NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F013917

Metagenome / Metatranscriptome Family F013917

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F013917
Family Type Metagenome / Metatranscriptome
Number of Sequences 267
Average Sequence Length 43 residues
Representative Sequence LIAQLADPSTEVKVEGINYFADTLLFAGAILALASATPRTD
Number of Associated Samples 207
Number of Associated Scaffolds 267

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.75 %
% of genes near scaffold ends (potentially truncated) 96.63 %
% of genes from short scaffolds (< 2000 bps) 88.01 %
Associated GOLD sequencing projects 192
AlphaFold2 3D model prediction Yes
3D model pTM-score0.59

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (94.382 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(15.730 % of family members)
Environment Ontology (ENVO) Unclassified
(27.341 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(49.064 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 46.38%    β-sheet: 0.00%    Coil/Unstructured: 53.62%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.59
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 267 Family Scaffolds
PF11412DsbC 6.74
PF01979Amidohydro_1 3.00
PF01207Dus 2.62
PF00578AhpC-TSA 2.25
PF13620CarboxypepD_reg 1.87
PF02635DrsE 1.50
PF01850PIN 1.12
PF13442Cytochrome_CBB3 1.12
PF02604PhdYeFM_antitox 0.75
PF00990GGDEF 0.75
PF13376OmdA 0.75
PF13186SPASM 0.75
PF00480ROK 0.75
PF00873ACR_tran 0.75
PF13676TIR_2 0.37
PF12867DinB_2 0.37
PF13480Acetyltransf_6 0.37
PF12850Metallophos_2 0.37
PF02687FtsX 0.37
PF13649Methyltransf_25 0.37
PF02683DsbD 0.37
PF01408GFO_IDH_MocA 0.37
PF12146Hydrolase_4 0.37
PF01546Peptidase_M20 0.37
PF05768Glrx-like 0.37
PF00903Glyoxalase 0.37
PF00365PFK 0.37
PF13519VWA_2 0.37
PF01541GIY-YIG 0.37
PF04011LemA 0.37
PF09285Elong-fact-P_C 0.37
PF00882Zn_dep_PLPC 0.37
PF01042Ribonuc_L-PSP 0.37
PF01066CDP-OH_P_transf 0.37
PF02517Rce1-like 0.37
PF13414TPR_11 0.37
PF13744HTH_37 0.37
PF04978DUF664 0.37
PF08818DUF1801 0.37
PF04229GrpB 0.37
PF08207EFP_N 0.37
PF08240ADH_N 0.37
PF00795CN_hydrolase 0.37
PF01144CoA_trans 0.37
PF15902Sortilin-Vps10 0.37
PF12833HTH_18 0.37
PF04185Phosphoesterase 0.37
PF14236DUF4338 0.37
PF10431ClpB_D2-small 0.37
PF07690MFS_1 0.37
PF14279HNH_5 0.37
PF07927HicA_toxin 0.37
PF13147Obsolete Pfam Family 0.37
PF02518HATPase_c 0.37
PF12681Glyoxalase_2 0.37
PF10385RNA_pol_Rpb2_45 0.37
PF13650Asp_protease_2 0.37
PF03764EFG_IV 0.37
PF00004AAA 0.37
PF05988DUF899 0.37
PF02873MurB_C 0.37
PF01406tRNA-synt_1e 0.37
PF13565HTH_32 0.37
PF00145DNA_methylase 0.37
PF02492cobW 0.37
PF00586AIRS 0.37
PF16036Chalcone_3 0.37
PF13472Lipase_GDSL_2 0.37
PF11752DUF3309 0.37
PF07238PilZ 0.37
PF12840HTH_20 0.37
PF00413Peptidase_M10 0.37
PF01618MotA_ExbB 0.37
PF09972DUF2207 0.37
PF02806Alpha-amylase_C 0.37
PF02366PMT 0.37
PF08388GIIM 0.37
PF02073Peptidase_M29 0.37
PF00083Sugar_tr 0.37
PF00027cNMP_binding 0.37
PF00805Pentapeptide 0.37
PF03576Peptidase_S58 0.37
PF04055Radical_SAM 0.37
PF01557FAA_hydrolase 0.37
PF13470PIN_3 0.37
PF00561Abhydrolase_1 0.37
PF06114Peptidase_M78 0.37

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 267 Family Scaffolds
COG0042tRNA-dihydrouridine synthaseTranslation, ribosomal structure and biogenesis [J] 2.62
COG1940Sugar kinase of the NBD/HSP70 family, may contain an N-terminal HTH domainTranscription [K] 1.50
COG4118Antitoxin component of toxin-antitoxin stability system, DNA-binding transcriptional repressorDefense mechanisms [V] 0.75
COG2161Antitoxin component YafN of the YafNO toxin-antitoxin module, PHD/YefM familyDefense mechanisms [V] 0.75
COG3191L-aminopeptidase/D-esteraseAmino acid transport and metabolism [E] 0.75
COG5050sn-1,2-diacylglycerol ethanolamine- and cholinephosphotranferasesLipid transport and metabolism [I] 0.37
COG4670Acyl CoA:acetate/3-ketoacid CoA transferaseLipid transport and metabolism [I] 0.37
COG4449Predicted protease, Abi (CAAX) familyGeneral function prediction only [R] 0.37
COG4430Uncharacterized conserved protein YdeI, YjbR/CyaY-like superfamily, DUF1801 familyFunction unknown [S] 0.37
COG4312Predicted dithiol-disulfide oxidoreductase, DUF899 familyGeneral function prediction only [R] 0.37
COG5649Uncharacterized conserved protein, DUF1801 domainFunction unknown [S] 0.37
COG3511Phospholipase CCell wall/membrane/envelope biogenesis [M] 0.37
COG5549Predicted Zn-dependent proteasePosttranslational modification, protein turnover, chaperones [O] 0.37
COG3118Chaperedoxin CnoX, contains thioredoxin-like and TPR-like domains, YbbN/TrxSC familyPosttranslational modification, protein turnover, chaperones [O] 0.37
COG2320GrpB domain, predicted nucleotidyltransferase, UPF0157 familyGeneral function prediction only [R] 0.37
COG2309Leucyl aminopeptidase (aminopeptidase T)Amino acid transport and metabolism [E] 0.37
COG5646Iron-binding protein Fra/YdhG, frataxin family (Fe-S cluster biosynthesis)Posttranslational modification, protein turnover, chaperones [O] 0.37
COG2057Acyl-CoA:acetate/3-ketoacid CoA transferase, beta subunitLipid transport and metabolism [I] 0.37
COG0018Arginyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 0.37
COG1788Acyl CoA:acetate/3-ketoacid CoA transferase, alpha subunitLipid transport and metabolism [I] 0.37
COG0480Translation elongation factor EF-G, a GTPaseTranslation, ribosomal structure and biogenesis [J] 0.37
COG0143Methionyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 0.37
COG02056-phosphofructokinaseCarbohydrate transport and metabolism [G] 0.37
COG0215Cysteinyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 0.37
COG0231Translation elongation factor P (EF-P)/translation initiation factor 5A (eIF-5A)Translation, ribosomal structure and biogenesis [J] 0.37
COG0251Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 familyDefense mechanisms [V] 0.37
COG0270DNA-cytosine methylaseReplication, recombination and repair [L] 0.37
COG02961,4-alpha-glucan branching enzymeCarbohydrate transport and metabolism [G] 0.37
COG0366Glycosidase/amylase (phosphorylase)Carbohydrate transport and metabolism [G] 0.37
COG1724Predicted RNA binding protein YcfA, dsRBD-like fold, HicA-like mRNA interferase familyGeneral function prediction only [R] 0.37
COG0558Phosphatidylglycerophosphate synthaseLipid transport and metabolism [I] 0.37
COG0695GlutaredoxinPosttranslational modification, protein turnover, chaperones [O] 0.37
COG0812UDP-N-acetylenolpyruvoylglucosamine reductaseCell wall/membrane/envelope biogenesis [M] 0.37
COG1183Phosphatidylserine synthaseLipid transport and metabolism [I] 0.37
COG1266Membrane protease YdiL, CAAX protease familyPosttranslational modification, protein turnover, chaperones [O] 0.37
COG1357Uncharacterized conserved protein YjbI, contains pentapeptide repeatsFunction unknown [S] 0.37
COG1523Pullulanase/glycogen debranching enzymeCarbohydrate transport and metabolism [G] 0.37
COG1704Magnetosome formation protein MamQ, lipoprotein antigen LemA familyCell wall/membrane/envelope biogenesis [M] 0.37


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms94.38 %
UnclassifiedrootN/A5.62 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2189573003|GZIR7W402J143LAll Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium504Open in IMG/M
3300001159|JGI12650J13346_1006250All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia570Open in IMG/M
3300001356|JGI12269J14319_10076204All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1815Open in IMG/M
3300002245|JGIcombinedJ26739_100097653All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis2748Open in IMG/M
3300002245|JGIcombinedJ26739_100437617All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1185Open in IMG/M
3300002245|JGIcombinedJ26739_101294228All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus620Open in IMG/M
3300002886|JGI25612J43240_1055328All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus595Open in IMG/M
3300004080|Ga0062385_10537943Not Available728Open in IMG/M
3300004082|Ga0062384_101262077All Organisms → cellular organisms → Bacteria → Acidobacteria539Open in IMG/M
3300004091|Ga0062387_100150828All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1338Open in IMG/M
3300004092|Ga0062389_102278913All Organisms → cellular organisms → Bacteria714Open in IMG/M
3300004157|Ga0062590_102335046All Organisms → cellular organisms → Bacteria → Acidobacteria563Open in IMG/M
3300004479|Ga0062595_101086760All Organisms → cellular organisms → Bacteria → Acidobacteria697Open in IMG/M
3300004631|Ga0058899_11799775All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae664Open in IMG/M
3300004633|Ga0066395_10524945All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae685Open in IMG/M
3300005328|Ga0070676_11519567All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales516Open in IMG/M
3300005435|Ga0070714_102189482All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium538Open in IMG/M
3300005436|Ga0070713_101459527All Organisms → cellular organisms → Bacteria → Acidobacteria664Open in IMG/M
3300005445|Ga0070708_100655154All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingobium → unclassified Sphingobium → Sphingobium sp. AP50989Open in IMG/M
3300005518|Ga0070699_101650709All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae587Open in IMG/M
3300005542|Ga0070732_10661088All Organisms → cellular organisms → Bacteria → Acidobacteria635Open in IMG/M
3300005576|Ga0066708_10031319All Organisms → cellular organisms → Bacteria → Acidobacteria2841Open in IMG/M
