVRFVRRELGTRAFGINQFVLEPGFAG |
| Ga0063454_1011735172 | 3300004081 | Soil | MGYSVVNIADVEGAGPGGAVKFLRRELGVQAFGVNWFELPPN |
| Ga0062593_1005513421 | 3300004114 | Soil | VGYSVVNVEEIEGEGPGGAVRFVRRKLGVQAFGINWFELGPNVRG |
| Ga0062593_1012088033 | 3300004114 | Soil | MGYSVVNVEEIEGEGPGGAVRFVRRKLGVQAFGINWFELGPNVRG |
| Ga0063455_1009887081 | 3300004153 | Soil | MGYTVVNVEDIEGAGPGGAVRFVRRELGCEAFGINWFELAPGAEG |
| Ga0063455_1014483571 | 3300004153 | Soil | MGYSVVNIADVEGVGPGGAVKFLRRELGVEAFGVNWFELPPNAEG |
| Ga0062589_1018534932 | 3300004156 | Soil | MGFSVVHIDEIEGAGPGNAVKFVRRRLGVEAFGINWFEVPPDMEGVE |
| Ga0062589_1028390582 | 3300004156 | Soil | VGYSVANVDEIEREGPGGAVRFVRRKLGVQAFGINWFELGPNVR |
| Ga0062595_1015189812 | 3300004479 | Soil | MGYSHVHVDDIEPAGPGGAVRFVRRELGVEAFGINRFDLPPNAE |
| Ga0062594_1006747901 | 3300005093 | Soil | MGYSIVNVEDVEGAGPGGRVKFVRRELGCEAFGINWFQLPPNT |
| Ga0066816_10275191 | 3300005158 | Soil | MGYSMISVDDIEGEGPGGAARFVRRRLGVEAFGINWFEIPPGA |
| Ga0066673_105623193 | 3300005175 | Soil | VSYSIVHVDDLPGEGPGEAVRFVRRHLGAEAFGINWFEFAPNVTG |
| Ga0066673_108880192 | 3300005175 | Soil | MGYDVVHADDLEGSGPGGAVRFVRRELGVAAFGINWFELPP |
| Ga0066679_106887031 | 3300005176 | Soil | MGYSIVNVGDIEPAGPGGAVRFVRRELGCEAFGINWFEVPPNFAGPEA* |
| Ga0070658_114627502 | 3300005327 | Corn Rhizosphere | MAYSIVRVDEIEGSGPGGAVHFVRRELGVEAFGINWFELP |
| Ga0066388_1022776622 | 3300005332 | Tropical Forest Soil | MAYSIVHVDDIEGTGPGGAVHFVRRELGVEAFGINWFEIPPN |
| Ga0068869_1019725301 | 3300005334 | Miscanthus Rhizosphere | MEAGMGYSMVQIGDIEPAGPGGAVRFLRREIGAQAFGVNWFE |
| Ga0070660_1005571841 | 3300005339 | Corn Rhizosphere | MSYTIVHVDDIEGAGPGGSVKFVRRELGVDAFGVNWFELP |
| Ga0070660_1015989421 | 3300005339 | Corn Rhizosphere | MAYSIVRVDEIEGSGPGGAVHFVRRELGVEAFGINWFELPPGA |
| Ga0070692_105507971 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | MGYSMIHVDKVEPSGPGGAVRFVRRVLGVEAFGINWFEIP |
| Ga0070674_1004583281 | 3300005356 | Miscanthus Rhizosphere | MGYSMIHVDEVVPAGPGGAVRFVRRVLGVEAFGINWFEIPP |
| Ga0070713_1013769233 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MGYSVVNVEDIEGGGPGGAVRFVRREIDCEAFGINWFELQP |
| Ga0070662_1009789331 | 3300005457 | Corn Rhizosphere | MGYSKVNVHDLEPAGPGGAIRFVRRELDLLAFGINWFEISPNS |
| Ga0070707_1002999082 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | VAYTIVHVDDIEPAGPRGAVRFVRRELGVEAFGINWFQIPP |
| Ga0070698_1013718372 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MSFSKVNVDEIEGAGPGGAVRFVRRQLGVEAFGINWIELPPD |
| Ga0070698_1014215982 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MGYSVVNVNDLEAAGPGGAVRFVRRELGLEAFGLNWFELPPN |
| Ga0070684_1000865301 | 3300005535 | Corn Rhizosphere | VGYSVVNVEDIEGEGPGGAVRFVRRKLGVQAFGINWFELG |
| Ga0070732_103388881 | 3300005542 | Surface Soil | MGYSVVNVDDIEGAGPGGAVRFVRRELGVEAFGINWFDLPPGTA |
| Ga0066695_102454723 | 3300005553 | Soil | VGYSMVHVDDLPPEGPGGAVRFVRRHLGVGAFGINWFEIPPNAEG |
| Ga0066695_105496221 | 3300005553 | Soil | MAYSITHIDEIEGAGPGGSVRFVRRVLGVEAFGIN |
| Ga0066704_102898042 | 3300005557 | Soil | MGYSIVNVGDIEPAGPGGAVRFVRRDLGCEAFGINWFEVPPNFAGPGA* |
| Ga0070664_1010933002 | 3300005564 | Corn Rhizosphere | MGYSVVRIDEIEPSGPGGAIRFVRRELGVEAFGINWFELPPNA |
