| Basic Information | |
|---|---|
| Family ID | F013804 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 268 |
| Average Sequence Length | 45 residues |
| Representative Sequence | MSDGADRREARRFTMTLPLRVLPREAHGSELQAQTRDVSYRGLYF |
| Number of Associated Samples | 221 |
| Number of Associated Scaffolds | 268 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 99.25 % |
| % of genes near scaffold ends (potentially truncated) | 99.25 % |
| % of genes from short scaffolds (< 2000 bps) | 89.55 % |
| Associated GOLD sequencing projects | 210 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.28 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (99.254 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (22.388 % of family members) |
| Environment Ontology (ENVO) | Unclassified (29.851 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (52.985 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 31.51% Coil/Unstructured: 68.49% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.28 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 268 Family Scaffolds |
|---|---|---|
| PF07238 | PilZ | 46.64 |
| PF12146 | Hydrolase_4 | 9.33 |
| PF00248 | Aldo_ket_red | 3.36 |
| PF12695 | Abhydrolase_5 | 1.49 |
| PF13432 | TPR_16 | 1.12 |
| PF08032 | SpoU_sub_bind | 0.37 |
| PF02771 | Acyl-CoA_dh_N | 0.37 |
| PF01139 | RtcB | 0.37 |
| PF02151 | UVR | 0.37 |
| PF06925 | MGDG_synth | 0.37 |
| PF01738 | DLH | 0.37 |
| COG ID | Name | Functional Category | % Frequency in 268 Family Scaffolds |
|---|---|---|---|
| COG0566 | tRNA G18 (ribose-2'-O)-methylase SpoU | Translation, ribosomal structure and biogenesis [J] | 0.37 |
| COG0707 | UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferase | Cell wall/membrane/envelope biogenesis [M] | 0.37 |
| COG1690 | RNA-splicing ligase RtcB, repairs tRNA damage | Translation, ribosomal structure and biogenesis [J] | 0.37 |
| COG1960 | Acyl-CoA dehydrogenase related to the alkylation response protein AidB | Lipid transport and metabolism [I] | 0.37 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 99.63 % |
| Unclassified | root | N/A | 0.37 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459023|GZGNO2B02FQWMJ | All Organisms → cellular organisms → Bacteria → Acidobacteria | 505 | Open in IMG/M |
| 2228664022|INPgaii200_c1008328 | All Organisms → cellular organisms → Bacteria | 5448 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_101617828 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3127 | Open in IMG/M |
| 3300001661|JGI12053J15887_10474057 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 598 | Open in IMG/M |
| 3300001661|JGI12053J15887_10561485 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 543 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101535544 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 562 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101683102 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 533 | Open in IMG/M |
| 3300002908|JGI25382J43887_10008490 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5108 | Open in IMG/M |
| 3300002910|JGI25615J43890_1047432 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 704 | Open in IMG/M |
| 3300002916|JGI25389J43894_1028689 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 964 | Open in IMG/M |
| 3300002917|JGI25616J43925_10004652 | All Organisms → cellular organisms → Bacteria | 5841 | Open in IMG/M |
| 3300003367|JGI26338J50219_1002916 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1260 | Open in IMG/M |
| 3300003505|JGIcombinedJ51221_10435808 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 531 | Open in IMG/M |
| 3300004092|Ga0062389_100683235 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1199 | Open in IMG/M |
| 3300004152|Ga0062386_100244791 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1420 | Open in IMG/M |
| 3300004479|Ga0062595_102463399 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 518 | Open in IMG/M |
| 3300005167|Ga0066672_10267991 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1103 | Open in IMG/M |
| 3300005175|Ga0066673_10365883 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 842 | Open in IMG/M |
| 3300005180|Ga0066685_11133957 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 510 | Open in IMG/M |
| 3300005332|Ga0066388_103964872 | All Organisms → cellular organisms → Bacteria | 755 | Open in IMG/M |
| 3300005340|Ga0070689_101266011 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 663 | Open in IMG/M |
| 3300005434|Ga0070709_11390790 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 568 | Open in IMG/M |
| 3300005439|Ga0070711_100018051 | All Organisms → cellular organisms → Bacteria | 4501 | Open in IMG/M |
| 3300005446|Ga0066686_10444751 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 885 | Open in IMG/M |
| 3300005467|Ga0070706_100621105 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1004 | Open in IMG/M |
| 3300005536|Ga0070697_101450810 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 613 | Open in IMG/M |
| 3300005536|Ga0070697_101824152 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 544 | Open in IMG/M |
| 3300005540|Ga0066697_10006126 | All Organisms → cellular organisms → Bacteria | 5920 | Open in IMG/M |
| 3300005569|Ga0066705_10601567 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 674 | Open in IMG/M |
| 3300005586|Ga0066691_10085778 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1750 | Open in IMG/M |
| 3300005607|Ga0070740_10032273 | All Organisms → cellular organisms → Bacteria | 2912 | Open in IMG/M |
| 3300005610|Ga0070763_10876158 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 533 | Open in IMG/M |
| 3300005764|Ga0066903_101750576 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1185 | Open in IMG/M |
| 3300005844|Ga0068862_101532747 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 672 | Open in IMG/M |
| 3300005944|Ga0066788_10141252 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 610 | Open in IMG/M |
| 3300006031|Ga0066651_10189759 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1086 | Open in IMG/M |
| 3300006041|Ga0075023_100147581 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 863 | Open in IMG/M |
| 3300006050|Ga0075028_100549736 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 680 | Open in IMG/M |
| 3300006052|Ga0075029_101149417 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 541 | Open in IMG/M |
| 3300006102|Ga0075015_100367895 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 805 | Open in IMG/M |
| 3300006162|Ga0075030_101157638 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 608 | Open in IMG/M |
| 3300006172|Ga0075018_10414904 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 687 | Open in IMG/M |
| 3300006173|Ga0070716_100376014 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1014 | Open in IMG/M |