3300005602|Ga0070762_10020120All Organisms → cellular organisms → Bacteria3475Open in IMG/M
3300005602|Ga0070762_10050609All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter2288Open in IMG/M
3300005602|Ga0070762_10174736All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter1300Open in IMG/M
3300005602|Ga0070762_10712770All Organisms → cellular organisms → Bacteria674Open in IMG/M
3300005610|Ga0070763_10658145All Organisms → cellular organisms → Bacteria → Acidobacteria611Open in IMG/M
3300005615|Ga0070702_101105507All Organisms → cellular organisms → Bacteria → Acidobacteria634Open in IMG/M
3300005712|Ga0070764_10075297All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1768Open in IMG/M
3300005712|Ga0070764_10218882All Organisms → cellular organisms → Bacteria → Acidobacteria1074Open in IMG/M
3300005719|Ga0068861_100073312All Organisms → cellular organisms → Bacteria2659Open in IMG/M
3300005719|Ga0068861_101595761All Organisms → cellular organisms → Bacteria643Open in IMG/M
3300005921|Ga0070766_10158885All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter1390Open in IMG/M
3300005921|Ga0070766_10592168All Organisms → cellular organisms → Bacteria → Acidobacteria744Open in IMG/M
3300005921|Ga0070766_11276331All Organisms → cellular organisms → Bacteria509Open in IMG/M
3300005921|Ga0070766_11302442All Organisms → cellular organisms → Bacteria503Open in IMG/M
3300006028|Ga0070717_12087632Not Available510Open in IMG/M
3300006046|Ga0066652_101605274Not Available598Open in IMG/M
3300006051|Ga0075364_10446374All Organisms → cellular organisms → Bacteria → Acidobacteria884Open in IMG/M
3300006052|Ga0075029_100342772All Organisms → cellular organisms → Bacteria → Acidobacteria962Open in IMG/M
3300006052|Ga0075029_101092167All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 83554Open in IMG/M
3300006059|Ga0075017_101143947All Organisms → cellular organisms → Bacteria609Open in IMG/M
3300006102|Ga0075015_100112709All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1379Open in IMG/M
3300006102|Ga0075015_100295553All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium889Open in IMG/M
3300006102|Ga0075015_100684401All Organisms → cellular organisms → Bacteria → Acidobacteria607Open in IMG/M
3300006162|Ga0075030_100650031All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 89835Open in IMG/M
3300006175|Ga0070712_101358755All Organisms → cellular organisms → Bacteria620Open in IMG/M
3300006176|Ga0070765_100063890All Organisms → cellular organisms → Bacteria3060Open in IMG/M
3300006176|Ga0070765_100822839All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae878Open in IMG/M
3300006176|Ga0070765_102144410All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 83522Open in IMG/M
3300006797|Ga0066659_11170546All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium642Open in IMG/M
3300006893|Ga0073928_11191826All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae513Open in IMG/M
3300006904|Ga0075424_102755057All Organisms → cellular organisms → Bacteria513Open in IMG/M
3300009089|Ga0099828_10751279All Organisms → cellular organisms → Bacteria → Acidobacteria875Open in IMG/M
3300009089|Ga0099828_11427011All Organisms → cellular organisms → Bacteria → Acidobacteria611Open in IMG/M
3300009174|Ga0105241_12301126All Organisms → cellular organisms → Bacteria → Acidobacteria → Holophagae → Holophagales → Holophagaceae → unclassified Holophagaceae → Holophagaceae bacterium536Open in IMG/M
3300009518|Ga0116128_1206648All Organisms → cellular organisms → Bacteria → Acidobacteria551Open in IMG/M
3300009525|Ga0116220_10538769All Organisms → cellular organisms → Bacteria → Acidobacteria532Open in IMG/M
3300009525|Ga0116220_10610021All Organisms → cellular organisms → Bacteria → Acidobacteria502Open in IMG/M
3300009628|Ga0116125_1153992All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium638Open in IMG/M
3300009637|Ga0116118_1267286All Organisms → cellular organisms → Bacteria → Acidobacteria522Open in IMG/M
3300009644|Ga0116121_1259596All Organisms → cellular organisms → Bacteria → Acidobacteria557Open in IMG/M
3300009698|Ga0116216_10109557All Organisms → cellular organisms → Bacteria1700Open in IMG/M
3300009759|Ga0116101_1026961All Organisms → cellular organisms → Bacteria → Acidobacteria1157Open in IMG/M
3300009839|Ga0116223_10153672All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1427Open in IMG/M
3300010048|Ga0126373_10400007All Organisms → cellular organisms → Bacteria → Acidobacteria1398Open in IMG/M
3300010048|Ga0126373_12021945All Organisms → cellular organisms → Bacteria639Open in IMG/M
3300010048|Ga0126373_12383432All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales → Isosphaeraceae589Open in IMG/M
3300010159|Ga0099796_10405740Not Available598Open in IMG/M
3300010339|Ga0074046_10478233All Organisms → cellular organisms → Bacteria → Acidobacteria745Open in IMG/M
3300010359|Ga0126376_12599704All Organisms → cellular organisms → Bacteria555Open in IMG/M
3300010362|Ga0126377_10312444All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → Sorangium → Sorangium cellulosum1554Open in IMG/M
3300010362|Ga0126377_13623214All Organisms → cellular organisms → Bacteria → Acidobacteria500Open in IMG/M
3300011120|Ga0150983_11415826All Organisms → cellular organisms → Bacteria → Proteobacteria551Open in IMG/M
3300011269|Ga0137392_10120010All Organisms → cellular organisms → Bacteria → Acidobacteria2096Open in IMG/M
3300011270|Ga0137391_10710766All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia834Open in IMG/M
3300012199|Ga0137383_10645603All Organisms → cellular organisms → Bacteria → Acidobacteria774Open in IMG/M
3300012206|Ga0137380_10221577All Organisms → cellular organisms → Bacteria → Acidobacteria1710Open in IMG/M
3300012212|Ga0150985_110404692All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium1232Open in IMG/M
3300012362|Ga0137361_11300058All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076652Open in IMG/M
3300012363|Ga0137390_10952562All Organisms → cellular organisms → Bacteria → Acidobacteria812Open in IMG/M
3300012683|Ga0137398_10624731All Organisms → cellular organisms → Bacteria746Open in IMG/M
3300012685|Ga0137397_10992300All Organisms → cellular organisms → Bacteria618Open in IMG/M
3300012917|Ga0137395_11205176Not Available529Open in IMG/M
3300012923|Ga0137359_10326940All Organisms → cellular organisms → Bacteria1364Open in IMG/M
3300012923|Ga0137359_10349110All Organisms → cellular organisms → Bacteria1315Open in IMG/M
3300012924|Ga0137413_11788454All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia507Open in IMG/M
3300012925|Ga0137419_10413184All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella rosea1056Open in IMG/M
3300012927|Ga0137416_10238390All Organisms → cellular organisms → Bacteria1480Open in IMG/M
3300012929|Ga0137404_10246463All Organisms → cellular organisms → Bacteria1532Open in IMG/M
3300012957|Ga0164303_10111755All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus1376Open in IMG/M
3300012958|Ga0164299_11021920All Organisms → cellular organisms → Bacteria → Acidobacteria611Open in IMG/M
3300012961|Ga0164302_10609130Not Available793Open in IMG/M
3300012985|Ga0164308_10488469Not Available1027Open in IMG/M
3300013306|Ga0163162_11860758All Organisms → cellular organisms → Bacteria689Open in IMG/M
3300013308|Ga0157375_10118409All Organisms → cellular organisms → Bacteria2755Open in IMG/M
3300014164|Ga0181532_10785199All Organisms → cellular organisms → Bacteria → Acidobacteria511Open in IMG/M
3300014166|Ga0134079_10080012All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1211Open in IMG/M
3300014167|Ga0181528_10165276All Organisms → cellular organisms → Bacteria1197Open in IMG/M
3300014489|Ga0182018_10009163All Organisms → cellular organisms → Bacteria → Acidobacteria7298Open in IMG/M
3300014654|Ga0181525_10115629All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1478Open in IMG/M
3300014658|Ga0181519_10098292All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1895Open in IMG/M
3300015054|Ga0137420_1055781Not Available1145Open in IMG/M
3300015054|Ga0137420_1145296All Organisms → cellular organisms → Bacteria745Open in IMG/M
3300015264|Ga0137403_10684612All Organisms → cellular organisms → Bacteria → Acidobacteria886Open in IMG/M
3300015372|Ga0132256_102412000All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae628Open in IMG/M
3300015374|Ga0132255_104777190All Organisms → cellular organisms → Bacteria → Acidobacteria574Open in IMG/M
3300017822|Ga0187802_10277897All Organisms → cellular organisms → Bacteria → Acidobacteria651Open in IMG/M
3300017930|Ga0187825_10386878All Organisms → cellular organisms → Bacteria535Open in IMG/M
3300017932|Ga0187814_10091018All Organisms → cellular organisms → Bacteria → Acidobacteria1123Open in IMG/M
3300017933|Ga0187801_10436470All Organisms → cellular organisms → Bacteria → Acidobacteria548Open in IMG/M
3300017947|Ga0187785_10021265All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Marinilabiliales → Prolixibacteraceae → unclassified Prolixibacteraceae → Prolixibacteraceae bacterium2296Open in IMG/M
3300017955|Ga0187817_10149218All Organisms → cellular organisms → Bacteria → Acidobacteria1486Open in IMG/M
3300017972|Ga0187781_10394633All Organisms → cellular organisms → Bacteria → Acidobacteria987Open in IMG/M