| Ga0070664_1011229641 | 3300005564 | Corn Rhizosphere | VAYSIVRVEEIEGAGPGGTVRFVRRELGAEAFGINWFELPP |
| Ga0070664_1015564943 | 3300005564 | Corn Rhizosphere | MAYSLVHIDDIEPSGPGGAVRFVRRELGVEAFGINRFDLPPNR |
| Ga0066694_102817241 | 3300005574 | Soil | VGYSMVQVDDLPPEGPGGAVRFVRRHLGVGAFGINWFEIPPNV |
| Ga0066702_103096011 | 3300005575 | Soil | MAYSVVRIDEIEPSGPGGAVRFVRRELGVEAFGVNWFELRPNAEG |
| Ga0066708_107011242 | 3300005576 | Soil | MGYSLVHADDIEPSGPGGAVRFVRRALGVEAFGINRFDLPAGREGRE |
| Ga0068854_1021519031 | 3300005578 | Corn Rhizosphere | MAYSIVRVDEVEGSGPGGMVRFVRRELGVEAFGINWFELPP |
| Ga0066903_1003707151 | 3300005764 | Tropical Forest Soil | MGYSVKSIGDIEGTGPGGAVRFVRRELGLEAFGINWFEL |
| Ga0066903_1011333623 | 3300005764 | Tropical Forest Soil | MGYSVLNVAELEPAGPGGAVRFVRRELGVGAFGINWFELAPHA |
| Ga0066903_1068164821 | 3300005764 | Tropical Forest Soil | MGYSVVRIEEIEPAGPGGAVRFVRRELGVEAFGVNWFELPP |
| Ga0066903_1088510192 | 3300005764 | Tropical Forest Soil | MGYSVVHVDEIEGAGPGGAVKFVRRELGLLAFGVNWFE |
| Ga0075299_10335131 | 3300005883 | Rice Paddy Soil | MGYSVVKVQDIEPAGPGGAVRFVRRELGVEAFGINWFEVPPN |
| Ga0075281_10649002 | 3300005897 | Rice Paddy Soil | MGYSIVNVNELEAGCRSGRVKFIRRALGLEAFGLNWFELPPD |
| Ga0066656_108278502 | 3300006034 | Soil | MSYSITHIDDIEGAGPAGSVRFVRRVLGVEAFGINWFEIAPNSE |
| Ga0070716_1012955211 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MGYSVVRVDDIEGSGPGGAVRFVRRQLGVEAFGINWFEIP |
| Ga0070712_1000465161 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MAYSLVHIDDIEPSGPGGAVRFVRRALGVEAFGINRF |
| Ga0075422_100060591 | 3300006196 | Populus Rhizosphere | MAYSIAHVDDIEGTGPGGAVHFVRRELGVEAFGINWFEIP |
| Ga0074055_116544162 | 3300006573 | Soil | MGYSVAHVDELEPAGPGGMVRFVRRAIGVEASVTRRSS |
| Ga0074054_121258132 | 3300006579 | Soil | MGYSKVNVHELEPAGPGGAIRFVRRELDLLAFGINWFELAPNA |
| Ga0074049_125660811 | 3300006580 | Soil | MGYSIVNVDEIEGAGRSGAVRFVRRELGAEAFGINWFEL |
| Ga0074049_128343551 | 3300006580 | Soil | MGYSLVHLDDIEPGGPGGVIRFVRRELEVEAFGINWFE |
| Ga0074049_131000501 | 3300006580 | Soil | MGYSILNVNEIEGGGPTGAFHFVRRELGVEAFGINWIDLPPGAEG |
| Ga0079222_104735932 | 3300006755 | Agricultural Soil | MGYSTVNVDDIEGAGPGGGVHFVRRVLGVEAFGVNWIEIPPNSPG |
| Ga0066665_111963791 | 3300006796 | Soil | MGYSVVHVTEVEPAGPAGAVRFVRRALGVEAVGINWF |
| Ga0079221_110146922 | 3300006804 | Agricultural Soil | VGYSVVKIADIEPAGPGNAVRFVRRELGVEAFGVNWFE |
| Ga0079221_113747671 | 3300006804 | Agricultural Soil | MGYSVINVDEVEGAGPGGVVHFVRRQLGVEAFGINW |
| Ga0079220_110967542 | 3300006806 | Agricultural Soil | MGYSVVKVADIEPAGPGNAVRFVRRELGVEAFGINWFEIPANTA |
| Ga0075420_1018023962 | 3300006853 | Populus Rhizosphere | MGHSIVHVDDITPAGPGDAVRFVRRELGVGAFGINWYELGPSVVGRE |
| Ga0075434_1015607681 | 3300006871 | Populus Rhizosphere | VGYSIVNVDEIEGAGTSGAVRFVRRELGVEAFGINWFEL |
| Ga0075434_1023371382 | 3300006871 | Populus Rhizosphere | VAYSVVQVDELEGAGPGGAVRFVRRALGVEAFGINWFE |
| Ga0075426_110223952 | 3300006903 | Populus Rhizosphere | MGYSYVDLDDIEPAGPGGAVRFVRRELGATAFGINQFILPPGATGLEH |
| Ga0075426_114657881 | 3300006903 | Populus Rhizosphere | VGYTLVDVADVEPGGPGGAVRFVRRELGCEAFGIN |