| 3300006175|Ga0070712_101691861 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 554 | Open in IMG/M |
| 3300006797|Ga0066659_10099244 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1977 | Open in IMG/M |
| 3300006806|Ga0079220_11163625 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 632 | Open in IMG/M |
| 3300006871|Ga0075434_100028963 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 5446 | Open in IMG/M |
| 3300006881|Ga0068865_101297946 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 647 | Open in IMG/M |
| 3300006904|Ga0075424_100072092 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3617 | Open in IMG/M |
| 3300007255|Ga0099791_10658532 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 514 | Open in IMG/M |
| 3300007265|Ga0099794_10206009 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1008 | Open in IMG/M |
| 3300009012|Ga0066710_101960742 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 872 | Open in IMG/M |
| 3300009012|Ga0066710_103078067 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 646 | Open in IMG/M |
| 3300009038|Ga0099829_10414891 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1114 | Open in IMG/M |
| 3300009088|Ga0099830_10474121 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1019 | Open in IMG/M |
| 3300009088|Ga0099830_10940930 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 715 | Open in IMG/M |
| 3300009089|Ga0099828_11732713 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 549 | Open in IMG/M |
| 3300009090|Ga0099827_10586578 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 961 | Open in IMG/M |
| 3300009143|Ga0099792_10636033 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 684 | Open in IMG/M |
| 3300009162|Ga0075423_11175362 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 818 | Open in IMG/M |
| 3300009551|Ga0105238_11002865 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 856 | Open in IMG/M |
| 3300009792|Ga0126374_11382328 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 572 | Open in IMG/M |
| 3300010043|Ga0126380_12184695 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 511 | Open in IMG/M |
| 3300010046|Ga0126384_10429737 | All Organisms → cellular organisms → Bacteria | 1122 | Open in IMG/M |
| 3300010047|Ga0126382_10442277 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1028 | Open in IMG/M |
| 3300010048|Ga0126373_12358515 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 592 | Open in IMG/M |
| 3300010320|Ga0134109_10375135 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 564 | Open in IMG/M |
| 3300010341|Ga0074045_10564594 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 728 | Open in IMG/M |
| 3300010343|Ga0074044_10210232 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1291 | Open in IMG/M |
| 3300010343|Ga0074044_10276788 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1106 | Open in IMG/M |
| 3300010359|Ga0126376_10562883 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1070 | Open in IMG/M |
| 3300010359|Ga0126376_10909557 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 871 | Open in IMG/M |
| 3300010360|Ga0126372_13004442 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 523 | Open in IMG/M |
| 3300010396|Ga0134126_10624160 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1231 | Open in IMG/M |
| 3300010398|Ga0126383_10235532 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1785 | Open in IMG/M |
| 3300010398|Ga0126383_11440986 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 778 | Open in IMG/M |
| 3300010398|Ga0126383_11655091 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 729 | Open in IMG/M |
| 3300011270|Ga0137391_10327094 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1319 | Open in IMG/M |
| 3300011271|Ga0137393_10156772 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1905 | Open in IMG/M |
| 3300011271|Ga0137393_10451365 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1102 | Open in IMG/M |
| 3300012096|Ga0137389_10952523 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 736 | Open in IMG/M |
| 3300012189|Ga0137388_10417427 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1243 | Open in IMG/M |
| 3300012189|Ga0137388_10565341 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1057 | Open in IMG/M |
| 3300012189|Ga0137388_10583885 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1039 | Open in IMG/M |
| 3300012189|Ga0137388_11149148 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 713 | Open in IMG/M |
| 3300012200|Ga0137382_10324094 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1078 | Open in IMG/M |
| 3300012202|Ga0137363_11544536 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 555 | Open in IMG/M |
| 3300012203|Ga0137399_10211192 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1579 | Open in IMG/M |
| 3300012207|Ga0137381_10640094 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 926 | Open in IMG/M |
| 3300012208|Ga0137376_10126308 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2187 | Open in IMG/M |
| 3300012209|Ga0137379_10641627 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 968 | Open in IMG/M |
| 3300012351|Ga0137386_10170571 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1559 | Open in IMG/M |
| 3300012362|Ga0137361_11922413 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 508 | Open in IMG/M |
| 3300012363|Ga0137390_10553951 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1120 | Open in IMG/M |
| 3300012683|Ga0137398_11128352 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 539 | Open in IMG/M |
| 3300012917|Ga0137395_11118731 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 557 | Open in IMG/M |
| 3300012918|Ga0137396_10687843 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 755 | Open in IMG/M |
| 3300012923|Ga0137359_10998095 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 719 | Open in IMG/M |
| 3300012924|Ga0137413_10992482 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 658 | Open in IMG/M |
| 3300012929|Ga0137404_10810312 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 851 | Open in IMG/M |
| 3300012944|Ga0137410_11795575 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 541 | Open in IMG/M |
| 3300012957|Ga0164303_10011838 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3070 | Open in IMG/M |
| 3300012971|Ga0126369_11403834 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 788 | Open in IMG/M |
| 3300012972|Ga0134077_10369206 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 615 | Open in IMG/M |
| 3300013306|Ga0163162_13460798 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 503 | Open in IMG/M |
| 3300014154|Ga0134075_10086683 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1317 | Open in IMG/M |
| 3300014162|Ga0181538_10604580 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 572 | Open in IMG/M |