3300017975|Ga0187782_10268631All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1284Open in IMG/M
3300017988|Ga0181520_11069514All Organisms → cellular organisms → Bacteria → Acidobacteria531Open in IMG/M
3300017995|Ga0187816_10270665All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus743Open in IMG/M
3300018001|Ga0187815_10158405All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae958Open in IMG/M
3300018005|Ga0187878_1090463All Organisms → cellular organisms → Bacteria → Acidobacteria1269Open in IMG/M
3300018006|Ga0187804_10007306All Organisms → cellular organisms → Bacteria3657Open in IMG/M
3300018006|Ga0187804_10150687All Organisms → cellular organisms → Bacteria → Acidobacteria980Open in IMG/M
3300018007|Ga0187805_10501923All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus569Open in IMG/M
3300018012|Ga0187810_10426623All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus560Open in IMG/M
3300018012|Ga0187810_10446237All Organisms → cellular organisms → Bacteria → Acidobacteria548Open in IMG/M
3300018013|Ga0187873_1108270All Organisms → cellular organisms → Bacteria → Acidobacteria1093Open in IMG/M
3300018035|Ga0187875_10759661All Organisms → cellular organisms → Bacteria → Acidobacteria508Open in IMG/M
3300018038|Ga0187855_10118027All Organisms → cellular organisms → Bacteria → Acidobacteria1594Open in IMG/M
3300018038|Ga0187855_10277753All Organisms → cellular organisms → Bacteria → Acidobacteria981Open in IMG/M
3300018043|Ga0187887_10121180All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1571Open in IMG/M
3300018058|Ga0187766_10463902All Organisms → cellular organisms → Bacteria → Acidobacteria847Open in IMG/M
3300019881|Ga0193707_1143628All Organisms → cellular organisms → Bacteria → Acidobacteria673Open in IMG/M
3300020140|Ga0179590_1093612All Organisms → cellular organisms → Bacteria → Acidobacteria806Open in IMG/M
3300020579|Ga0210407_10830257All Organisms → cellular organisms → Bacteria711Open in IMG/M
3300020579|Ga0210407_11088090All Organisms → cellular organisms → Bacteria → Acidobacteria606Open in IMG/M
3300020580|Ga0210403_10920295All Organisms → cellular organisms → Bacteria → Acidobacteria689Open in IMG/M
3300020581|Ga0210399_10043746All Organisms → cellular organisms → Bacteria3590Open in IMG/M
3300020583|Ga0210401_10691623All Organisms → cellular organisms → Bacteria880Open in IMG/M
3300020583|Ga0210401_11116423All Organisms → cellular organisms → Bacteria → Acidobacteria647Open in IMG/M
3300021168|Ga0210406_11045316All Organisms → cellular organisms → Bacteria605Open in IMG/M
3300021170|Ga0210400_10093575Not Available2374Open in IMG/M
3300021171|Ga0210405_10347114All Organisms → cellular organisms → Bacteria1171Open in IMG/M
3300021180|Ga0210396_10023300All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales5732Open in IMG/M
3300021180|Ga0210396_11580098All Organisms → cellular organisms → Bacteria → Acidobacteria536Open in IMG/M
3300021181|Ga0210388_11085448All Organisms → cellular organisms → Bacteria → Acidobacteria683Open in IMG/M
3300021181|Ga0210388_11422519All Organisms → cellular organisms → Bacteria581Open in IMG/M
3300021401|Ga0210393_10727599All Organisms → cellular organisms → Bacteria809Open in IMG/M
3300021401|Ga0210393_10801903All Organisms → cellular organisms → Bacteria → Acidobacteria766Open in IMG/M
3300021401|Ga0210393_11457142All Organisms → cellular organisms → Bacteria546Open in IMG/M
3300021402|Ga0210385_10008756All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis6132Open in IMG/M
3300021402|Ga0210385_10935032All Organisms → cellular organisms → Bacteria → Acidobacteria666Open in IMG/M
3300021403|Ga0210397_10632766All Organisms → cellular organisms → Bacteria → Acidobacteria819Open in IMG/M
3300021405|Ga0210387_10479533All Organisms → cellular organisms → Bacteria1105Open in IMG/M
3300021405|Ga0210387_10955581All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium752Open in IMG/M
3300021405|Ga0210387_11001052All Organisms → cellular organisms → Bacteria → Acidobacteria732Open in IMG/M
3300021405|Ga0210387_11312151All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis → Candidatus Koribacter versatilis Ellin345625Open in IMG/M
3300021406|Ga0210386_10246849All Organisms → cellular organisms → Bacteria → Acidobacteria1522Open in IMG/M
3300021407|Ga0210383_10335827All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1301Open in IMG/M
3300021407|Ga0210383_10431625All Organisms → cellular organisms → Bacteria1137Open in IMG/M
3300021420|Ga0210394_11129397All Organisms → cellular organisms → Bacteria → Acidobacteria675Open in IMG/M
3300021432|Ga0210384_11099298All Organisms → cellular organisms → Bacteria → Acidobacteria698Open in IMG/M
3300021433|Ga0210391_10459606All Organisms → cellular organisms → Bacteria → Acidobacteria999Open in IMG/M
3300021433|Ga0210391_10982747All Organisms → cellular organisms → Bacteria → Acidobacteria657Open in IMG/M
3300021474|Ga0210390_10289664All Organisms → cellular organisms → Bacteria → Acidobacteria1387Open in IMG/M
3300021474|Ga0210390_10805788All Organisms → cellular organisms → Bacteria → Acidobacteria777Open in IMG/M
3300021474|Ga0210390_11332977All Organisms → cellular organisms → Bacteria → Acidobacteria574Open in IMG/M
3300021475|Ga0210392_10562810All Organisms → cellular organisms → Bacteria → Acidobacteria844Open in IMG/M
3300021477|Ga0210398_10859222All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium728Open in IMG/M
3300021477|Ga0210398_11248800All Organisms → cellular organisms → Bacteria → Acidobacteria585Open in IMG/M
3300021478|Ga0210402_11405557All Organisms → cellular organisms → Bacteria → Acidobacteria625Open in IMG/M
3300021478|Ga0210402_12026701All Organisms → cellular organisms → Bacteria → Acidobacteria501Open in IMG/M
3300021559|Ga0210409_11207530All Organisms → cellular organisms → Bacteria → Acidobacteria632Open in IMG/M
3300021560|Ga0126371_11440426All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium819Open in IMG/M
3300022515|Ga0224546_1001312All Organisms → cellular organisms → Bacteria → Acidobacteria1216Open in IMG/M
3300022557|Ga0212123_10083646All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis2681Open in IMG/M
3300022557|Ga0212123_10167193All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1674Open in IMG/M
3300022557|Ga0212123_10207835All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1444Open in IMG/M
3300022722|Ga0242657_1223605All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium530Open in IMG/M
3300024288|Ga0179589_10467065Not Available583Open in IMG/M
3300025315|Ga0207697_10077874All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1394Open in IMG/M
3300025412|Ga0208194_1001827All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis4298Open in IMG/M
3300025414|Ga0208935_1036138All Organisms → cellular organisms → Bacteria → Acidobacteria656Open in IMG/M
3300025434|Ga0208690_1046555All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium683Open in IMG/M
3300025612|Ga0208691_1076004All Organisms → cellular organisms → Bacteria → Acidobacteria758Open in IMG/M
3300025898|Ga0207692_10310761All Organisms → cellular organisms → Bacteria → Proteobacteria962Open in IMG/M
3300025906|Ga0207699_10663972All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales762Open in IMG/M
3300025915|Ga0207693_11183261All Organisms → cellular organisms → Bacteria → Acidobacteria577Open in IMG/M
3300025928|Ga0207700_11144902All Organisms → cellular organisms → Bacteria → Acidobacteria695Open in IMG/M
3300025961|Ga0207712_10505348All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingobium → unclassified Sphingobium → Sphingobium sp. AP501034Open in IMG/M
3300025986|Ga0207658_11389909All Organisms → cellular organisms → Bacteria → Proteobacteria642Open in IMG/M
3300026551|Ga0209648_10117990All Organisms → cellular organisms → Bacteria2146Open in IMG/M
3300026551|Ga0209648_10789019All Organisms → cellular organisms → Bacteria519Open in IMG/M
3300026557|Ga0179587_10120139All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1611Open in IMG/M
3300026557|Ga0179587_10165221All Organisms → cellular organisms → Bacteria → Acidobacteria1386Open in IMG/M
3300027003|Ga0207722_1004866All Organisms → cellular organisms → Bacteria1658Open in IMG/M
3300027575|Ga0209525_1067661All Organisms → cellular organisms → Bacteria → Acidobacteria861Open in IMG/M
3300027629|Ga0209422_1005578All Organisms → cellular organisms → Bacteria3088Open in IMG/M
3300027641|Ga0208827_1042800All Organisms → cellular organisms → Bacteria1553Open in IMG/M
3300027648|Ga0209420_1146161All Organisms → cellular organisms → Bacteria → Acidobacteria650Open in IMG/M
3300027676|Ga0209333_1186168All Organisms → cellular organisms → Bacteria → Acidobacteria551Open in IMG/M
3300027729|Ga0209248_10226196All Organisms → cellular organisms → Bacteria548Open in IMG/M
3300027768|Ga0209772_10270025All Organisms → cellular organisms → Bacteria → Acidobacteria539Open in IMG/M
3300027787|Ga0209074_10136782All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium868Open in IMG/M
3300027812|Ga0209656_10338631All Organisms → cellular organisms → Bacteria → Acidobacteria687Open in IMG/M
3300027853|Ga0209274_10486132All Organisms → cellular organisms → Bacteria → Acidobacteria639Open in IMG/M
3300027855|Ga0209693_10056276All Organisms → cellular organisms → Bacteria1935Open in IMG/M
3300027862|Ga0209701_10029049All Organisms → cellular organisms → Bacteria3596Open in IMG/M