| Ga0079219_103229352 | 3300006954 | Agricultural Soil | MGYSKVNLNEIEPTGPGGMVRFVRRELDLQAFGINWFQLPP |
| Ga0075435_1015835361 | 3300007076 | Populus Rhizosphere | MGYSVVDVSDVEGAGPGGSVRFVRRELGVEAFGINWFELAP |
| Ga0102853_10983422 | 3300007543 | Estuarine | VGYTVVDIEEIEGAGPGGAVRFVRRQLGVEAFGVNWFE |
| Ga0066710_1018608151 | 3300009012 | Grasslands Soil | MGWSVVDVHELEGEGPGGAVRFVRRRLGCEAFGINWFE |
| Ga0105240_108394331 | 3300009093 | Corn Rhizosphere | MGYSVVNIADVEGSGPGNAVKFLRRELGVSAFGVNWFDLPPNGV |
| Ga0105245_129965282 | 3300009098 | Miscanthus Rhizosphere | MGYSTVHVEEIEGSGPGGAVHFVRRVLGVEAFGVNWFEIP |
| Ga0066709_1002462674 | 3300009137 | Grasslands Soil | MGYSKVNVYDLEPAGPGGVVRFVRRELDLLAFGINWFEIPPN |
| Ga0066709_1003787303 | 3300009137 | Grasslands Soil | MGHRVVDVEQIEPAGPGGAVRFVRRELGTRAFGIN |
| Ga0066709_1030313962 | 3300009137 | Grasslands Soil | MGYSITHLDEIEGAGPGGSVRFVRRVLGVEAFGINWFEIAPNSEGH |
| Ga0114129_121953541 | 3300009147 | Populus Rhizosphere | MGFSVIHVDKVEPSGPGGAVRFVRRVLGVEAFGINWFEIPPNAEGR |
| Ga0111538_117689432 | 3300009156 | Populus Rhizosphere | MGYSMINVEDVEPSGPGDAVRFVRRELGVQAFGINWFEIPPGVEGRE |
| Ga0075423_123263101 | 3300009162 | Populus Rhizosphere | VGYSFVNIADVEGSGPGNAVKFLRRELGVGAFGVNWFDLPPNGE |
| Ga0105241_103257921 | 3300009174 | Corn Rhizosphere | MGYSFKNIEDIDGAGPGGAVRFVRRELGLEAFGINWF |
| Ga0126374_114311412 | 3300009792 | Tropical Forest Soil | MGWSVVNVDEIEGSGPGGAVRFVRRQLGVEAFGINWFELPPGAEG |
| Ga0105064_11072612 | 3300009821 | Groundwater Sand | MGYSMLHVDEIEPAGPGGAVRFVRRELGVEAFGINWFEPS |
| Ga0126305_100291253 | 3300010036 | Serpentine Soil | VGYTHVNVDDIAPAGPGGAARFVRRELGVGAFGINWYEI |
| Ga0126308_102748242 | 3300010040 | Serpentine Soil | MGYSIAHVDEIEGGGPGGGFHFVRRELGVEAFGINWIDLPPGA |
| Ga0126384_120993042 | 3300010046 | Tropical Forest Soil | MGYHVVHVDELEGAGPGGAVRFVRRELGVEAFGINW |
| Ga0134082_102100992 | 3300010303 | Grasslands Soil | MGYSKVNVHEIEPAGPGGAVRFVRRELGVEAFGINWFELPPDFGG* |
| Ga0134064_103984103 | 3300010325 | Grasslands Soil | VSYSMVQVDDLPGEGPGGAVRFVRRHLGAEAFGINWFEFAPN |
| Ga0134062_107500583 | 3300010337 | Grasslands Soil | MVQVDDLPPEGPGGSVRFVRRHLGVGAFGINWFEIP |
| Ga0126378_128577681 | 3300010361 | Tropical Forest Soil | MGYSKINLDEIEPTGPGGMVRFVRRELDLQAFGINWF |
| Ga0126379_112811221 | 3300010366 | Tropical Forest Soil | MGYDVVNVEEIEGAGPGGAVRFVRRELGCEAFGINWF |
| Ga0105239_107565351 | 3300010375 | Corn Rhizosphere | MGHRVVDVEQIEPAGPGGAVRFVRRELGTRAFGINQFVLEP |
| Ga0105239_110268441 | 3300010375 | Corn Rhizosphere | MGYSVVDIAGIDATGPGGAVRFVRRELGVEAFGINWFEVAANMS |
| Ga0134126_106877132 | 3300010396 | Terrestrial Soil | LAYSVIHSDEIDPAGPGGMVRFVRRGLGVEAFGINRFDLPPGA |
| Ga0134126_122364801 | 3300010396 | Terrestrial Soil | MGYSVVNVDDIAPAGPGGAVRFVRRELGVQAFGINWF |
| Ga0134127_101529092 | 3300010399 | Terrestrial Soil | MAYSLVHVDDIEPGGPGGAVRFVRRALGVQAFGINRFDLSPNR* |
| Ga0134122_102938491 | 3300010400 | Terrestrial Soil | VGYSVVNVEEIEGEGPGGAVRFVRRKLGVQAFGINWFEL |
| Ga0137364_106251252 | 3300012198 | Vadose Zone Soil | MGYSKVNVNEIEPAGPGGAVKFVRRELDLLAFGLNWFELPPNVS |