| 3300014200|Ga0181526_10229842 | All Organisms → cellular organisms → Bacteria | 1184 | Open in IMG/M |
| 3300015051|Ga0137414_1241329 | All Organisms → cellular organisms → Bacteria | 6923 | Open in IMG/M |
| 3300015054|Ga0137420_1159537 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 601 | Open in IMG/M |
| 3300015241|Ga0137418_10147984 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2072 | Open in IMG/M |
| 3300015241|Ga0137418_11174815 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 541 | Open in IMG/M |
| 3300015264|Ga0137403_10895944 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 737 | Open in IMG/M |
| 3300015357|Ga0134072_10074012 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 998 | Open in IMG/M |
| 3300015358|Ga0134089_10119018 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1025 | Open in IMG/M |
| 3300015371|Ga0132258_10867004 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2279 | Open in IMG/M |
| 3300015374|Ga0132255_101138049 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1174 | Open in IMG/M |
| 3300016270|Ga0182036_10219151 | All Organisms → cellular organisms → Bacteria | 1406 | Open in IMG/M |
| 3300016270|Ga0182036_11743968 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 526 | Open in IMG/M |
| 3300016294|Ga0182041_12003486 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 539 | Open in IMG/M |
| 3300016371|Ga0182034_10007519 | All Organisms → cellular organisms → Bacteria | 5930 | Open in IMG/M |
| 3300016404|Ga0182037_11120288 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 689 | Open in IMG/M |
| 3300016404|Ga0182037_11225229 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 660 | Open in IMG/M |
| 3300017972|Ga0187781_10028513 | All Organisms → cellular organisms → Bacteria | 3856 | Open in IMG/M |
| 3300017972|Ga0187781_10420373 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 955 | Open in IMG/M |
| 3300017973|Ga0187780_10526731 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 845 | Open in IMG/M |
| 3300017974|Ga0187777_11123168 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 572 | Open in IMG/M |
| 3300018060|Ga0187765_10768722 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 639 | Open in IMG/M |
| 3300018085|Ga0187772_10286863 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1125 | Open in IMG/M |
| 3300018088|Ga0187771_10923987 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 740 | Open in IMG/M |
| 3300018433|Ga0066667_11354497 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 623 | Open in IMG/M |
| 3300019789|Ga0137408_1100861 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1543 | Open in IMG/M |
| 3300020170|Ga0179594_10020669 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1995 | Open in IMG/M |
| 3300020579|Ga0210407_10771149 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 743 | Open in IMG/M |
| 3300020579|Ga0210407_10879984 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 688 | Open in IMG/M |
| 3300020580|Ga0210403_10170435 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1783 | Open in IMG/M |
| 3300020580|Ga0210403_11305392 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 554 | Open in IMG/M |
| 3300020581|Ga0210399_10201831 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1654 | Open in IMG/M |
| 3300020581|Ga0210399_10504859 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1005 | Open in IMG/M |
| 3300020581|Ga0210399_10895287 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 720 | Open in IMG/M |
| 3300020581|Ga0210399_11090706 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 639 | Open in IMG/M |
| 3300020583|Ga0210401_11148320 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 635 | Open in IMG/M |
| 3300021088|Ga0210404_10132195 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1292 | Open in IMG/M |
| 3300021088|Ga0210404_10772636 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 548 | Open in IMG/M |
| 3300021170|Ga0210400_10499551 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1004 | Open in IMG/M |
| 3300021171|Ga0210405_10025731 | All Organisms → cellular organisms → Bacteria | 4735 | Open in IMG/M |
| 3300021171|Ga0210405_11225197 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 555 | Open in IMG/M |
| 3300021180|Ga0210396_10143079 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2151 | Open in IMG/M |
| 3300021401|Ga0210393_10170190 | All Organisms → cellular organisms → Bacteria | 1755 | Open in IMG/M |
| 3300021401|Ga0210393_10988405 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 681 | Open in IMG/M |
| 3300021403|Ga0210397_10222945 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1357 | Open in IMG/M |
| 3300021406|Ga0210386_10448933 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1113 | Open in IMG/M |
| 3300021406|Ga0210386_11711161 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 519 | Open in IMG/M |
| 3300021407|Ga0210383_10179707 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1805 | Open in IMG/M |
| 3300021407|Ga0210383_10608103 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 942 | Open in IMG/M |
| 3300021407|Ga0210383_11339195 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 597 | Open in IMG/M |
| 3300021407|Ga0210383_11588471 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 538 | Open in IMG/M |
| 3300021475|Ga0210392_11400152 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 523 | Open in IMG/M |
| 3300021476|Ga0187846_10292399 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 674 | Open in IMG/M |
| 3300021477|Ga0210398_11184466 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 604 | Open in IMG/M |
| 3300021478|Ga0210402_10822047 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 855 | Open in IMG/M |
| 3300021478|Ga0210402_11049770 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 742 | Open in IMG/M |
| 3300021479|Ga0210410_10592959 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 985 | Open in IMG/M |
| 3300021559|Ga0210409_11682668 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 511 | Open in IMG/M |
| 3300021560|Ga0126371_10619194 | All Organisms → cellular organisms → Bacteria | 1231 | Open in IMG/M |
| 3300022557|Ga0212123_10788397 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 573 | Open in IMG/M |
| 3300024179|Ga0247695_1072409 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 514 | Open in IMG/M |
| 3300024330|Ga0137417_1234424 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 604 | Open in IMG/M |
| 3300024347|Ga0179591_1066702 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2506 | Open in IMG/M |
| 3300025477|Ga0208192_1010509 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2699 | Open in IMG/M |
| 3300025904|Ga0207647_10581110 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 619 | Open in IMG/M |