3300027862|Ga0209701_10353026All Organisms → cellular organisms → Bacteria → Acidobacteria831Open in IMG/M
3300027867|Ga0209167_10063279Not Available1838Open in IMG/M
3300027867|Ga0209167_10533401All Organisms → cellular organisms → Bacteria → Acidobacteria643Open in IMG/M
3300027867|Ga0209167_10569293All Organisms → cellular organisms → Bacteria620Open in IMG/M
3300027869|Ga0209579_10181771Not Available1125Open in IMG/M
3300027874|Ga0209465_10369893All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium718Open in IMG/M
3300027884|Ga0209275_10579487All Organisms → cellular organisms → Bacteria → Acidobacteria643Open in IMG/M
3300027889|Ga0209380_10863026All Organisms → cellular organisms → Bacteria → Acidobacteria510Open in IMG/M
3300027895|Ga0209624_11119521All Organisms → cellular organisms → Bacteria → Acidobacteria506Open in IMG/M
3300027903|Ga0209488_10695151All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_2_57_6729Open in IMG/M
3300028773|Ga0302234_10466336All Organisms → cellular organisms → Bacteria540Open in IMG/M
3300028781|Ga0302223_10234840All Organisms → cellular organisms → Bacteria → Acidobacteria605Open in IMG/M
3300028801|Ga0302226_10488352All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae514Open in IMG/M
3300028871|Ga0302230_10123346All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1025Open in IMG/M
3300028906|Ga0308309_10046901All Organisms → cellular organisms → Bacteria3087Open in IMG/M
3300028906|Ga0308309_11207041All Organisms → cellular organisms → Bacteria → Acidobacteria652Open in IMG/M
3300029903|Ga0247271_129662All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus564Open in IMG/M
3300029939|Ga0311328_11082408All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans518Open in IMG/M
3300029945|Ga0311330_11031892All Organisms → cellular organisms → Bacteria605Open in IMG/M
3300029951|Ga0311371_10089566All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis4951Open in IMG/M
3300030051|Ga0302195_10083601All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1644Open in IMG/M
3300030503|Ga0311370_12209332All Organisms → cellular organisms → Bacteria → Acidobacteria540Open in IMG/M
3300030520|Ga0311372_12082541All Organisms → cellular organisms → Bacteria → Proteobacteria660Open in IMG/M
3300030706|Ga0310039_10325295All Organisms → cellular organisms → Bacteria577Open in IMG/M
3300030940|Ga0265740_1047722All Organisms → cellular organisms → Bacteria → Acidobacteria521Open in IMG/M
3300031057|Ga0170834_108952043All Organisms → cellular organisms → Bacteria → Acidobacteria510Open in IMG/M
3300031057|Ga0170834_110561471All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus705Open in IMG/M
3300031090|Ga0265760_10257533All Organisms → cellular organisms → Bacteria → Acidobacteria606Open in IMG/M
3300031090|Ga0265760_10353737All Organisms → cellular organisms → Bacteria526Open in IMG/M
3300031231|Ga0170824_120681968All Organisms → cellular organisms → Bacteria → Acidobacteria500Open in IMG/M
3300031236|Ga0302324_103062568All Organisms → cellular organisms → Bacteria554Open in IMG/M
3300031446|Ga0170820_15783365All Organisms → cellular organisms → Bacteria → Acidobacteria539Open in IMG/M
3300031708|Ga0310686_100645376All Organisms → cellular organisms → Bacteria → Acidobacteria846Open in IMG/M
3300031708|Ga0310686_110914814Not Available980Open in IMG/M
3300031715|Ga0307476_10050927All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis2822Open in IMG/M
3300031715|Ga0307476_11338152All Organisms → cellular organisms → Bacteria → Acidobacteria522Open in IMG/M
3300031718|Ga0307474_11141712All Organisms → cellular organisms → Bacteria → Acidobacteria616Open in IMG/M
3300031753|Ga0307477_10669895All Organisms → cellular organisms → Bacteria → Acidobacteria696Open in IMG/M
3300031794|Ga0318503_10310854All Organisms → cellular organisms → Bacteria → Acidobacteria512Open in IMG/M
3300031820|Ga0307473_11160946All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus572Open in IMG/M
3300031823|Ga0307478_10312281All Organisms → cellular organisms → Bacteria1289Open in IMG/M
3300031823|Ga0307478_10380592All Organisms → cellular organisms → Bacteria → Acidobacteria1166Open in IMG/M
3300031823|Ga0307478_11244384All Organisms → cellular organisms → Bacteria619Open in IMG/M
3300031823|Ga0307478_11388174All Organisms → cellular organisms → Bacteria583Open in IMG/M
3300031941|Ga0310912_11352207All Organisms → cellular organisms → Bacteria → Acidobacteria539Open in IMG/M
3300032160|Ga0311301_10181457All Organisms → cellular organisms → Bacteria3677Open in IMG/M
3300032180|Ga0307471_102423707All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium663Open in IMG/M
3300032205|Ga0307472_100479652All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1066Open in IMG/M
3300032783|Ga0335079_11248794All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium745Open in IMG/M
3300032783|Ga0335079_11804427All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium595Open in IMG/M
3300032805|Ga0335078_10106381All Organisms → cellular organisms → Bacteria4041Open in IMG/M
3300032805|Ga0335078_10212875All Organisms → cellular organisms → Bacteria2671Open in IMG/M
3300032805|Ga0335078_10576671All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium → Acidobacterium capsulatum1425Open in IMG/M
3300032829|Ga0335070_10000272All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae60200Open in IMG/M
3300032892|Ga0335081_10260723All Organisms → cellular organisms → Bacteria2331Open in IMG/M
3300032892|Ga0335081_10850645All Organisms → cellular organisms → Bacteria → Acidobacteria1083Open in IMG/M
3300032893|Ga0335069_10113776All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae3400Open in IMG/M
3300032955|Ga0335076_10140028All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2338Open in IMG/M
3300033158|Ga0335077_10913605All Organisms → cellular organisms → Bacteria883Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil15.73%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil10.49%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil7.49%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment4.49%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil4.12%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil4.12%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil4.12%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil4.12%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere3.75%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland3.37%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil3.00%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa3.00%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil2.62%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds2.62%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil2.62%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland2.25%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog1.87%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil1.87%
Iron-Sulfur Acid SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring1.50%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil1.50%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland1.50%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil1.12%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.12%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.12%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog1.12%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.75%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.75%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.75%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.37%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.37%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil0.37%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.37%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil0.37%
PalsaEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa0.37%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.37%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil0.37%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.37%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere0.37%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.37%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.37%
Populus EndosphereHost-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere0.37%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.37%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.37%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.37%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.37%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.37%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.37%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2189573003Grass soil microbial communities from Rothamsted Park, UK - FE2 (NaCl 30g/L 5ml)EnvironmentalOpen in IMG/M
3300001159Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M2EnvironmentalOpen in IMG/M
3300001356Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007EnvironmentalOpen in IMG/M
3300002245Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)EnvironmentalOpen in IMG/M
3300002886Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cmEnvironmentalOpen in IMG/M
3300004080Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3EnvironmentalOpen in IMG/M