| Ga0137382_109644142 | 3300012200 | Vadose Zone Soil | MGYSKVNVHELEPAGPGGAIRFVRRELDLLAFGINWFELAP |
| Ga0137362_111139511 | 3300012205 | Vadose Zone Soil | MGYSIVKVEDLEGEGPGGAVRFVRRHLGCEAFGINWFELPPNSEGK |
| Ga0150985_1170532722 | 3300012212 | Avena Fatua Rhizosphere | MGYSAVKIAEIEPAGPRGMVRFVRRELGVEAFGINWFELPPNAKG |
| Ga0137366_103813682 | 3300012354 | Vadose Zone Soil | MAYSIVKVDEIDPEGPGGAVRFVRRRLGVQAFGINWFEFPP |
| Ga0137371_100056571 | 3300012356 | Vadose Zone Soil | VGYSMVHVDDLPHEGPGGAVRFVRRHLGVGAFGIN |
| Ga0157333_10284111 | 3300012484 | Soil | MAYDVVDALELEGEGPGGAVRFVRRRLNVTAFGINWYQL |
| Ga0137373_107019032 | 3300012532 | Vadose Zone Soil | MGYSHVNVDDIEGASPGGAVRFVRRELGVGAFGINWFEIPP |
| Ga0157291_102808852 | 3300012902 | Soil | MGYSVANVDELEPAGPGGMVRFVRRALGVEAFGVNWY |
| Ga0157295_103249813 | 3300012906 | Soil | VGYSIVQVDDLPSEGPGGSVRFVRRHLGVGAFGINWF |
| Ga0157286_101287501 | 3300012908 | Soil | MGYSMIHVDKVEPSGPGGAVRFVRRVLGVEAFGINW |
| Ga0157306_102702802 | 3300012912 | Soil | MGYSVVNVEEIEGEGPAGAVRFVRRKLGVQAFGINWFELGPNVRGRE |
| Ga0157298_103457502 | 3300012913 | Soil | MGYSKLNVHELEGAGPGGAVRFVRRQLGVEAFGINWFELGPNVVGHE |
| Ga0157302_101460802 | 3300012915 | Soil | LAYSVIHSDEIDPAGPGGVVRFVRRGLGVEAFGINRFDLPPGAG |
| Ga0157302_104821041 | 3300012915 | Soil | MGYSLAHVDEIEPGGPGGAVRFVRRELGVKAFGINWFEL |
| Ga0164298_101962314 | 3300012955 | Soil | MGYSVKDIEDIEGAGPGGAVRFVRRELGLEAFGINWF |
| Ga0164298_111231781 | 3300012955 | Soil | MGYSIANIDEIEGAGPGGAVRFVRRELGVEAFGINWFEL |
| Ga0164308_106065101 | 3300012985 | Soil | MGYSIANVDEIEGAGPTGAVRFVRRELGAEAFGINWFELAPGA |
| Ga0164305_100931741 | 3300012989 | Soil | MGYSLVHIDDVEPSGPGGAVRFVRRALGVEAFGINRFDLPPDREGI |
| Ga0157374_102607465 | 3300013296 | Miscanthus Rhizosphere | MGYSVKNVDDIEGAGPGGAVRFVRRELGLEAFGVNWFE |
| Ga0157372_102094611 | 3300013307 | Corn Rhizosphere | MAYSVVRIDEIEPSGPGGAIRFVRRELGVEAFGINWFE |
| Ga0120111_10500312 | 3300013764 | Permafrost | MGYSIVQVEEIDPAGPGGVVRFVRRELGVEAFGIN |
| Ga0120172_11446591 | 3300013765 | Permafrost | MGYSMVNVDEIDGSGPGGAVHFVRKVLGAEAFGINWFELPPNTAGFE |
| Ga0075327_11534402 | 3300014272 | Natural And Restored Wetlands | VAYSVVHIDDIEPAGPGGSVRFVRRELDVQAFGVNWFELPP |
| Ga0075310_10306782 | 3300014302 | Natural And Restored Wetlands | MSYSVVNVEEIEGEGPGGAVRFIRRQLGVQAFGINWF |
| Ga0163163_119511922 | 3300014325 | Switchgrass Rhizosphere | VGYSKVNVHELDGAGPGGAVRFVRRELGAEAFGINWFEL |
| Ga0157377_100704873 | 3300014745 | Miscanthus Rhizosphere | MAYSLVHVDDIEPGGPGGAVRFVRRALGVEAFGINRFDLSPNR |
| Ga0157376_110516343 | 3300014969 | Miscanthus Rhizosphere | MGYSVKNVDDIEGAGPGGAVRFVRRELGLEAFGINWFE |
| Ga0173483_102702742 | 3300015077 | Soil | MAYSIVHIDEIEPAGSGGAVRFVRRELGVEAFGINWFELPP |
| Ga0132258_111290501 | 3300015371 | Arabidopsis Rhizosphere | MGYTHVNVDEIEPSGPGGAVRFVRRELGVEAFGINWFE |
| Ga0132257_1011092193 | 3300015373 | Arabidopsis Rhizosphere | MGYSVVDITGIESAGPGGAVRFVRRELGVEAFGINWF |
| Ga0132257_1013307893 | 3300015373 | Arabidopsis Rhizosphere | GYSVVDIAGIEAAGPGGAVRFVRRELGVEAFGINF* |
| Ga0132257_1035687552 | 3300015373 | Arabidopsis Rhizosphere | MGYSVAHVDEIEGSGPGGAFHFVRRELGVAAFGINWINLPPG |