| 3300025922|Ga0207646_10581300 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1006 | Open in IMG/M |
| 3300025922|Ga0207646_11006903 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 736 | Open in IMG/M |
| 3300026215|Ga0209849_1069768 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 619 | Open in IMG/M |
| 3300026285|Ga0209438_1198381 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 534 | Open in IMG/M |
| 3300026318|Ga0209471_1016215 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3813 | Open in IMG/M |
| 3300026327|Ga0209266_1290952 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 514 | Open in IMG/M |
| 3300026332|Ga0209803_1364038 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 503 | Open in IMG/M |
| 3300026354|Ga0257180_1025097 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 790 | Open in IMG/M |
| 3300026469|Ga0257169_1021626 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 916 | Open in IMG/M |
| 3300026482|Ga0257172_1067175 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 658 | Open in IMG/M |
| 3300026489|Ga0257160_1062228 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 654 | Open in IMG/M |
| 3300026538|Ga0209056_10636016 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 538 | Open in IMG/M |
| 3300026540|Ga0209376_1149709 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1120 | Open in IMG/M |
| 3300026540|Ga0209376_1408768 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 507 | Open in IMG/M |
| 3300026551|Ga0209648_10180678 | All Organisms → cellular organisms → Bacteria | 1633 | Open in IMG/M |
| 3300026833|Ga0207728_106648 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1125 | Open in IMG/M |
| 3300026847|Ga0207802_1014223 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 699 | Open in IMG/M |
| 3300026849|Ga0207804_110648 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 854 | Open in IMG/M |
| 3300027050|Ga0209325_1044224 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 539 | Open in IMG/M |
| 3300027330|Ga0207777_1097387 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 507 | Open in IMG/M |
| 3300027334|Ga0209529_1058709 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 655 | Open in IMG/M |
| 3300027528|Ga0208985_1026668 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1123 | Open in IMG/M |
| 3300027603|Ga0209331_1107746 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 678 | Open in IMG/M |
| 3300027680|Ga0207826_1145404 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 648 | Open in IMG/M |
| 3300027729|Ga0209248_10029526 | All Organisms → cellular organisms → Bacteria | 1708 | Open in IMG/M |
| 3300027817|Ga0209112_10041638 | All Organisms → Viruses → Predicted Viral | 1386 | Open in IMG/M |
| 3300027824|Ga0209040_10099137 | All Organisms → cellular organisms → Bacteria | 1653 | Open in IMG/M |
| 3300027842|Ga0209580_10157661 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1118 | Open in IMG/M |
| 3300027855|Ga0209693_10585348 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 528 | Open in IMG/M |
| 3300027867|Ga0209167_10057402 | All Organisms → cellular organisms → Bacteria | 1924 | Open in IMG/M |
| 3300027879|Ga0209169_10261728 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 907 | Open in IMG/M |
| 3300027894|Ga0209068_10527925 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 682 | Open in IMG/M |
| 3300027903|Ga0209488_10566141 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 827 | Open in IMG/M |
| 3300027903|Ga0209488_10584507 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 811 | Open in IMG/M |
| 3300027903|Ga0209488_10690393 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 732 | Open in IMG/M |
| 3300027911|Ga0209698_10465353 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 982 | Open in IMG/M |
| 3300028072|Ga0247675_1061983 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 562 | Open in IMG/M |
| 3300028138|Ga0247684_1032923 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 827 | Open in IMG/M |
| 3300028145|Ga0247663_1040459 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 763 | Open in IMG/M |
| 3300028792|Ga0307504_10327434 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 584 | Open in IMG/M |
| 3300029636|Ga0222749_10114977 | All Organisms → cellular organisms → Bacteria | 1279 | Open in IMG/M |
| 3300029636|Ga0222749_10446182 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 692 | Open in IMG/M |
| 3300030056|Ga0302181_10370015 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 623 | Open in IMG/M |
| 3300030509|Ga0302183_10186429 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 811 | Open in IMG/M |
| 3300030844|Ga0075377_11360855 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 767 | Open in IMG/M |
| 3300031128|Ga0170823_13174860 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 967 | Open in IMG/M |
| 3300031128|Ga0170823_16522585 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1051 | Open in IMG/M |
| 3300031546|Ga0318538_10214511 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1030 | Open in IMG/M |
| 3300031573|Ga0310915_10364078 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1026 | Open in IMG/M |
| 3300031668|Ga0318542_10138204 | All Organisms → cellular organisms → Bacteria | 1203 | Open in IMG/M |
| 3300031681|Ga0318572_10875422 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 534 | Open in IMG/M |
| 3300031715|Ga0307476_10769344 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 712 | Open in IMG/M |
| 3300031718|Ga0307474_10035991 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3642 | Open in IMG/M |
| 3300031718|Ga0307474_10726708 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 785 | Open in IMG/M |
| 3300031718|Ga0307474_10791149 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 750 | Open in IMG/M |
| 3300031718|Ga0307474_11507066 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 529 | Open in IMG/M |
| 3300031719|Ga0306917_10282916 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1278 | Open in IMG/M |
| 3300031720|Ga0307469_10062758 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2413 | Open in IMG/M |
| 3300031720|Ga0307469_10106147 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1989 | Open in IMG/M |
| 3300031720|Ga0307469_10301078 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1321 | Open in IMG/M |
| 3300031720|Ga0307469_11409506 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 665 | Open in IMG/M |
| 3300031720|Ga0307469_11763940 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 598 | Open in IMG/M |
| 3300031744|Ga0306918_10747283 | Not Available | 765 | Open in IMG/M |
| 3300031754|Ga0307475_10139056 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1922 | Open in IMG/M |