3300004082Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3EnvironmentalOpen in IMG/M
3300004091Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300004092Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300004157Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2EnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300004631Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF234 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004633Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBioEnvironmentalOpen in IMG/M
3300005328Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaGHost-AssociatedOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005518Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaGEnvironmentalOpen in IMG/M
3300005542Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1EnvironmentalOpen in IMG/M
3300005576Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157EnvironmentalOpen in IMG/M
3300005602Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2EnvironmentalOpen in IMG/M
3300005610Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3EnvironmentalOpen in IMG/M
3300005615Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaGEnvironmentalOpen in IMG/M
3300005712Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4EnvironmentalOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300005921Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6EnvironmentalOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006051Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4Host-AssociatedOpen in IMG/M
3300006052Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013EnvironmentalOpen in IMG/M
3300006059Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012EnvironmentalOpen in IMG/M
3300006102Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013EnvironmentalOpen in IMG/M
3300006162Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012EnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300006893Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaGEnvironmentalOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300009089Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaGEnvironmentalOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300009518Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_150EnvironmentalOpen in IMG/M
3300009525Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaGEnvironmentalOpen in IMG/M
3300009545Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaGHost-AssociatedOpen in IMG/M
3300009628Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_10EnvironmentalOpen in IMG/M
3300009637Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_40EnvironmentalOpen in IMG/M
3300009644Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_10EnvironmentalOpen in IMG/M
3300009698Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaGEnvironmentalOpen in IMG/M
3300009759Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_10EnvironmentalOpen in IMG/M
3300009839Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaGEnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010159Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3EnvironmentalOpen in IMG/M
3300010339Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300011120Combined assembly of Microbial Forest Soil metaTEnvironmentalOpen in IMG/M
3300011269Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaGEnvironmentalOpen in IMG/M
3300011270Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaGEnvironmentalOpen in IMG/M
3300012199Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012206Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012362Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaGEnvironmentalOpen in IMG/M
3300012363Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaGEnvironmentalOpen in IMG/M
3300012683Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaGEnvironmentalOpen in IMG/M
3300012685Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaGEnvironmentalOpen in IMG/M
3300012917Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaGEnvironmentalOpen in IMG/M
3300012923Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaGEnvironmentalOpen in IMG/M
3300012924Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012925Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012927Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300012958Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MGEnvironmentalOpen in IMG/M
3300012961Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MGEnvironmentalOpen in IMG/M
3300012985Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MGEnvironmentalOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300014164Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaGEnvironmentalOpen in IMG/M
3300014166Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015EnvironmentalOpen in IMG/M
3300014167Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_10_metaGEnvironmentalOpen in IMG/M
3300014489Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaGEnvironmentalOpen in IMG/M
3300014654Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaGEnvironmentalOpen in IMG/M
3300014658Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_10_metaGEnvironmentalOpen in IMG/M
3300015054Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300015264Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300017822Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2EnvironmentalOpen in IMG/M
3300017930Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5EnvironmentalOpen in IMG/M
3300017932Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4EnvironmentalOpen in IMG/M
3300017933Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1EnvironmentalOpen in IMG/M
3300017947Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MGEnvironmentalOpen in IMG/M
3300017955Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2EnvironmentalOpen in IMG/M
3300017972Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300017975Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300017988Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_30_metaGEnvironmentalOpen in IMG/M
3300017995Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1EnvironmentalOpen in IMG/M
3300018001Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_5EnvironmentalOpen in IMG/M
3300018005Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_150EnvironmentalOpen in IMG/M
3300018006Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4EnvironmentalOpen in IMG/M
3300018007Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5EnvironmentalOpen in IMG/M
3300018012Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5EnvironmentalOpen in IMG/M
3300018013Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_100EnvironmentalOpen in IMG/M
3300018035Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10EnvironmentalOpen in IMG/M
3300018038Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10EnvironmentalOpen in IMG/M
3300018043Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10EnvironmentalOpen in IMG/M
3300018058Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MGEnvironmentalOpen in IMG/M
3300019881Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3c2EnvironmentalOpen in IMG/M
3300020140Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300020579Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-MEnvironmentalOpen in IMG/M
3300020580Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-MEnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300020583Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-MEnvironmentalOpen in IMG/M
3300021168Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-MEnvironmentalOpen in IMG/M
3300021170Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-MEnvironmentalOpen in IMG/M
3300021171Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-MEnvironmentalOpen in IMG/M
3300021180Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-OEnvironmentalOpen in IMG/M
3300021181Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-OEnvironmentalOpen in IMG/M
3300021401Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-OEnvironmentalOpen in IMG/M
3300021402Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-OEnvironmentalOpen in IMG/M
3300021403Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-OEnvironmentalOpen in IMG/M
3300021405Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-OEnvironmentalOpen in IMG/M
3300021406Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-OEnvironmentalOpen in IMG/M
3300021407Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-OEnvironmentalOpen in IMG/M
3300021420Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-MEnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021433Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-OEnvironmentalOpen in IMG/M
3300021474Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-OEnvironmentalOpen in IMG/M
3300021475Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-OEnvironmentalOpen in IMG/M
3300021477Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-OEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300021559Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300022515Peat soil microbial communities from Stordalen Mire, Sweden - 717 P2 1-5EnvironmentalOpen in IMG/M
3300022557Paint Pots_combined assemblyEnvironmentalOpen in IMG/M