| Ga0132255_1048140793 | 3300015374 | Arabidopsis Rhizosphere | SRAMGYSVVDIAGIEAAGPGGAVRFVRRELGVEAFGINF* |
| Ga0182035_111860272 | 3300016341 | Soil | VGFSVVHVDDIEGAGQGGAIRFVRRELGVEAFGINW |
| Ga0187820_11437612 | 3300017924 | Freshwater Sediment | MGYSVVRIDEIEPAGSGGAVRFVRRELGVEAFGVNWFELPPNAE |
| Ga0187786_102854351 | 3300017944 | Tropical Peatland | MGYTALNVDEIEGSGPGGAVRFVRRELGLEAFGINW |
| Ga0187779_101075901 | 3300017959 | Tropical Peatland | VPLVGYSVVNVDEIEGAGPGGAVRFVRRELGVEAFGINWFELPPNAK |
| Ga0187788_105533551 | 3300018032 | Tropical Peatland | MGYSVVHVDEIEGAGPGGGVRFVRRELGLEAFGVN |
| Ga0187765_100060191 | 3300018060 | Tropical Peatland | MSYSVVNVDEIEPGGRTGMVRFVRRALEVEAFGINWFELPPNAEG |
| Ga0184617_10891971 | 3300018066 | Groundwater Sediment | VGYSMVQVDDLPPEGPGGAVRFVRRHLGVGAFGINWFEIP |
| Ga0187774_103050912 | 3300018089 | Tropical Peatland | MGYSVVRVSEIEPTGPGGAVRFVRRELGVEAFGINWFELPPGMEG |
| Ga0066662_119589721 | 3300018468 | Grasslands Soil | MGYSIVNVGDIEPAGPGGAVRFVRRELGCEAFGINWFEVPPNFAGPEA |
| Ga0066662_128143131 | 3300018468 | Grasslands Soil | MGYSKVNVHELEPAGPGGAVRFVRRELDLLSFGINWFE |
| Ga0066669_111304953 | 3300018482 | Grasslands Soil | LGYSVVNVDELEPAGPGGAVRFVRRALGVEAFGINWFE |
| Ga0173481_106160621 | 3300019356 | Soil | MGYSKVNVHDLEPAGPGGAIRFVRRELDLLAFGINWFEIQPNADGYR |
| Ga0173482_104497362 | 3300019361 | Soil | MGYSKLNVHELEGAGPGGAVRFVRRPLGVEAFGLNWFERGP |
| Ga0173482_107110312 | 3300019361 | Soil | VGYSVVNVEEIEGEGPGGAVRFVRRKLGVQAFGINWFELGPNV |
| Ga0173482_107277102 | 3300019361 | Soil | MGYSVKNVDDIEGAGPGGAVRFVRRELGLEAFGINWFELP |
| Ga0173479_101542521 | 3300019362 | Soil | VGYSVVNVEDIEGEGPGGAVRFVRRKLGVQAFGINWFELGPNVR |
| Ga0193728_10040021 | 3300019890 | Soil | MGYSKVNVHELEPAGPGGVVRFVRRELDLQAFGINW |
| Ga0193692_11262571 | 3300020000 | Soil | MGYSKVNVHDLEPAGPGGAIRFVRRELDLLAFGINWFEISPKS |
| Ga0182009_105630932 | 3300021445 | Soil | MGYSKVNLNEIEPTGPGGMVRFVRRELDLQAFGINWFQLPPNVD |
| Ga0126371_117973342 | 3300021560 | Tropical Forest Soil | VRLAIGYSVINYADVAPEGPGGAVRFVRRVLGVEAFGINFF |
| Ga0126371_124642723 | 3300021560 | Tropical Forest Soil | MGYSTINVDEIEGEGPGGAVRFVRRRLGVEAFGINWSEIPPN |
| Ga0247801_10214641 | 3300023064 | Soil | MGYSMIHVDKVEPSGPGGAVRFVRRVLGVEAFGINWF |
| Ga0247794_101156352 | 3300024055 | Soil | MAYSIVHVSDIEGSGPGGAAHFVRRELGVEAFGINW |
| Ga0247693_10562342 | 3300024181 | Soil | VGYSMVRVDELEPAGPGSAVRFVRRELGVEAFGVNWFELPPDAEGRR |
| Ga0247664_11198292 | 3300024232 | Soil | MGFSVVNVEEIEGSGPGGAVRFVRRELGLEAFGVNWFELPPGAP |
| Ga0247670_10871562 | 3300024283 | Soil | MSYSLVNVDEIEPGGPGGAVRFVRRELGALAFGINWFELGP |
| Ga0179589_102937072 | 3300024288 | Vadose Zone Soil | MGYSKVNVHELEPAGPGGAVRFVRRELDLLAFGINWFELAPTAD |
| Ga0210131_10075942 | 3300025551 | Natural And Restored Wetlands | MAYSIVHIDDIEPAGPGGAVRFVRRELGVEAFGINWFELG |
| Ga0207710_104844741 | 3300025900 | Switchgrass Rhizosphere | MGYSMIHVDKVEPSGPGGAVRFVRRVLGVEAFGINWFEIPANTEGR |
| Ga0207685_104728571 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | MGYSVVRIDEIEPSGPGGAIRFVRRELGVEAFGINWFELPPNAE |
| Ga0207643_110881262 | 3300025908 | Miscanthus Rhizosphere | MGYSKVNVHDLEPAGPGGAIRFVRRELDLLAFGIN |