| 3300031768|Ga0318509_10549366 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 644 | Open in IMG/M |
| 3300031781|Ga0318547_10978475 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 529 | Open in IMG/M |
| 3300031795|Ga0318557_10589260 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 510 | Open in IMG/M |
| 3300031798|Ga0318523_10512923 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 593 | Open in IMG/M |
| 3300031820|Ga0307473_10396356 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 903 | Open in IMG/M |
| 3300031820|Ga0307473_10616817 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 751 | Open in IMG/M |
| 3300031823|Ga0307478_10630975 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 897 | Open in IMG/M |
| 3300031831|Ga0318564_10522271 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 515 | Open in IMG/M |
| 3300031859|Ga0318527_10437627 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 557 | Open in IMG/M |
| 3300031890|Ga0306925_10001456 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 19431 | Open in IMG/M |
| 3300031893|Ga0318536_10304157 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 809 | Open in IMG/M |
| 3300031902|Ga0302322_103092314 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 572 | Open in IMG/M |
| 3300031912|Ga0306921_11818682 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 654 | Open in IMG/M |
| 3300031941|Ga0310912_10247599 | All Organisms → cellular organisms → Bacteria | 1371 | Open in IMG/M |
| 3300031945|Ga0310913_11239883 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 518 | Open in IMG/M |
| 3300031946|Ga0310910_10014364 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 5050 | Open in IMG/M |
| 3300031946|Ga0310910_11369167 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 545 | Open in IMG/M |
| 3300031947|Ga0310909_10365224 | All Organisms → cellular organisms → Bacteria | 1212 | Open in IMG/M |
| 3300031962|Ga0307479_11866133 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 552 | Open in IMG/M |
| 3300032035|Ga0310911_10383740 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 812 | Open in IMG/M |
| 3300032076|Ga0306924_10512944 | All Organisms → cellular organisms → Bacteria | 1364 | Open in IMG/M |
| 3300032094|Ga0318540_10409786 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 655 | Open in IMG/M |
| 3300032160|Ga0311301_12283077 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 617 | Open in IMG/M |
| 3300032174|Ga0307470_10030685 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2552 | Open in IMG/M |
| 3300032174|Ga0307470_10631850 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 805 | Open in IMG/M |
| 3300032180|Ga0307471_100623579 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1239 | Open in IMG/M |
| 3300032180|Ga0307471_103529987 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 553 | Open in IMG/M |
| 3300032770|Ga0335085_12267192 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 544 | Open in IMG/M |
| 3300032783|Ga0335079_10045399 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 5040 | Open in IMG/M |
| 3300032805|Ga0335078_10030793 | All Organisms → cellular organisms → Bacteria | 7970 | Open in IMG/M |
| 3300032897|Ga0335071_10953272 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 805 | Open in IMG/M |
| 3300033180|Ga0307510_10564304 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 586 | Open in IMG/M |
| 3300033289|Ga0310914_10448963 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1167 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 22.39% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 16.42% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 7.09% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.97% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.10% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.73% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.36% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.36% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.99% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.61% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.61% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.87% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.87% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.49% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.12% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 1.12% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.12% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.12% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.75% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.75% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.75% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.75% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.75% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.75% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.37% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.37% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.37% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.37% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.37% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.37% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.37% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.37% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.37% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.37% |
| Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 0.37% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.37% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.37% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.37% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.37% |
| Ectomycorrhiza | Host-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza | 0.37% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.37% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459023 | Grass soil microbial communities from Rothamsted Park, UK - FA3 (control condition) | Environmental | Open in IMG/M |
| 2228664022 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300002908 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002910 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm | Environmental | Open in IMG/M |
| 3300002916 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm | Environmental | Open in IMG/M |
| 3300002917 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_100cm | Environmental | Open in IMG/M |
| 3300003367 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM3 | Environmental | Open in IMG/M |
| 3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005607 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen15_06102014_R2 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300005944 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-048 | Environmental | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006041 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