3300022722Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-12-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300024288Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungalEnvironmentalOpen in IMG/M
3300025315Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)Host-AssociatedOpen in IMG/M
3300025412Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10 (SPAdes)EnvironmentalOpen in IMG/M
3300025414Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10 (SPAdes)EnvironmentalOpen in IMG/M
3300025434Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_10 (SPAdes)EnvironmentalOpen in IMG/M
3300025612Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 (SPAdes)EnvironmentalOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025961Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025986Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026551Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes)EnvironmentalOpen in IMG/M
3300026557Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungalEnvironmentalOpen in IMG/M
3300027003Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 26 (SPAdes)EnvironmentalOpen in IMG/M
3300027575Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300027629Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027641Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027648Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300027676Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O3 (SPAdes)EnvironmentalOpen in IMG/M
3300027729Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM1 (SPAdes)EnvironmentalOpen in IMG/M
3300027768Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM1 (SPAdes)EnvironmentalOpen in IMG/M
3300027787Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes)EnvironmentalOpen in IMG/M
3300027812Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes)EnvironmentalOpen in IMG/M
3300027853Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes)EnvironmentalOpen in IMG/M
3300027855Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes)EnvironmentalOpen in IMG/M
3300027862Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027867Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027869Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027874Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes)EnvironmentalOpen in IMG/M
3300027884Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes)EnvironmentalOpen in IMG/M
3300027889Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes)EnvironmentalOpen in IMG/M
3300027895Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300027903Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes)EnvironmentalOpen in IMG/M
3300028773Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_2EnvironmentalOpen in IMG/M
3300028781Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_3EnvironmentalOpen in IMG/M
3300028801Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_3EnvironmentalOpen in IMG/M
3300028871Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_1EnvironmentalOpen in IMG/M
3300028906Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)EnvironmentalOpen in IMG/M
3300029903Soil microbial communities from Marcell Experimental Forest, Minnesota, USA - Fen703EnvironmentalOpen in IMG/M
3300029939I_Bog_E3 coassemblyEnvironmentalOpen in IMG/M
3300029945I_Bog_N2 coassemblyEnvironmentalOpen in IMG/M
3300029951III_Palsa_N1 coassemblyEnvironmentalOpen in IMG/M
3300030051Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N1_2EnvironmentalOpen in IMG/M
3300030503III_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030520III_Palsa_N2 coassemblyEnvironmentalOpen in IMG/M
3300030706Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG (v2)EnvironmentalOpen in IMG/M
3300030940Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSI1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031057Oak Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031090Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031236Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1EnvironmentalOpen in IMG/M
3300031446Fir Summer Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031715Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05EnvironmentalOpen in IMG/M
3300031718Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05EnvironmentalOpen in IMG/M
3300031753Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515EnvironmentalOpen in IMG/M
3300031794Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f23EnvironmentalOpen in IMG/M
3300031820Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515EnvironmentalOpen in IMG/M
3300031823Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05EnvironmentalOpen in IMG/M
3300031941Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M
3300032829Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3EnvironmentalOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M
3300032893Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1EnvironmentalOpen in IMG/M
3300032955Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5EnvironmentalOpen in IMG/M
3300033158Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1EnvironmentalOpen in IMG/M
3300033475Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YCEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
FE2_038555502189573003Grass SoilSDPSTLAQIEGINYFFDTLLFGGVVLALANAKQLPLRPNS
JGI12650J13346_100625023300001159Forest SoilGPILIASLLDPSTAAKVEGINYFADTLLFAGAILALASAPPRPA*
JGI12269J14319_1007620413300001356Peatlands SoilSFLDPSTDVKVEGINYFFDTMLYAGTILALAQKTQGLS*
JGIcombinedJ26739_10009765313300002245Forest SoilLGTWLVLVVLFVYGRILIAALADPSTGVKIEGINYFFDTMLFAGAILALASATPRTN*
JGIcombinedJ26739_10043761713300002245Forest SoilTYLGGWLVLLVLFIYGPILIAALADPGTDVQVEGINYFFDTLLFAGTILVLASATPRTD*
JGIcombinedJ26739_10129422813300002245Forest SoilILFSALSNPSTEVKIEGINYFFDTLLFAGVILALASATPPSD*
JGI25612J43240_105532813300002886Grasslands SoilQLSDPSIAVKIEGINYFADTLLFAGAILALASATPRMEPSASTLRIN*
Ga0062385_1053794333300004080Bog Forest SoilIAQVSDPSTAAQVEGINYFADTLLFAGAILALASATPSTD*
Ga0062384_10126207713300004082Bog Forest SoilGPILIASARDPSVAVQVEGINYFTDTLLFAGVILGLASATPRSE*
Ga0062387_10015082813300004091Bog Forest SoilPSTAVKVEGLNYFFDTLLFAGTILALASVRREPIKVPAANL*
Ga0062389_10227891323300004092Bog Forest SoilILVVQMSDPSTAVKVEGINYFADTLLFAGAILALASATPRTD*
Ga0062590_10233504623300004157SoilPVMILALFDPNTGVQVEGINYFADTLLFAGVLLALAKAAPG*
Ga0062595_10108676013300004479SoilAPVMIAALGAPGLENKVEGINYFADTLLFAGVLLAAARAAPRSD*
Ga0058899_1179977523300004631Forest SoilTWIVLLVLFIYGPILIASLANPSTDIKIEGINYFFDTLLFAGAILALASATPRSD*
Ga0066395_1052494513300004633Tropical Forest SoilYGPLLIDSTRDPTPAGRVQGLNYFTDTLLYAGAILGLAGATPKSD*
Ga0070676_1151956713300005328Miscanthus RhizospherePILIESTRDPSTAVKVQGINYFTGTLLFAGAILGLAGATPQSD*
Ga0070714_10218948213300005435Agricultural SoilPIMIVSLADPSTAVKVEGIDYFFDTLLFAGAILALASATPRTRIAD*
Ga0070713_10145952713300005436Corn, Switchgrass And Miscanthus RhizosphereVMIGALSDPNIGVQVEGINYFADTLLFTGAILALASAGPGEDAAARR*
Ga0070708_10065515433300005445Corn, Switchgrass And Miscanthus RhizosphereYGPLLIVALTDPDTTAKVVGINYFSDTLMFAGVILALASATPGIFASTH*
Ga0070699_10165070923300005518Corn, Switchgrass And Miscanthus RhizosphereLIVQLLDPSTAVKVEGINYFADTLLFAGAILALASATPRTEQPTG*
Ga0070732_1066108813300005542Surface SoilPNTGVKVEGINYFADTLLFAGAILALASATPRAD*
Ga0066708_1003131913300005576SoilILIAQMSDPSTAVKVEGINYIADTLLFAGAILALAGATPRID*
Ga0070762_1002012013300005602SoilLITQMSDPSTAVKVEGINYFADTLLFAGAILALASATPRTN*
Ga0070762_1005060943300005602SoilYLGTWLVLVVLFVYGPILIAALADPSTGVKVEGINYFFDTMLFAGAILAVASAAPRTD*
Ga0070762_1017473613300005602SoilWIVLLVVFIYGPILIAALADPSTGVKIEGINYFFDTMLFAGAILALASATPRTD*
Ga0070762_1071277013300005602SoilVVFIYGPILISALGNPSTDVKVEGINYFFDTLLFAGAILALASATPRTD*
Ga0070763_1065814533300005610SoilILLAKKTRMAATYLGTWIVLLVLFIYGPILIAQIPDPSIAVKIEGINYFADALLFAGAILVLASASPRTD*
Ga0070702_10110550713300005615Corn, Switchgrass And Miscanthus RhizosphereAATYLGTWIVLLVVFIYGPILIASLANPSTAIKVEGIDYFFDTLLFAGAILVLVGATSPSSPSNSRL*
Ga0070764_1007529713300005712SoilILISSLLNPSADVQLEGINYIFDTMLYAGAILAFARAMPRTD*
Ga0070764_1021888223300005712SoilPSTAVKVEGINYFADTLLYAGVILVLARAMPRPD*
Ga0068861_10007331273300005719Switchgrass RhizosphereIYGPLLIVALTDPDTTAKVVGINYFSDTLMFAGVILALASATPGIFASTH*
Ga0068861_10159576113300005719Switchgrass RhizosphereILVVAIYGPILIESTRDPSTAVKVQGINYFTGTLLFAGAILGLAGATPQSD*
Ga0070766_1015888513300005921SoilYLGTWLVLVVLFVYGPILIAALADPSTGVKIEGINYFFDTMLFAGAILALASATPRTN*
Ga0070766_1059216823300005921SoilISAPSTEVQIEGINYFFDTLLFAGTILALASATPRTD*
Ga0070766_1127633133300005921SoilPILIAALANPSTDVKVEGINYFFDTLLFAGAILALASATPRTD*
Ga0070766_1130244213300005921SoilPSTAVKIEGINYFFDTLLFAGTILALASATPRTD*
Ga0070717_1208763213300006028Corn, Switchgrass And Miscanthus RhizosphereILIVQMSDPSTAVKVEGINYFADTLLFAGAILALAMRTPRTD*
Ga0066652_10160527423300006046SoilQMSDPSTAAKVEGINYFADTLLLAGAILALASGAPRTD*
Ga0075364_1044637413300006051Populus EndosphereLSDPNAGVQIEGVNYFADTLLFAGAVLALARASRPASSM*
Ga0075029_10034277233300006052WatershedsWIVLLVLFIYGPILIAQMSDPSTEVKIDGINYFFDTLLFAGAILALASATPRAD*
Ga0075029_10109216713300006052WatershedsQMFDPSTAVKVEGINYFADTLLFAGAILALASATPRTD*
Ga0075017_10114394713300006059WatershedsPILIAALMDPSTGVKIEGINYFADTLLFAGAILALASAAPRSD*
Ga0075015_10011270933300006102WatershedsMSDPSTAVKVEGINYFADTQLFAGAILALASATPRTD*
Ga0075015_10029555313300006102WatershedsAQMSDPSTAVKVEGINYFADTLLFAGAILALASATRRTD*
Ga0075015_10068440133300006102WatershedsVFIYGPILIASLADPSTGVKVEGINYFFDTLLFAGVILALASATPRAD*
Ga0075030_10065003123300006162WatershedsLMDPSTDVKVEGLNYFGDTLLFAGTILALAQAIPQED*