| Ga0207654_109006822 | 3300025911 | Corn Rhizosphere | MSYTIVHVDDIEGAGPGGSVKFVRRELGVDAFGVNWFELPPNAEGF |
| Ga0207671_101649632 | 3300025914 | Corn Rhizosphere | MGYSAVHIDDIEPGGPGSAVRFVRRALGVEAFGINRFDLRAGREG |
| Ga0207663_110515593 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | VGYWLVQVDELPPEGPGGSVRFVRRHLGVDAFGINWFELPPNAEGRE |
| Ga0207681_113529352 | 3300025923 | Switchgrass Rhizosphere | VGYSVVNVEEIEGEGPGGAVRFVRRKLGVQAFGINWFELGPNVR |
| Ga0207694_105080421 | 3300025924 | Corn Rhizosphere | MGYSVVEIDEIEPAGPGGAVRFVRRELGVEAFGINWFELPPHAE |
| Ga0207650_113584651 | 3300025925 | Switchgrass Rhizosphere | MGYSFKNIEDIDGAGPGGAVRFVRRELGLEAFGINWFELPPGA |
| Ga0207644_110002651 | 3300025931 | Switchgrass Rhizosphere | MGYSFKNIEDIDGAGPGGAVRFVRRELGLEAFGINWFELPPG |
| Ga0207665_102419042 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MGYSLVHIDDVEPSGPGGAVRFVRRALGVEAFGINRFDLPPDRE |
| Ga0207711_104163072 | 3300025941 | Switchgrass Rhizosphere | VGYSIVRVDELEGSGPGGAVRFVRRELGVEAFGINWFELP |
| Ga0207711_110559431 | 3300025941 | Switchgrass Rhizosphere | MGYSIVNVDEIDGAGPTGGVRFVRRELGLEAFGINWFELP |
| Ga0207661_111136292 | 3300025944 | Corn Rhizosphere | MGYSVVNVDEIEPGGRTGAVRFVRRELGLEAFGINWFELPP |
| Ga0207679_117331301 | 3300025945 | Corn Rhizosphere | VGYSVVNVEEIEGEGPGGAVRFVRRKLGVQAFGINWF |
| Ga0207667_120755321 | 3300025949 | Corn Rhizosphere | MGHRVVDVEQIEPAGPGGAVRFVRRELGTRAFGINQFVLEPG |
| Ga0210077_11355782 | 3300025952 | Natural And Restored Wetlands | MNYSVVNVHEMEPGGRTGRVKFVRRELGVEAFGLNWFELPPDT |
| Ga0207712_108369501 | 3300025961 | Switchgrass Rhizosphere | MGYSMVQIGDIEPAGPGGVVRFLRREIGAQAFGVNWFELP |
| Ga0207668_113683451 | 3300025972 | Switchgrass Rhizosphere | MAYSIVRVDEIEGSGPGGAVHFVRRELGVGAFGINW |
| Ga0207708_116030983 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | MGYSMVHVKDIEGSGPGGAVHFVRRELGAEAFGIN |
| Ga0207702_103123341 | 3300026078 | Corn Rhizosphere | MGYSFKNIEDIDGAGPGGAVRFVRRELGLEAFGINWFRMASL |
| Ga0207648_122854721 | 3300026089 | Miscanthus Rhizosphere | VAYSVVNVEEIEAEGPGGAVRYVRRNLGVQAFGINWFELAPNVR |
| Ga0207674_101720901 | 3300026116 | Corn Rhizosphere | MAYSLVHIDDIEPSGPGGAVRFVRRELGVEAFGINRFDLPPNRE |
| Ga0209153_10330802 | 3300026312 | Soil | MGYSVVKVADIEPAGPGNAVRFVRRELGVEAFGVNWFQQPQ |
| Ga0209154_11302402 | 3300026317 | Soil | MAYSLVNIDEIEPGGRTGMVKFVRRELGIEAFGLNWFELPPSTEGVEHHE |
| Ga0209474_101316051 | 3300026550 | Soil | MGYSVVHLDEIEPGGPGGAVRFVRRALGVEAFGINWFELP |
| Ga0209577_103725332 | 3300026552 | Soil | MGYSKVNVHDLEPAGPGGAIRYVRRELDLLAFGINWFE |
| Ga0207461_10018171 | 3300026929 | Soil | VGYSIVRVDELEGSGPGGSVRFVRRELGVEAFGINWFDLPPDAE |
| Ga0209999_10541092 | 3300027543 | Arabidopsis Thaliana Rhizosphere | MGYSVAHVDELEPEGPGGMVRFVRRALGVEAFGINWYELPA |
| Ga0209178_11289522 | 3300027725 | Agricultural Soil | MAYSLVHIDDIEPSGPGGAVRFVRRALGVEAFGINRFDLAAGREGI |
| Ga0209073_101158803 | 3300027765 | Agricultural Soil | VGYSIVQVDDLPSEGPGGSVRFVRRHLGVGAFGINWFEFPPNVE |
| Ga0209073_101390964 | 3300027765 | Agricultural Soil | MGYTVVNVDEIEPAGPGGAVRFVRRELGVQAFGINRFDIGP |