| 3300014162 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaG | Environmental | Open in IMG/M |
| 3300014200 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaG | Environmental | Open in IMG/M |
| 3300015051 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015357 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021476 | Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2) | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300024179 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK36 | Environmental | Open in IMG/M |
| 3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300024347 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025477 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026215 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-048 (SPAdes) | Environmental | Open in IMG/M |
| 3300026285 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026318 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes) | Environmental | Open in IMG/M |
| 3300026327 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 (SPAdes) | Environmental | Open in IMG/M |
| 3300026332 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes) | Environmental | Open in IMG/M |
| 3300026354 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-04-B | Environmental | Open in IMG/M |
| 3300026469 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-17-B | Environmental | Open in IMG/M |
| 3300026482 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-16-B | Environmental | Open in IMG/M |
| 3300026489 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-11-A | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300026540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes) | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026833 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 54 (SPAdes) | Environmental | Open in IMG/M |
| 3300026847 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 20 (SPAdes) | Environmental | Open in IMG/M |
| 3300026849 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 46 (SPAdes) | Environmental | Open in IMG/M |
| 3300027050 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027330 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 35 (SPAdes) | Environmental | Open in IMG/M |
| 3300027334 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027528 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027603 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027680 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 80 (SPAdes) | Environmental | Open in IMG/M |
| 3300027729 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027817 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027824 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
| 3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028072 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK16 | Environmental | Open in IMG/M |
| 3300028138 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK25 | Environmental | Open in IMG/M |
| 3300028145 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK04 | Environmental | Open in IMG/M |
| 3300028792 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030056 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_3 | Environmental | Open in IMG/M |
| 3300030509 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_2 | Environmental | Open in IMG/M |
| 3300030844 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA11 EcM (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031128 | Oak Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031795 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19 | Environmental | Open in IMG/M |
| 3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031831 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20 | Environmental | Open in IMG/M |
| 3300031859 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
| 3300031902 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_2 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032094 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032897 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5 | Environmental | Open in IMG/M |
| 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Host-Associated | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| FA3_02528820 | 2170459023 | Grass Soil | MPDGADRREARRFNMSLPMRLLPRDSNSPELTAQTRDVSYRVDFIF |
| INPgaii200_10083287 | 2228664022 | Soil | MPDGTDRREARRFNMTLPMRLLPQDSNSPEFTAQTRDVSYRGLYFLCEAAFKLGSAI |
| INPhiseqgaiiFebDRAFT_1016178285 | 3300000364 | Soil | MPDGTDRREARRFNMTLPMRLLPQDSNSPEFTAQTRDVSYRGLYFL |
| JGI12053J15887_104740571 | 3300001661 | Forest Soil | MSDGADRREARRFTMSLPMRVLPLDAEGQELSVQTRDVSYRGL |
| JGI12053J15887_105614852 | 3300001661 | Forest Soil | MSDGADRREARRFSMSLPMRVLPREAHHKELRANTRDVS |
| JGIcombinedJ26739_1015355441 | 3300002245 | Forest Soil | MSDLSDRREARRFAMNLPVRVLLNDANGPELKANTRDVSYRGLYFVTEAP |
| JGIcombinedJ26739_1016831022 | 3300002245 | Forest Soil | MADGSERRVARRFTMSLPLRVLPREARTSELRTQTRDV |
| JGI25382J43887_100084901 | 3300002908 | Grasslands Soil | MGDGAERREARRFTMNLPMRVLRREDKERELDAHTRDVSYRGL |
| JGI25615J43890_10474322 | 3300002910 | Grasslands Soil | MPDGADRREARRFLMSLPMRVLPREAHNKELHANTRDVSYRGLYFL |
| JGI25389J43894_10286891 | 3300002916 | Grasslands Soil | MGDASERREARRFTMTLPLRVFPHKSRGIELKAQTRDVSYRGLYFLAEAK |
| JGI25616J43925_100046521 | 3300002917 | Grasslands Soil | MPDGADRREARRFLMSLPMRVLPREAHNKELQANTRDVSYRGL |
| JGI26338J50219_10029162 | 3300003367 | Bog Forest Soil | MSDGADRREARRFNMTLPLRVLPHXPHGHELAAQTRDVSYRGLYFL |
| JGIcombinedJ51221_104358082 | 3300003505 | Forest Soil | MADGSERRVARRFTMSLPLRVLPRASRNHELRAQTRDVSYQGLY |
| Ga0062389_1006832352 | 3300004092 | Bog Forest Soil | MSDGADRREARRFNMTLPLRVLAHEPHGSELAAQTRDVSYRGLYFLAETKFPIGSE |
| Ga0062386_1002447913 | 3300004152 | Bog Forest Soil | MADLSDRREARRFVMTLPVRVMAHDANSPELKAHTRDVSYRGLYFLAEAS |
| Ga0062595_1024633991 | 3300004479 | Soil | MSDGADRREARRFNMTLPLRVIPTGPYSHELTAQTRDVSYRGLYFLAETNF |
| Ga0066672_102679911 | 3300005167 | Soil | MVDGAERREARRFTMSLPMRVFLRESKGREMDAHTRDVSYRGLYFLTDA |
| Ga0066673_103658832 | 3300005175 | Soil | MSVGADRREARRFNMTLPMRILSLDSNSHELKALTRDVSYRGLYFLAE |
| Ga0066685_111339572 | 3300005180 | Soil | MSDGSERREARRFNMNLPMRLMPREGKGRELDAHTRDLSYQGLYF |
| Ga0066388_1039648721 | 3300005332 | Tropical Forest Soil | MGDGSERREARRFTMTLPLLVVPHDSSGPELNARTRDVSYRGLYFLADAKFEVGN |
| Ga0070689_1012660112 | 3300005340 | Switchgrass Rhizosphere | MGDISERRVARRFTMSLPLRVLAREPRNSELRVQTRDVSYQGLYFLAEEPFE |
| Ga0070709_113907902 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MGDISERRVARRFTMSLPLRVLAREPRNSELRVQTRDVSYQ |
| Ga0070711_1000180516 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MPDGADRREARRFNMTLPIRLLLQNSQPQELAGQTRDVSYRGLYFLAEANF |