Ga0070712_10135875523300006175Corn, Switchgrass And Miscanthus RhizosphereADPSTGVKVEGLNYFADTLLFGGVILSLALIRRG*
Ga0070765_10006389013300006176SoilDPSTGVKIEGINYFFDTMLFAGAILALASATPRTD*
Ga0070765_10082283923300006176SoilYLGTWLVLVVLFVYGPILIAALADPSTGVKVEGINYFFDTMLFAGAILAVASATPRTD*
Ga0070765_10214441013300006176SoilKTRMAATYLGTWIVLLVLFIYGPILIAQIPDPSIAVKIEGINYFADALLFAGAILVLASASPRTD*
Ga0066659_1117054623300006797SoilDPSTAVKVEGINYFADTLLFAGAILALASATPCED*
Ga0073928_1119182613300006893Iron-Sulfur Acid SpringILIASLSDPSTAVKGEGINYFADTLLFAGAILALASATPRTD*
Ga0075424_10275505713300006904Populus RhizosphereVKLEGINYFADTLLFAGAILALASATPRSEARLS*
Ga0099828_1075127923300009089Vadose Zone SoilIAQISDPSTAAKVEGINYFADTLLFAGAILALASATPRTD*
Ga0099828_1142701123300009089Vadose Zone SoilLIAQMSDPSTAVKVEGINYFADTLLFAGAILALASATPRTD*
Ga0105241_1230112623300009174Corn RhizosphereVKVEGINYFADTLLFAGVILAVASAAPRSDVRNISA*
Ga0116128_120664823300009518PeatlandTWIVLVVVLIYGPILIAALGNPSTDVKIEGINYFFDTLLFAGAILALASATPRTE*
Ga0116220_1053876923300009525Peatlands SoilADPRTDVKVDGINYFADTLLFAGAILALASATPRTD*
Ga0116220_1061002123300009525Peatlands SoilLVLLVVFIYGPILIAGLGDPSTDVKIEGINYFFDTLLFAGATLALASATPRTD*
Ga0105237_1227095323300009545Corn RhizosphereSALSTPGTGVQVEAINYFADTLLFAGVILSVATARP*
Ga0116125_115399223300009628PeatlandYGPILIAALGNPSTDVKIEGINYFFDTLLFAGAILALASATPRTE*
Ga0116118_126728623300009637PeatlandILIASLLDPSTDVKVDGINYFFDTLLFAGAILALASATPRTE*
Ga0116121_125959623300009644PeatlandLFIYGPILIAALADPNTDVKVEGINYFFDTLLFAGAILALASATPRTD*
Ga0116216_1010955713300009698Peatlands SoilPSTDVKVEGINYFFDTLLFAGAILALASATPRTD*
Ga0116101_102696123300009759PeatlandYGPILIAALADPSTGVKIEGINYFFDTLLFAGVILALASAAPRTD*
Ga0116223_1015367223300009839Peatlands SoilDPSTGVKVEGINYFFDTLLFAGAILALASATPRTD*
Ga0126373_1040000713300010048Tropical Forest SoilNSPGIGVKVEGINYFFDTLLFAGVILAVASATPKSE*
Ga0126373_1202194513300010048Tropical Forest SoilVALSDPSTAVQVEGINYFADTLLFSGAILALASAVPRREAVA*
Ga0126373_1238343213300010048Tropical Forest SoilLSDPAIPVKIEGINYFADTLLFAGAILAVASAAPRSNAV*
Ga0099796_1040574013300010159Vadose Zone SoilGPSTAVKGEGINYFADTLLFAGAILALASATPRTD*
Ga0074046_1047823313300010339Bog Forest SoilSDPSTAVKVEGINYFFDTLLFAGAILALASATPRTD*
Ga0126376_1259970423300010359Tropical Forest SoilSEPGIGVQVEGINYFADTLLFGGTILALAGAAPRSD*
Ga0126377_1031244413300010362Tropical Forest SoilPVLIVALSEPGVAAKVEGINYFADTLLFAGAILALAKATPRSDVVTQK*
Ga0126377_1362321413300010362Tropical Forest SoilPGSAVKVEGINYFADTLLFAGAILALAKATPRPELKGSGAA*
Ga0150983_1141582613300011120Forest SoilILIAQMSDPSTAAQVEGVNYFADTLLFAGAILALASATPPTD*
Ga0137392_1012001033300011269Vadose Zone SoilIAQMSDPSTAAKVEGINYFADTLLFAGLILALASATPRTD*
Ga0137391_1071076613300011270Vadose Zone SoilISDPSTAVKVEGINYFADTLLFAGAILALASATPRTD*
Ga0137383_1064560313300012199Vadose Zone SoilQMFDPSTAAKVEGINYFADTLLFAGAILALASATPRTD*
Ga0137380_1022157733300012206Vadose Zone SoilAQMFDPSTAAKVEGINYFADTLLFAGAILALASATPRTD*
Ga0150985_11040469223300012212Avena Fatua RhizosphereMMIVALSQPGTAVKLEGINYVADTLLFAGGILALASAQDST*
Ga0137361_1130005823300012362Vadose Zone SoilSDPSTAVKVEGINYFADTLLFAGAILALASATPRTD*
Ga0137390_1095256233300012363Vadose Zone SoilSDPSTAAKVEGINYFADTLLFAGAILALASATPRTD*
Ga0137398_1062473113300012683Vadose Zone SoilTTAKVVGINYFADTMLFAGVILALASATPRSDAAG*
Ga0137397_1099230023300012685Vadose Zone SoilLIAQLSDPSIAVKIEGINYFADTLLFAGAILALASAMPRTDPSASTLRIN*
Ga0137395_1120517623300012917Vadose Zone SoilAQMSDPSTAAKVEGINYFADTLLFAGAILALASATPRTD*
Ga0137359_1032694023300012923Vadose Zone SoilLALSEPDTTAKVVGINYFADTMLFAGVILALASATPRSDAAG*
Ga0137359_1034911033300012923Vadose Zone SoilPILIAQMSDPSTAVKVEGINYFADTLLFAGAILALASATPRTD*
Ga0137413_1178845423300012924Vadose Zone SoilLLVLFIYGPILIAQISDPSIAVKIEGINYFSDTLLFAGAILALANATPRAD*
Ga0137419_1041318413300012925Vadose Zone SoilPSIAVKIEGINYFSDTLLFAGAILALASATPRTD*
Ga0137416_1023839013300012927Vadose Zone SoilQMSDPSTAVKVEGINYFADTLLFAGAILALASAAPRRD*
Ga0137404_1024646313300012929Vadose Zone SoilDPSTAVKVEGINYFADTLLFAGAILALASAAPRRD*
Ga0164303_1011175533300012957SoilFIYGPILIASLANPSTAVKVEGIDYFFDTLLFAGAVLALASASLRTD*
Ga0164299_1102192023300012958SoilDPALGVKIEGINYFADTLLFAGVILAAASAAPRSD*
Ga0164302_1060913023300012961SoilMIGAVSGPNIGAEVEAIDCFADTFFFAGVILAAASAAPRSDAAG*
Ga0164308_1048846913300012985SoilLEVQVEGINYFADTLFFAGVILAAASAAPRSDVAG*
Ga0163162_1186075813300013306Switchgrass RhizospherePGIGTKVEGINYFADTLLFGGAILSVAKAAPKSD*
Ga0157375_1011840913300013308Miscanthus RhizosphereIYGPLLIVALTDPDTTAKVVGINYFSDTLMFAGVILALASATPRTFAGTP*
Ga0181532_1078519923300014164BogALGNPSTDVKVEGINYFFDTLLFAGAILALASATPRTE*
Ga0134079_1008001213300014166Grasslands SoilATAVKVEGINYFADTLLFAGAILALASASPRSASKLAG*
Ga0181528_1016527613300014167BogGPILIALMATPNTGVNVEGLNYFGDTLLFAGVILALARAAEREATD*
Ga0182018_1000916383300014489PalsaMPDPSTAAQVEGINYFADTLRFAGAILALASAKPRTD*
Ga0181525_1011562913300014654BogATYLGTWLVLLVLFIYGPILIAALADPNAGVKIEGINYFFDTMLFAGTVLALANAMPCTA
Ga0181519_1009829213300014658BogSTYLGTWIVLLVIFIYGPILIAALADPSPDAKMEGINYFFDTLLFAGAILALARATPSAD
Ga0137420_105578133300015054Vadose Zone SoilDPSTAVKVEGINYFADTLLFAGAILALASATPRSE*
Ga0137420_114529633300015054Vadose Zone SoilDPSIAVKIEGINYFSDTLLFAGAILALASATPRTD*
Ga0137403_1068461223300015264Vadose Zone SoilDPRIGVQVEGINYFADTLLFAGVVLALASATPRSDG*
Ga0132256_10241200013300015372Arabidopsis RhizosphereGPILIDSMRDPSAAVKVQGINYFTDTLLFAGAILAVASATTEA*
Ga0132255_10477719023300015374Arabidopsis RhizosphereNPDIGAKIEGINYFADTLLFAGVILAAGSAAPQSD*
Ga0187802_1027789723300017822Freshwater SedimentSLADPSTGVKVEGINYFFDTLLFAGAILALASATQRTD
Ga0187825_1038687813300017930Freshwater SedimentIAALSDPSTAVKVEGINYFADTLLFAGAILALANASPDPIPR
Ga0187814_1009101833300017932Freshwater SedimentAWIVLLVLFVYGPILIAALGDPSTSVKIEGINYFLDTLLFAGVILALASATPRTD
Ga0187801_1043647013300017933Freshwater SedimentYGPILIAALANPSTDVKIEGINYFLDTLLYAGAILALASATPRTD
Ga0187785_1002126513300017947Tropical PeatlandATKMEGVNYFADTLLFAGAILALARGTPPSDAEGRSH
Ga0187817_1014921813300017955Freshwater SedimentIVSLSDPSTAVKVEGINYFADTLLFAGPILALASATPRTD
Ga0187781_1039463313300017972Tropical PeatlandTYLGSWIFLMVLAVYGPILISSLLTPSTDVRVEGINYFFDTLLYAGTVLALANASPRSD
Ga0187782_1026863113300017975Tropical PeatlandTRMAATYLGTWIFLVVLAVYGPILVISLLDPSTTVKVDGINYFFDTLLYAGTILALARATPRSE
Ga0181520_1106951423300017988BogIVLVVVFIYDPILIAALGNASTDVKIEGINYFFDTLLFAGAILALASATPRTE
Ga0187816_1027066513300017995Freshwater SedimentWIVLLVLLVYGPILIAALADPSTDVKIEGINYFFDTLLFAGAILALASATPRTD
Ga0187815_1015840533300018001Freshwater SedimentIVYGPILIAALANPSTDVKIEGINYFLDTLLYAGAILALASASPRTD
Ga0187878_109046313300018005PeatlandPILIAALADPSTGVKIEGINYFFDTLLFAGVILTLACATPRTD
Ga0187804_1000730613300018006Freshwater SedimentLIAQLSDPSTAAKVEGINYFADTLLFAGAILALASATPPTD
Ga0187804_1015068713300018006Freshwater SedimentNPSTDVKIEGINYFLDTLLYAGAILALASATPRTD
Ga0187805_1050192313300018007Freshwater SedimentVFIYGPILIAALANPSTDVKIEGINYFFDTVLFAGAILALASATPRNDYMPPPEDYC
Ga0187810_1042662313300018012Freshwater SedimentLLVLFIYGPILIASLADPNTGVKVEGINYFFDTLLFAGAILALASATPRTD
Ga0187810_1044623713300018012Freshwater SedimentLSDPSTGVKIEGINYFFDTLLFAGAILALARATPRTD
Ga0187873_110827033300018013PeatlandALANPSTDVKIEGINYFFDTLLFAGAILALASATPRTE
Ga0187875_1075966123300018035PeatlandLVVFIYGPILIAALADPSADKVEALNYFFDTQLFAGAVLALASASPRTD
Ga0187855_1011802733300018038PeatlandAALGNPSTDVKIEGINYFFDTLLFAGAILALASATPRTE
Ga0187855_1027775323300018038PeatlandLFIYGPILIVQMSDPSTAAQVEGINYFADTLLFAGAILALASAKARTD
Ga0187887_1012118013300018043PeatlandIYGPILIAALADPSADKVEALNYFFDTQLFAGAALALASASPRTD
Ga0187766_1046390223300018058Tropical PeatlandAGILVGKKRRTAATYLGSWITLLVFTVYLAILIASFLDPSTDVKVEGINYFFDTMLYAGAILALAKQPSDFANG
Ga0193707_114362823300019881SoilVLIDALATPKMAVQMVGINYFADTLLFAGAILALASAMPRSER
Ga0179590_109361233300020140Vadose Zone SoilILIVQISDPSTGVKVEGINYFADTLLFAGAILALASATPSTD
Ga0210407_1083025713300020579SoilVPILIAQLSDPSTAAQVEGINYFADTLLFAGAILALAGATPRTD
Ga0210407_1108809013300020579SoilLISALANPSTEIKIEGINYFFDTLLFAGVILALASATPPTD
Ga0210403_1092029513300020580SoilSALSNPSTQLKIEGINYFFDTLLFAGVILALASATPPTD
Ga0210399_1004374613300020581SoilILVAQMSDPSTEAQVEGINYFADTLLFAGAILALASATPRTD
Ga0210401_1069162313300020583SoilLIAALADPSTDVKIEGINYFFDTMLFAGAILALASATPRTD
Ga0210401_1111642323300020583SoilLLAKKTRTAATYLGTWIVLLVVFIYGPILIAALADPGADKVEALNYFFDTQLFAGAILALAKATPRTD
Ga0210406_1104531613300021168SoilIASLLDPSTDVKVDGLNYFFDTLLFAGAILALASATPRSD
Ga0210400_1009357513300021170SoilIYGPILIAALANLSTDIKVEGINYFFDTLLFAGTILALARATPRTE
Ga0210405_1034711423300021171SoilSTGVKIEGINYFFDTMLFAGAILGLASATSRTDQNAA
Ga0210396_1002330063300021180SoilSTGVKVEGINYFFDTMLFAGAILALASATPRTEVYGVS
Ga0210396_1158009813300021180SoilSALANPSTEIKIEGINYFFDTLLFAGVILALASATPPTD
Ga0210388_1108544823300021181SoilPILISALANPSTQVKIEGINYFFDTLLFAGVILALASATPPTD
Ga0210388_1142251913300021181SoilLLDPSTAVKVEGLNYFFDTLLFAGAILALASATPRTD
Ga0210393_1072759923300021401SoilDPSTDVKVEGLNYFADTLLFGGVILSLARTSTDIF
Ga0210393_1080190323300021401SoilILIASLLTPGTDVKVEGLNYFFDTLLFTGTILALASASPGSDQNPV
Ga0210393_1145714223300021401SoilIAALGNPSTDVKVEGINYFFDTLLFAGAILALASATPRTD
Ga0210385_1000875683300021402SoilLLAKKTRAAATYLGTWIVLLVVFIYGPILIAALADPGADKVEALNYFFDTQLFAGAILALAKATPRTD
Ga0210385_1093503213300021402SoilADPSTAVKVEGINYFADTLLFAGAILALASATPRTD
Ga0210397_1063276623300021403SoilIAALADPSIGVKIEGINYFFDTMLFAGAILALASATPRTN
Ga0210387_1047953313300021405SoilIAQISDPNVAAQIEGINYFADTLLFGGAILALASATPRTD
Ga0210387_1095558123300021405SoilQPGTGVEVEGINYFADTLLFAGAILALASASPRISSDM
Ga0210387_1100105213300021405SoilIVQLLDPSTAVKVEGINYFADTLLFGGAILALASATPPTD
Ga0210387_1131215113300021405SoilLSDPGTAVKVEGINYFADTLLFAGAILAVASATPRTD
Ga0210386_1024684913300021406SoilYGPILISALGNPSTDVKVEGINYFFDTLLFAGAILALASATPRTE