| Ga0209060_100970552 | 3300027826 | Surface Soil | VAYSVVHLDDIEPAGPGAAVKFVRRELGVEAFGVNWFDVPANFAGP |
| Ga0209590_108661551 | 3300027882 | Vadose Zone Soil | MGYSVAHIDEIDGAGPGGSVHFVRRVLGVEAFGINWFEIAPNSDG |
| Ga0209382_116824562 | 3300027909 | Populus Rhizosphere | MAYSIAHVDDIEGTGPGGAVHFVRRELGVEAFGINWF |
| Ga0247683_10144052 | 3300027991 | Soil | MGYSMVHVKDIEGSGPGGAVHFVRRELGAEAFGINWFDLPPNSEGF |
| Ga0247675_10328131 | 3300028072 | Soil | MGYSVVHIDELEPSGPGGAIRFVRRELGVEAFGINWFE |
| Ga0307295_102085932 | 3300028708 | Soil | MGYSKVNVHDLEPAGPGGAIRFVRRELDLLAFGINWFEISPNGDGHQ |
| Ga0307295_102506401 | 3300028708 | Soil | MGYSVAHVDELKPEGPGGMVRFVRRALGVEAFGVNW |
| Ga0307303_100965801 | 3300028713 | Soil | MGYSLAHVEDIEGSGPGGAVHFVRRELGVEAFGVNWF |
| Ga0307313_102227243 | 3300028715 | Soil | VGYSMVQVDDLPAEGPGGAVRFVRRHLGVSAFGINWFEFAPN |
| Ga0307307_102808341 | 3300028718 | Soil | MGYSKVNVNDIEPAGPGGAVRFVRRELDLQAFGINWFELPPNADGNY |
| Ga0307301_100853262 | 3300028719 | Soil | MGYSKVNVHDLEPAGPGGAIRFVRRELDLLAFGINWFEISPKGD |
| Ga0307316_101083251 | 3300028755 | Soil | VGYSMVQVDDLPPEGPGGAVRFVRRHLGVGAFGINWFE |
| Ga0307316_101338261 | 3300028755 | Soil | VGYSVVNVEEIEGAGPGGAVRFVRRQLGVQAFGINWFELA |
| Ga0307316_103514941 | 3300028755 | Soil | MGYSKVNVHDLEPAGPGGVVRFVRRELDLLAFGINWFEIPPN |
| Ga0307280_100016581 | 3300028768 | Soil | VSYSIVNVDEIEGGGPGGGFRFVRRELGVGAFGINW |
| Ga0307280_100651401 | 3300028768 | Soil | MGYSVKSVEDIEGAGPGGAVRFVRRELGLEAFGINWFE |
| Ga0307282_101315323 | 3300028784 | Soil | VGYSMVQVDDLPPEGPGGAVRFVRRHLGVGAFGINWFEI |
| Ga0307282_102139652 | 3300028784 | Soil | VGYSLVNVEEIEVSGPGGAVRFVRRELGVEAFGINWYELPPNTEGREG |
| Ga0307282_104993801 | 3300028784 | Soil | MGYSLVRLGDIEPGGPGGAVRFVRRELGVEAFGINCFEIPPLSEGR |
| Ga0265338_110328002 | 3300028800 | Rhizosphere | MSYSVVNVDEIEPGGRTGVVKFVRRALGVEAFGINWFELPPNA |
| Ga0307286_102212912 | 3300028876 | Soil | MGYSLVHVEDIEGSGPGGAVHFVRRELGVEAFGVNWFE |
| Ga0307286_102249471 | 3300028876 | Soil | VGYSVVNVEEIEGAGPGGAVRFVRRQLGVQAFGINWFE |
| Ga0307300_101284391 | 3300028880 | Soil | VGYSVVNVEEIEGEGPGGAVRFVRRNLGVQAFGINWFE |
| Ga0307304_104176193 | 3300028885 | Soil | VGYSMVQVDDLPAEGPGGSVRFVRRHLGVGAFGIN |
| Ga0247827_109867281 | 3300028889 | Soil | VGYSKLNVHELDGAGPGGAVRFVRRELGAEAFGINWFELGPDV |
| Ga0247826_100858195 | 3300030336 | Soil | MGYSTLDADEIEGAGPGGAVRFVRRELGVEAFGINWFELAP |
| Ga0247826_113252901 | 3300030336 | Soil | MSYSMIHVDKVEASGPGGAVRFVRRVLGVEAFGINWFEIP |
| Ga0302184_100735822 | 3300030490 | Palsa | MPYSVVNVDEVEGTGPGGAVHFVRRELGVEAFGINWFELPP |
| Ga0302308_108503642 | 3300031027 | Palsa | MPYSVVNVDEVEGTGPGGAVHFVRRELGVEAFGINWFELPPN |
| Ga0307497_102764112 | 3300031226 | Soil | MAYSIAHVDEIEPGGPGGAVRFVRRELGVEAFGINWFELGPNV |
| Ga0307497_103860892 | 3300031226 | Soil | MGYSLAHVDEIEPDGPGGAVRFVRRELGVNAFGINWFELPPNA |
| Ga0307497_107679262 | 3300031226 | Soil | VGYSIVRVDELEGSGPGGAVHFVRRELGVEAFGINWFELPPNADGF |
| Ga0302323_1018875872 | 3300031232 | Fen | MGYSVLKIDEVEGVGPGGAVKFLRRELGVEAFGVNWFELAPNVKGVEH |
| Ga0265320_101322122 | 3300031240 | Rhizosphere | MSYSVVNVDEIEPGGRTGMVKFVRRALGVEAFGINWFEL |
| Ga0318516_101110421 | 3300031543 | Soil | MSYSIVHLDDIEPGGPGGAVRFVRRELEVGAFGIN |