| Ga0066686_104447512 | 3300005446 | Soil | MSEGADRREARRFTMSLPMRVLPQAAKGRELDAHTRDVSYRGLYFLS |
| Ga0070706_1006211051 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MPDGADRREARRFNMTLPMRLLPNDSNSPELPAQTRDVSYRGLYFLAEAQFKLG |
| Ga0070697_1014508101 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MSDGADRREARRFNMTLPLRVIPPGPHSHELTAQTRDVSYRGLYFLAETNFPIGSAIE |
| Ga0070697_1018241521 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MPEGVDRREARRFLMSLPMRVLPREANSKELHASTRDVSYRGLYFMSEAKFEVGG |
| Ga0066697_100061261 | 3300005540 | Soil | MADGEERREARRFTMSLPMRVLPREAKGNELDAHTRDLSYRGLYFLTD |
| Ga0066705_106015672 | 3300005569 | Soil | MSDGADRREARRFNMTLPMRMLSRDSQALEFTAQTRDVSYRGLYFLAKAQF |
| Ga0066691_100857781 | 3300005586 | Soil | MPDGADRREARRFNMTLPVRLLPRDSQSPELKAQTRDVSYRGLYFLAE |
| Ga0070740_100322734 | 3300005607 | Surface Soil | MGDGAERREARRFTMTLPLRVFPHESSVELKAQTRDVSYRG |
| Ga0070763_108761582 | 3300005610 | Soil | MAEGSDRRIARRFTMSLPLRILSSEPPSSELRTQTRDVSYQGLYFLAEANF |
| Ga0066903_1017505761 | 3300005764 | Tropical Forest Soil | MSDGVDRREARRFNMTLPMRILSVDSNSPELKAFTRDV |
| Ga0068862_1015327472 | 3300005844 | Switchgrass Rhizosphere | MGDISERRVARRFTMSLPLRVLAREPRNSELRVQTRDVSYQGLYFLAEEPFEVG |
| Ga0066788_101412521 | 3300005944 | Soil | MADASDRREARRFVMTLPVRVLARDSSGHELKAQTRDVSYRGLYF |
| Ga0066651_101897591 | 3300006031 | Soil | MSDGSERREARRFNMNLPMRLMPREGKGRELDAHTRDLSY |
| Ga0075023_1001475812 | 3300006041 | Watersheds | MSDGAERREARRFTMSLPMRVLAGAAKDHELNAHTRDVSYRGLYFLAESN |
| Ga0075028_1005497361 | 3300006050 | Watersheds | MSDLSDRREARRFTMTLPVRVLARDTSEHELKAHTRDVSYRGLY |
| Ga0075029_1011494171 | 3300006052 | Watersheds | MSDGADRREARRFNMTLPLRVLPHEPHGSELTAQTRDVSYRGLYF |
| Ga0075015_1003678951 | 3300006102 | Watersheds | MSDGADRREARRFTMTLPLRVLPREAHGSELQAQTRDVSYRGLYF |
| Ga0075030_1011576382 | 3300006162 | Watersheds | MSDGADRREARRFTMTLPLRVLPREAHGSELQAQTR |
| Ga0075018_104149041 | 3300006172 | Watersheds | MGEGAERREARRFTMTLPLRVFPHESSGLELKAQTRDVSYRGLYFLTDAKFD |
| Ga0070716_1003760142 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MGDISERRVARRFTMSLPLRVLAREPHRSELRAQTRDVSYQGLYFLAEEPFEVGTE |
| Ga0070712_1016918611 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MPDGADRREARRFNMTLPMRLLPRDSNSPELTAQTRDVSYRGLYFL |
| Ga0066659_100992444 | 3300006797 | Soil | MVDGAERREARRFTMSLPMRVFLRESKGREMDAHTRDVSYRG |
| Ga0079220_111636251 | 3300006806 | Agricultural Soil | MADGPDRREARRFTMSLPMRVLPRNANPRELQANTRDVSYRGLYFLAEG |
| Ga0075434_1000289631 | 3300006871 | Populus Rhizosphere | MSEGTDRREARRFNMTLPLKILSLDSNAHELKAFTRDVSYRGLYFL |
| Ga0068865_1012979461 | 3300006881 | Miscanthus Rhizosphere | MSEGTDRREARRFNMTLPLKILSLDSNAHELKAFTRDVSYRGL |
| Ga0075424_1000720921 | 3300006904 | Populus Rhizosphere | MSEGTDRREARRFNMTLPLKILSLDSNAHELKAFTRDVSYRGLYFLAE |
| Ga0099791_106585321 | 3300007255 | Vadose Zone Soil | MPDGADRREARRFNMTLPMRLLSRDSNSPELQAQTRDV |
| Ga0099794_102060091 | 3300007265 | Vadose Zone Soil | MSNGAERREARRFTMSLPMRVLPREVKGRELDAHTRDV |
| Ga0066710_1019607421 | 3300009012 | Grasslands Soil | MGDASERREARRFTMTLPLRVFPRESRGTELKAQTRDVSYRGLYFLVEAK |
| Ga0066710_1030780672 | 3300009012 | Grasslands Soil | MPDGADRREARRFNMNLPMRLLPRDSQSPELKAQTRDVSYRGLYFLAEAE |
| Ga0099829_104148913 | 3300009038 | Vadose Zone Soil | MAGDESERRIARRFLMTLPLRVLPREAQNHELRAQTRDVSYR |
| Ga0099830_104741211 | 3300009088 | Vadose Zone Soil | MSDGAERREARRFTMSLPMRVLPREAKGRELDAHTRDVSYRG |
| Ga0099830_109409302 | 3300009088 | Vadose Zone Soil | MAGGEAERRIARRFLMTLPLRVLPREAQNHELRAQTRDV |
| Ga0099828_117327132 | 3300009089 | Vadose Zone Soil | MADGAERREARRFMMNLPMRILPREAPGNELRGNTRDVSYRGLYFVVEAKFDVG |
| Ga0099827_105865782 | 3300009090 | Vadose Zone Soil | MVDGAERREARRFTMSLPMRVFPRESKGREMDAHTRDVSYRGL |
| Ga0099792_106360332 | 3300009143 | Vadose Zone Soil | MGDGAERREARRFTMSLPMRVFLREAKGRELDAHTRDVSYRGLYFLAEADF |
| Ga0075423_111753622 | 3300009162 | Populus Rhizosphere | MSEGTDRREARRFNMTLPLKILSLDSNAHELKAFTRDVSYR |
| Ga0105238_110028651 | 3300009551 | Corn Rhizosphere | MSDGADRREARRFNMTLPMRILSLDSNSHELKAFTRDVSYR |
| Ga0126374_113823281 | 3300009792 | Tropical Forest Soil | MSIADRREARRFNMTLPMRILSLDSSSHELKAFTRDVSYRGLYFLAETDAKVGAQ |
| Ga0126380_121846951 | 3300010043 | Tropical Forest Soil | MADGSERREARRFNMSLPMRVLPRDRHDSELRGQTR |
| Ga0126384_104297373 | 3300010046 | Tropical Forest Soil | MADGSERREARRFNMSLPMRVLPRDRHESELRGQTRDVSYRGL |
| Ga0126382_104422772 | 3300010047 | Tropical Forest Soil | MSDGADRREARRFNMTLPMRILSLDSNSHELKAFTRDV |
| Ga0126373_123585152 | 3300010048 | Tropical Forest Soil | MGDLSDRREARRFAMNLPVRVLAQDANGPELKANTRDVS |
| Ga0134109_103751352 | 3300010320 | Grasslands Soil | MSDGSERREARRFNMNLPLRVLLREAKGRELKAHTRDLSYQGLYFLA |
| Ga0074045_105645942 | 3300010341 | Bog Forest Soil | MADLSDRREARRFVMTLPVRVMAHNANSPELKAHTRDVSYR |
| Ga0074044_102102321 | 3300010343 | Bog Forest Soil | MADLSDRREARRFVMTLPVRVMAHEANSPELKAHTRDVSYRGLYFLAEAP |
| Ga0074044_102767882 | 3300010343 | Bog Forest Soil | MSDGADRREARRFNMTLPLRVLPNEPHGSELTAQTRDVSY |
| Ga0126376_105628832 | 3300010359 | Tropical Forest Soil | MSIADRREARRFNMTLPMRILSLDSNSQELKAFTRDVSYRGLYFLAETQAKV |
| Ga0126376_109095571 | 3300010359 | Tropical Forest Soil | MPDGNDRREARRFNMTLPMRVLSHDSQAMEFPAQTRD |
| Ga0126372_130044421 | 3300010360 | Tropical Forest Soil | MSDGSERREARRFNMNLPMRVLSREAKGHELVAQTRDLSYRGLYFLAEA |
| Ga0134126_106241601 | 3300010396 | Terrestrial Soil | MSDGADRREARRFNMTLPLRVLPHEPHGHELTAQTRDVSYRGLYFLAETN |
| Ga0126383_102355321 | 3300010398 | Tropical Forest Soil | MGDGAERREARRFTMTLPLRVFPHESSGPELNARTRDVSYRG |
| Ga0126383_114409862 | 3300010398 | Tropical Forest Soil | MSDGVDRREARRFNMTLPMRILSVDSNSPELKAFTRDVSYRGLYFLAEAEF |
| Ga0126383_116550912 | 3300010398 | Tropical Forest Soil | MGDLSDRREARRFVMTLPVRVLARDASGPELKAHTR |
| Ga0137391_103270943 | 3300011270 | Vadose Zone Soil | MAGGEAERRIARRFLMTLPLRVLPREAQNHELRAQTRDVSYR |
| Ga0137393_101567721 | 3300011271 | Vadose Zone Soil | MGDGAERREARRFTMSLPMRVLPREAKGHELDAHTRDVSYRGLYFLAEAN |
| Ga0137393_104513652 | 3300011271 | Vadose Zone Soil | MAGGEAERRIARRFLMTLPLRVLPREAQNHELRAQTRD |
| Ga0137389_109525231 | 3300012096 | Vadose Zone Soil | MTDWSDRRVARRFAMSLPVRLVARDASSPELRAQTRDVSYQGLY |
| Ga0137388_104174273 | 3300012189 | Vadose Zone Soil | MSDGSERREARRFNMNLPLRVLPSEAKGRELNTHTRDLSYQG |
| Ga0137388_105653411 | 3300012189 | Vadose Zone Soil | MGDGAERREARRFTMSLPMRVFPREAKGRELDAHTR |
| Ga0137388_105838852 | 3300012189 | Vadose Zone Soil | MPDGADRREARRFSMSLPMRVLAPEAQRKELRASTRDVSYRGLYFLSE |
| Ga0137388_111491482 | 3300012189 | Vadose Zone Soil | MTDGADRREARRFSMSLPMRVLPREARGKELRAST |
| Ga0137382_103240943 | 3300012200 | Vadose Zone Soil | MGDASERREARRFTMTLPLRVFPHESRGIELKAQTRD |
| Ga0137363_115445362 | 3300012202 | Vadose Zone Soil | MFEEADRREARRFSMSLPMRVLPREANDKELHASTRDVSYRGLYFIAETK |
| Ga0137399_102111923 | 3300012203 | Vadose Zone Soil | MPDGADRREARRFSMSLPMRVLPREAHNKELHANTRDV |
| Ga0137381_106400942 | 3300012207 | Vadose Zone Soil | MGDISDRREARRFNMALPLRLIPDGSGRELSAETRDVSYRGLYFLAD |