Ga0210383_1033582713300021407SoilPILIAALMDPSTGAKIEGINYFFDTLLFAGTILAVASATPQTE
Ga0210383_1043162523300021407SoilIYGPILISALANPSTQVKIEGINYFFDTLLFAGVILALASATPPTD
Ga0210394_1112939713300021420SoilTQMSDPSTAVKVEGINYFADTLLFAGAILALASATPRTD
Ga0210384_1109929813300021432SoilQLSDPSTAAKVEGINYFADTLLFAGAILALASATPRTD
Ga0210391_1045960613300021433SoilKTRMAATYLGTWIVALVVFIYGPILIGALGNPSTDVKVEGINYFLDTMLFAGVILALASATPRSD
Ga0210391_1098274723300021433SoilPILIVQMFDPSAAVKVEGINYFADTLLFAGAILALAKSTP
Ga0210390_1028966413300021474SoilVVFIYGPILISALGNPSTDVKVEGINYFFDTLLFAGAILALASATPRTE
Ga0210390_1080578813300021474SoilANPSTEVKIEGINYFFDTLLFAGVILALASATPPTD
Ga0210390_1133297713300021474SoilILISALSNPSTQLKIEGINYFFDTLLFAGVILALASATPPAD
Ga0210392_1056281013300021475SoilVPILIAQVSDPSTAVQVEGINYFADTLLFAGAILALASATPSTD
Ga0210398_1085922223300021477SoilILIASLLDPSTAVKVEGLNYFFDTLLFAGAILALASATPRTD
Ga0210398_1124880013300021477SoilIAALADPSTDVKIEGINYFFDTMLFGGAILALASATPRTD
Ga0210402_1140555723300021478SoilVLIVQISDPSTAVKVEGINYFADTLLFAGAILALARATPRTA
Ga0210402_1202670113300021478SoilMLVPALADPSAAVKIEGINYFFDTLLFAGAILALASATPRTD
Ga0210409_1120753013300021559SoilNPSTEIKIEGINYFFDTLLFAGVILALASATPPTD
Ga0126371_1144042623300021560Tropical Forest SoilLLDPNIGTKIEGLNYFFDTLLYAGTILALADASPRTD
Ga0224546_100131233300022515SoilMPDPSTAAQVEGINYFADTLRFAGAILALASAKPRTD
Ga0212123_1008364613300022557Iron-Sulfur Acid SpringILIAALANPSTDIKVEGINYFFDTLLFAGAILALASATPRTD
Ga0212123_1016719313300022557Iron-Sulfur Acid SpringLVLFIYVPILIAQVPDPSTAAQVEGINYFADALLFAGAILALAGATPSTD
Ga0212123_1020783533300022557Iron-Sulfur Acid SpringDPSTDVKIEGINYFFDTLLFAGAILALASATPRSN
Ga0242657_122360513300022722SoilALADPSTDVKIEGINYFFDTMLFAGAILALASATPRTEV
Ga0179589_1046706523300024288Vadose Zone SoilMIMALSNPNIGVKIEGINYFADTLLFAGVILAAASTTPQSD
Ga0207697_1007787413300025315Corn, Switchgrass And Miscanthus RhizosphereAALDDAKVAVQVEGLNYFFDTLLFAGAILVLARAVPHKVSR
Ga0208194_100182753300025412PeatlandVLLVLFIYGPILIAALADPSTGVKIEGINYFFDTLLFAGVILALASAAPRTD
Ga0208935_103613813300025414PeatlandPILIASLMDPSAAVQIEGINYFFDTLLFGGTILVLASASPRAD
Ga0208690_104655513300025434PeatlandATYLGTWIVLVVVLIYGPILIAALGNPSTDVKIEGINYFFDTLLFAGAILALASATPRTE
Ga0208691_107600423300025612PeatlandGSWIVLLVVFIYGPILIAALADPNTDVKVEGINYFFDTLLFAGAILALARATPRTD
Ga0207692_1031076133300025898Corn, Switchgrass And Miscanthus RhizosphereLGNPSAGVKIEGLNYFADTLLFGGVILSLASSDKSK
Ga0207699_1066397213300025906Corn, Switchgrass And Miscanthus RhizosphereIAQMSDPSTAVKVEGINYFADTLLFAGTILALASATPRTD
Ga0207693_1118326113300025915Corn, Switchgrass And Miscanthus RhizosphereVMIGALSDPSIGAKVEGINYFADTLFFAGVILAAASAAPRSDAAG
Ga0207700_1114490213300025928Corn, Switchgrass And Miscanthus RhizosphereSALSNPSTEAKVEGINYFFDTLLFAGVILALASATPPTD
Ga0207712_1050534813300025961Switchgrass RhizosphereSSLLIVALTDPDTTAKVVGINYFSDTLMFAGVILALASATPGIFASTH
Ga0207658_1138990923300025986Switchgrass RhizosphereVKVEGLNYFTDTLLFAGAILGLAGATPRPESPLLR
Ga0209648_1011799043300026551Grasslands SoilPILIAQMSDPSTAAKVEGINYFADTLLFAGAILALASATPRTN
Ga0209648_1078901913300026551Grasslands SoilVFIYGPILIASLADPSTDVKIEGINYLFDTLLFAGAIVALASATPPTD
Ga0179587_1012013933300026557Vadose Zone SoilPDTTAKVVGINYFADTMLFAGVILALASATPRSDAAG
Ga0179587_1016522133300026557Vadose Zone SoilSGPSTGVKVEGINYFADTLLFAGAILALASATPSTD
Ga0207722_100486623300027003Tropical Forest SoilPVLLVALSQPGTAVKVEGINYFADTLLFAGVILALASATPRPD
Ga0209525_106766123300027575Forest SoilLFIYGPILVAALGDPSTGVKVEGINYFSDTLLFAGAILALASATPRPD
Ga0209422_100557843300027629Forest SoilPILIAQISDPSTAVKVEGINYFADTLLFAGAILALASVTPRTD
Ga0208827_104280033300027641Peatlands SoilFIYGPILIASLGDPSTGVKIEGINYFFDTLLFAGAILALASATPRTD
Ga0209420_114616113300027648Forest SoilLITSLADPSTDVKVEGLNYFFDTLLFAGTILALANATPRSE
Ga0209333_118616813300027676Forest SoilYLGTWMVLVVVFIYGPILIAALSDPSTDVKVEGINYFFDTLLFAGAILALASATPSAD
Ga0209248_1022619623300027729Bog Forest SoilILIAQVSDPSTAAQVEGINYFADTLLFAGAILALASATPPTD
Ga0209772_1027002523300027768Bog Forest SoilGPILIASARDPSVAVQVEGINYFTDTLLFAGVILGLASATPRSE
Ga0209074_1013678223300027787Agricultural SoilLSEPAVPLQVEGINYFADTLLFAATILALASASPRSASKPTG
Ga0209656_1033863123300027812Bog Forest SoilFQDPSTDVKVEAVNYFTDTMLFAGVILALARATPRTD
Ga0209274_1048613223300027853SoilIYGPILIAALSDPSTDVKVEGINYFFDTLLFAGAILALASATPSAD
Ga0209693_1005627613300027855SoilLVVFIYGPILIAALADPSTGVKIEGINYFFDTMLFAGAILALASATPRTD
Ga0209701_1002904913300027862Vadose Zone SoilMFDPSTAAKVEGINYFADTLLFAGAILALASATPRTD
Ga0209701_1035302623300027862Vadose Zone SoilMADPSTAIKVEGINYFADTLLFAGAILALASATPRTD
Ga0209167_1006327913300027867Surface SoilGPILIASLANPSNDVKIEGINYFFDTLLFAGVILALASATPKTD
Ga0209167_1053340113300027867Surface SoilYGPILIIQLGNPDTGVKVEGINYFADTLLFAGAILGLAKATSRTD
Ga0209167_1056929313300027867Surface SoilDPSTDIKVEGLNYFFDTLLFAGTVLALASATPRSD
Ga0209579_1018177113300027869Surface SoilILISALANPSTEIEIEGINYFSDTLLFAGVILALASATPPTD
Ga0209465_1036989313300027874Tropical Forest SoilVIYGPLLIDSTRDPTPAGRVQGLNYFTDTLLYAGAILGLAGATPKSD
Ga0209275_1057948713300027884SoilYGPILIAQISAPSTEVQIEGINYFFDTLLFAGTILALASATPRKD
Ga0209380_1086302613300027889SoilISAPSTEVQIEGINYFFDTLLFAGTILALASATPRTD
Ga0209624_1111952113300027895Forest SoilMDPSTGVKIEGINYFADTLLFAGAILVLASAMPTTD
Ga0209488_1069515113300027903Vadose Zone SoilPILIAQMSDPSTAAKVEGINYFADTLLFAGAILALASAAPRTD
Ga0302234_1046633613300028773PalsaLLIYGPMMIAALRDPSVGAEIEGINYFADTLLFAGAVLALADAETDADERLA
Ga0302223_1023484023300028781PalsaYGPILATSLLDPSTDVQVEGLNYFFDTLLFAGTILAVANAAPRTDS
Ga0302226_1048835223300028801PalsaILFSALSDPGMGVKIEGINYFADTLLFAGAILALAKATPSS
Ga0302230_1012334633300028871PalsaSFPDPSTDVKVEAVNYFTDTMLYAGAILALASATPRTD
Ga0308309_1004690133300028906SoilLADPSTNVKIEGINYFFDTLLFAGAILALASATPRTD
Ga0308309_1120704123300028906SoilLIASLLDPSTNVKIEGINYFFDTMLFAGATLALASATPRTD
Ga0247271_12966213300029903SoilVLLVLFIYGPILIAALADPNTDVKVEGINYFFDTLLFAGAILALARATPRTD
Ga0311328_1108240823300029939BogLRDPSIAAEIEGINYFADTLLFGGAILALAGATERRVAGNS
Ga0311330_1103189233300029945BogAVEIEGINYFADTLLFGGAILALAGATERRVAGNS
Ga0311371_1008956613300029951PalsaILVASLLDPSTDVKVEGLNYFFDTLLYAGTILALANAAPDSG
Ga0302195_1008360113300030051BogAAALRDPSIAAEIEGINYFADTLLFGGTILALAGASRRAD
Ga0311370_1220933223300030503PalsaPILIASLLDPSTDVKVDGLNYFFDTLLYAGAILAVAIATPRTD
Ga0311372_1208254123300030520PalsaVVFIYGPMLIQSLLNPSPGIQIEGINYFFDTLLFAGAILALASATPSSAAQP
Ga0310039_1032529513300030706Peatlands SoilWIVLLVVFIYGPILIASLADPSTGVKVEGINYFFDTLLFAGAILALASATPRTD
Ga0265740_104772213300030940SoilIYGPILIAALADPSTDVKVEGINYFFDTMLFAGAILALASATPRTD
Ga0170834_10895204313300031057Forest SoilILIVQISDPSTAVKVEGLNYFADTLLFAGAILALASATPGTD
Ga0170834_11056147113300031057Forest SoilIVLLVLFVYGPILIASLADPSTGVKVEGINYFFDTMLFAGAILALASATPRTD
Ga0265760_1025753313300031090SoilFDSSTAVKVEGINYFFDTLLFAGAILALANATPRAGTSPPK
Ga0265760_1035373723300031090SoilADPSTNVKIEGINYFFDTLLFAGAILALASATPRTD
Ga0170824_12068196823300031231Forest SoilGPILIAQLSDPSIAAKIEGINYFADTLLFAGAILALASATPRKG
Ga0302324_10306256813300031236PalsaLITSLMDASTGVKIEGINYFADTLLFAGAILAVASAMPRTDLN
Ga0170820_1578336513300031446Forest SoilPILIAQLSDPSIAAKIEGINYFADTLLFAGAILALASATPRKG
Ga0310686_10064537633300031708SoilLGTWIVLVVVFIYGPILIAALGNPSTDVKIEGINYFFDTLLFAGAILALASATPRTE
Ga0310686_11091481423300031708SoilGPILIAALSAPGTDVKVEGLNYFFDTLLFAGTILALASATPHTD
Ga0307476_1005092753300031715Hardwood Forest SoilMPISDPSTNVKVEAVNYFTDTMLFAGTILALASARPRTDS
Ga0307476_1133815213300031715Hardwood Forest SoilLVGRKTRLAATYLGTWLVLEVLFIYGPILIAALGDPSTGVKVEGINYFFDTMLFAGAILAVASATPRTD
Ga0307474_1114171223300031718Hardwood Forest SoilTYLGTWIVLLVVFIYGPILIASLLDPTTAIKIEGINYFFDTLLFAGTILALASATPLTD
Ga0307477_1066989523300031753Hardwood Forest SoilGPILIAALADPSTGVKVEGINYFFDTMLFAGAILALASATPRTNLTADS
Ga0318503_1031085423300031794SoilALGDPSAGVQVEGVNYFADTLLFGGAILSLAGANPK
Ga0307473_1116094613300031820Hardwood Forest SoilASYLGTWIVLLVVFIYGPILIAALPNPSTDVKIEGINYFFDTLLFAGVILALASATPPTD
Ga0307478_1031228113300031823Hardwood Forest SoilLLDPSTAIKIEGINYFFDTLLFAGTILALASATPGTD
Ga0307478_1038059223300031823Hardwood Forest SoilYLGTWIVLLVLFIYGPILIAALADPSTNVKIEGINYFFDTLLFAGAILALASATPRAD
Ga0307478_1124438423300031823Hardwood Forest SoilADPGADKVEALNYFFDTQLFAGAVLALAKATPRTD
Ga0307478_1138817423300031823Hardwood Forest SoilAPGTDVKVEGINYFFDTLLFAGAILALASATPRSD
Ga0310912_1135220723300031941SoilDPSPAVQIEGINYFADTLLFAGAILALASATPRPD
Ga0311301_1018145733300032160Peatlands SoilPTYLGTWIVLVVVFVYGPILIAALANPSTDVQVEGINYFFDTMLFAGAILALASASPRTD
Ga0307471_10242370713300032180Hardwood Forest SoilLILALSDPGTAGKVEGINYFADTLLFAGAILALAKATPRS
Ga0307472_10047965223300032205Hardwood Forest SoilLIAQLADPSTEVKVEGINYFADTLLFAGAILALASATPRTD
Ga0335079_1124879413300032783SoilPVLIMALADPSTSVKVEGINYFFDTLLFAGTVLALASAIPRVE
Ga0335079_1180442713300032783SoilYGPILIAALLDPSTDAKIEGINYFFDTLLFAGTILAVASATPRPD
Ga0335078_1010638113300032805SoilLADPRTGVQVEGINYFADTLLFGGAILSLAAARCD
Ga0335078_1021287543300032805SoilGPILIAALLDPSTDAKIEGINYFFDTLLFAGTILAVASATPRTD
Ga0335078_1057667113300032805SoilDPSTDAKIEGINYFFDTLLFAGTILAVASATPRTD
Ga0335070_1000027213300032829SoilNPSTAVKVEGLNYFFDTLLFAGEILALASATPQPA
Ga0335081_1026072343300032892SoilLMDPSTDAKIEGINYFFDTLLFAGTILAVASATPRTD
Ga0335081_1085064523300032892SoilILLVAGAFMLLNKKTRLAATYLGGWIVLLVVVVYGPILIAALMDPSTDAKIEGINYFFDTLLFAGTIPAIASATPRTD
Ga0335069_1011377613300032893SoilIMSLLNPSTAVKVEGLNYFFDTLLFAGEILALASATPQPA
Ga0335076_1014002843300032955SoilIASLADPSTAVKVEGLNYFFDTLLFGGAILALASATPRAD
Ga0335077_1091360513300033158SoilDPSVAVKIEGINYFADTLLFAGVILALASAMPRTD
Ga0310811_1138979823300033475SoilVLVGALQNPGIGVQLEGVNYFADTLLFTGAILIVARTARR


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.