| Ga0310887_101415383 | 3300031547 | Soil | VGYSVVNVEEIEGEGPGGAVRFVRRKLGVQAFGINWFELGPNVRGR |
| Ga0310887_108446641 | 3300031547 | Soil | MGYSMIHVDEVEPAGPGGGVRFVRRVLGVEAFGINWFEIPP |
| Ga0318555_104475021 | 3300031640 | Soil | VGYTVVNVEDIEGAGPGGAVRFVRRELGLEAFGINWFELP |
| Ga0310813_107065033 | 3300031716 | Soil | MGYSVKNVDDIEGAGPGGAVRFVRRELGLEAFGINWFELPPGTP |
| Ga0306917_107363572 | 3300031719 | Soil | MGYSIVDVAEIDGSGPGGAVRFVRRELGCEAFGLNWFE |
| Ga0318493_102307571 | 3300031723 | Soil | MGYTVVNVEDIEGAGPGGAVRFVRRELGLEAFGINWFELP |
| Ga0318500_101688332 | 3300031724 | Soil | MGYSIVDVAEIDGSGPGGAVRFVRRELGCEAFGLNWFELPP |
| Ga0318502_108070101 | 3300031747 | Soil | MGYSVVHLDEIEPGGPGGAVRFVRRELEVGAFGINWFELPPE |
| Ga0318546_104081672 | 3300031771 | Soil | MGYSVVNVEEIEPAGPGGAVRFLRRALGVEAFGINWFELPPGARRRNR |
| Ga0310892_104251062 | 3300031858 | Soil | MGYSLAHVDDIEPGGPGGAVRFVRRELGVEAFGIN |
| Ga0306925_108363461 | 3300031890 | Soil | MGYSVVNVEEIEGAGPGGAVRFVRRELGLEAFGINWFELPPGAE |
| Ga0307412_119685571 | 3300031911 | Rhizosphere | VSYSVADLDALEPGGPGGMVRFVRKALGTRAFGCNYF |
| Ga0306926_104271521 | 3300031954 | Soil | VGYTVVNVEDIEGAGPGGAVRFVRRELGLEAFGIN |
| Ga0318507_103340252 | 3300032025 | Soil | MGYSVVNVEEIEPAGPGGAVRFLRRALGVEAFGINWFELPPGAE |
| Ga0318556_107554713 | 3300032043 | Soil | MGYSTINVDDIEGSGPGGAVRFVRRELGVEAFGINWFE |
| Ga0318510_104679201 | 3300032064 | Soil | MGYSVVNVEEIAGSGPGGAVRFVRRELGCEAFGINWFGLPPD |
| Ga0318513_102765971 | 3300032065 | Soil | MSYSIVHLDDIEPGGPGGAVRFVRRELEVGAFGINWF |
| Ga0318513_103810651 | 3300032065 | Soil | VGYTVVNVEDIEGAGPGGAVRFVRRELGLEAFGINWFELPPG |
| Ga0308173_104105132 | 3300032074 | Soil | MGYSTVNVDDIEGSGPGGAVHFVRRVLGVEAFGVNW |
| Ga0307472_1013254213 | 3300032205 | Hardwood Forest Soil | MGYSVVDVEEIEGSGPGGAVRFVRRELGLEAFGINWFELPP |
| Ga0335085_120036392 | 3300032770 | Soil | MGYTVINVDEVEPGGKTGAVRFTRRALGVEAFGINWFDL |
| Ga0335082_117131622 | 3300032782 | Soil | MGYSVVNVNEMEPGGRTGVIKFVRRELGLEAFGLNWFELPPDT |
| Ga0335079_123138951 | 3300032783 | Soil | VRPVGYSVLNVDDIEGSGPGGVIRFVRRELGVEAFGINWFEIPPNAE |
| Ga0335069_109287151 | 3300032893 | Soil | MGYSVVNVEEIEGAGPGGAVRFVRRELGLEAFGINWFEL |
| Ga0335083_101862631 | 3300032954 | Soil | MGYSIVDVADIEGSGPGGAVRFVRRELGCEAFGLNWF |
| Ga0310810_112993171 | 3300033412 | Soil | VAYTIVHVDDVEPAGPGGAVRFVRRELGVEAFGINWFEIPPKTEGL |
| Ga0310811_107857881 | 3300033475 | Soil | MGYSVVNVDEIEGAGPGGAVRFVRRELGCEAFGIN |
| Ga0326732_10636691 | 3300033501 | Peat Soil | MGFSKINVEETEGGGPTGAFHFVRRELGVEAFGINWIDLPPGA |
| Ga0247829_110557211 | 3300033550 | Soil | MGHRVVDVEQIEPAGPGGAVRFVRRELGTRAFGINQFVLEPGFAGPE |
| Ga0247830_104659522 | 3300033551 | Soil | VGYSKVNVHELDGAGPGGAVRFVRRELGAEAFGINWFELG |
| Ga0247830_107951353 | 3300033551 | Soil | MGYSTLDADEIEGAGPGGAVRFVRRELGVEAFGINWFELAPGAEGL |
| Ga0314864_0090738_3_134 | 3300033805 | Peatland | VGYSVVHADEVESGGAVRFIRRELGCEAFGVNWFELPPNTAGFE |
| Ga0364933_149293_482_604 | 3300034150 | Sediment | MGYSVAHVDELEPAGPGGMVRFVRRALGVEAFGVNWYELPA |
| Ga0364923_0213740_1_129 | 3300034690 | Sediment | VAYSVVHVDDIEGAGPGGAVRFVRRALDVEAFGINWIELGPGV |
| ⦗Top⦘ |