| Ga0137376_101263083 | 3300012208 | Vadose Zone Soil | MADGAERREARRFTMSLPMRVLPRETQGRELDAHTRDLSYRGLYFLTDANF |
| Ga0137379_106416271 | 3300012209 | Vadose Zone Soil | MGDGAERREARRFTMNLPMRVLRREDKERELDAHTRDVSY |
| Ga0137386_101705711 | 3300012351 | Vadose Zone Soil | MSEGADRREARRFTMSLPMRVLPQAAKGRELDAHTRDVSYRG |
| Ga0137361_119224132 | 3300012362 | Vadose Zone Soil | MSEGADRREARRFTMSLPMRVLPREAKERELDAQTRDVSYRGL |
| Ga0137390_105539513 | 3300012363 | Vadose Zone Soil | MAGDESERRIARRFLMTLPLRVLPREAQNHELRAQTRDVSYRGL |
| Ga0137398_111283521 | 3300012683 | Vadose Zone Soil | MSDLSDRREARRFSMNLPVRVLVNDVNGPELKANTRDVSYRGLYF |
| Ga0137395_111187311 | 3300012917 | Vadose Zone Soil | MSDLSDRREARRFSMNLPVRVLMNDANGPELKANTRDVSYRGLYF |
| Ga0137396_106878431 | 3300012918 | Vadose Zone Soil | MSDGADRREARRFTMNLPMRVLPSEAKGRELNAQTRDVSYR |
| Ga0137359_109980951 | 3300012923 | Vadose Zone Soil | MADGAERREARRFTMNLPMRGLPREAKGRELDAHTRDVSYRGLYF |
| Ga0137413_109924821 | 3300012924 | Vadose Zone Soil | MSDLSDRREARRFSMNLPVRVLVNDVNGPELKANTRDVSYRG |
| Ga0137404_108103122 | 3300012929 | Vadose Zone Soil | MGDASERREARRFTMTLPLRVFPHESRGIELKAQTRDVSYRGLYFLAEAKFDL |
| Ga0137410_117955751 | 3300012944 | Vadose Zone Soil | MGEASERREARRFTMTLPLRVFPREVRGLELKAQTRDVSYRGLYFLADAKFDI |
| Ga0164303_100118385 | 3300012957 | Soil | MPDGADRREARRFNMTLPMRVLSSDSRSPELKAQTRDVSYR |
| Ga0126369_114038342 | 3300012971 | Tropical Forest Soil | MSEGTDRREARRFNMTLPLKILSLDSNAHELKAFTRDVSYRGLYFLAEAEF |
| Ga0134077_103692062 | 3300012972 | Grasslands Soil | MSEGADRREARRFTMSLPMRVLPQAAKGRELDAHTRDVSYR |
| Ga0163162_134607981 | 3300013306 | Switchgrass Rhizosphere | MSDGADRREARRFNMTLPMRILSLDSVSRELKAFTRDVSYRGLYFLAEAEFKLGSAI |
| Ga0134075_100866831 | 3300014154 | Grasslands Soil | MADGEERREARRFTMSLPMRVLPREAKGNELDAHTRDLSYRGLYFLTDVKFEI |
| Ga0181538_106045801 | 3300014162 | Bog | MGDLSDRREARRFVMTLPVRVLAHDTGSPELRANTRDVSYRGLY |
| Ga0181526_102298421 | 3300014200 | Bog | MGDLSDRREARRFVMTLPVRVLAHDANSPELRANTRDVSYRGLYFLT |
| Ga0137414_12413298 | 3300015051 | Vadose Zone Soil | MPEGADRREARRFNMTLPLRLLPTDSNSPELQAQTT* |
| Ga0137420_11595372 | 3300015054 | Vadose Zone Soil | MSDLSDRREARRFSMNLPVRVLVNDVNGPELKANTRDVSY |
| Ga0137418_101479844 | 3300015241 | Vadose Zone Soil | MSDGADRREARRFTMNLPMRVLPSEAKGRELNAQTRD |
| Ga0137418_111748152 | 3300015241 | Vadose Zone Soil | MPDGADRREARRFNMSLPMRVLSRDSQALEFTAQTRD |
| Ga0137403_108959442 | 3300015264 | Vadose Zone Soil | MADGAERREARRFTMSLPMRVLPREDKGRELDAHTRDLSYRGLYFLTDANF |
| Ga0134072_100740121 | 3300015357 | Grasslands Soil | MSDGSERREARRFNMNLPLRVLLREAKGRELKAHTRDLSYQ |
| Ga0134089_101190182 | 3300015358 | Grasslands Soil | MADGAERREARRFTMSLPMRVLPREAKGCELDAHTRDLSYR |
| Ga0132258_108670041 | 3300015371 | Arabidopsis Rhizosphere | MSEGTDRREARRFNMTLPVKILSLDSNAHELKAFTRDVSYRGLYFLA |
| Ga0132255_1011380493 | 3300015374 | Arabidopsis Rhizosphere | MSEGTDRREARRFNMTLPLKILSLDSNAHELKAFTR |
| Ga0182036_102191511 | 3300016270 | Soil | MGDLSDRREARRFTMTLPVRVLAHEASSPELKAHTRDV |
| Ga0182036_117439681 | 3300016270 | Soil | MGDLSDRRVARRFVMTLPVRVLAHDPHTPELRANTRDVSYRGLYFLTEAKF |
| Ga0182041_120034861 | 3300016294 | Soil | MSIADRREARRFNMTLPMRILSLDSNSHELKAFTRDVSYRGL |
| Ga0182034_100075191 | 3300016371 | Soil | MSIADRREARRFNMTLPMRILSLDSNSHELKAFTRDVSYRGLYFLAETEAKVGA |
| Ga0182037_111202881 | 3300016404 | Soil | MGDLSDRREARRFAMNLPVRVLAQDASGTELKANTRDVS |
| Ga0182037_112252291 | 3300016404 | Soil | MSDLSDRREARRFVMTLPVRVLAHDASSPELKAHTRDVSYRGLYFLSEAK |
| Ga0187781_100285135 | 3300017972 | Tropical Peatland | MGDLSDRREARRFVMTLPVRVLAHDANSPELRANT |
| Ga0187781_104203732 | 3300017972 | Tropical Peatland | MGDLSDRREARRFVMTLPVRVLAHDPNGPELKAQTR |
| Ga0187780_105267312 | 3300017973 | Tropical Peatland | MGARMGDLSDRREARRFVMTLPVRVLAHDPNGPELRANTRDVSYRGLYF |
| Ga0187777_111231682 | 3300017974 | Tropical Peatland | MGDLSDRREARRFVMTLPVRVLAHDANNPELKAHTRDVSYRGLYFLSEASFQD |
| Ga0187765_107687221 | 3300018060 | Tropical Peatland | MADGSERREARRFNMSLPMRVLPRDRHENELRGQTRDVSYRGLYFLSDASFEPG |
| Ga0187772_102868632 | 3300018085 | Tropical Peatland | MGDLSDRREARRFTMTLPVRVLAHDANSPELRAHTR |
| Ga0187771_109239871 | 3300018088 | Tropical Peatland | MEDMSDRREARRFVMTLPVRVLAHDVNSPELKAHTRDVSYRGLYFLS |
| Ga0066667_113544971 | 3300018433 | Grasslands Soil | MPDGADRREARRFNMTLPMRLLPRDSQSPELKAQTRDVSYRGLYFLAEA |
| Ga0137408_11008613 | 3300019789 | Vadose Zone Soil | MADGSERRVARRFTMSLPLRVLPRASHSHEHRAQTRDVSYQG |
| Ga0179594_100206694 | 3300020170 | Vadose Zone Soil | MADGSERRVARRFTMSLPLRVLPRASHSHELRAQTRDVSYQ |
| Ga0210407_107711491 | 3300020579 | Soil | MGEFSDRREARRFVMTLPVRVMTRDGGSHGSELKAHTRDVS |
| Ga0210407_108799842 | 3300020579 | Soil | MGDLSDRREARRFSMNLPVRVLVNDASGPEIKANTRDVSYRRLYFLVEAPFEK |
| Ga0210403_101704353 | 3300020580 | Soil | MSDGTERREARRFTMSLPMRVLPREAKGRELDAHTRDVSYRG |
| Ga0210403_113053922 | 3300020580 | Soil | MGDLSDRREARRFVMTLPVRVLARDASGPELKAHTRDVSYRGLYFLTEA |
| Ga0210399_102018311 | 3300020581 | Soil | MADGADRREARRFTMSLPMRVLPRESKGHELDAHTRDVSYR |
| Ga0210399_105048592 | 3300020581 | Soil | MSEGADRREARRFNMTLPLRVLPHEPRGSELTAQTRDVSYRGLYFLAE |
| Ga0210399_108952871 | 3300020581 | Soil | MSDGAERREARRFTMSLPMRVLAGAAKDRELNAHTRDV |
| Ga0210399_110907062 | 3300020581 | Soil | MGDGAERREARRFTMSLPLRVLPQASKGHELAASTRDV |
| Ga0210401_111483201 | 3300020583 | Soil | MGDLSDRREARRFVMTLPVRVLAHDAHSPELRANTRDVSYR |
| Ga0210404_101321951 | 3300021088 | Soil | MSDGAERREARRFTMSLPMRVLAGAAKDRELNAHTRDVSYRG |
| Ga0210404_107726361 | 3300021088 | Soil | MSDGTERREARRFTMSLPMRVLPREAKGRELDAHTRD |
| Ga0210400_104995511 | 3300021170 | Soil | MPDGADRREARRFLMSLPMRVLPQEAQSKELRASTRDV |
| Ga0210405_100257317 | 3300021171 | Soil | MGDLSDRREARRFVMTLPVRVLARDASGSELKAHTRD |
| Ga0210405_112251971 | 3300021171 | Soil | MADGSERRVARRFTMSLPLRVLPRESRTHELRTQTRDVSYQGLYF |
| Ga0210396_101430791 | 3300021180 | Soil | MPDGADRREARRFLMSLPMRVLPREAHSKALRANTRDVSYR |
| Ga0210393_101701901 | 3300021401 | Soil | MSDGADRREARRFNMTLPLRVLPHEPHGSELTAQTRDVSYRGLYFLAETKF |
| Ga0210393_109884052 | 3300021401 | Soil | MADGSERRVARRFTMSLPLRVLPREARTSELRTQTRDVSYQGLYFLAEAQFEVGSEIEF |
| Ga0210397_102229452 | 3300021403 | Soil | MADGSERRVARRFTMSLPLRVLPREARSSELRTQTRDVSYQGLYFLAEAEFEV |
| Ga0210386_104489331 | 3300021406 | Soil | MADGSERRVARRFTMSLPLRVLPREARTSELRTQTRDVSYQGLY |
| Ga0210386_117111611 | 3300021406 | Soil | MPDGADRREARRFLMSLPMRVLPQEAQSKELRASTRDVSYRGLYFLSET |
| Ga0210383_101797073 | 3300021407 | Soil | MADGSERRVARRFTMSLPLRVLPRASRNHELRAQTRDVSYQGLYFVAED |
| Ga0210383_106081031 | 3300021407 | Soil | MADGSERRVARRFTMSLPLRVLPREARTSELRTQTRDVSY |
| Ga0210383_113391952 | 3300021407 | Soil | MNEGADRREARRFNMTLPLRVLPHEPRGTELSAQTRDVSYR |
| Ga0210383_115884712 | 3300021407 | Soil | MSDGADRREARRFNMTLPLRVLPHEPHGSELTAQTRDVSYRGLYFLAETKFPI |
| Ga0210392_114001521 | 3300021475 | Soil | MADGSERRVARRFTMSLPLRVLPRASRNHELRAQTRDVSYQGLYFVA |
| Ga0187846_102923992 | 3300021476 | Biofilm | MSDGAERREARRFIMTLPLRVLSHETKGSEFTAHTRDVSYRGLYF |
| Ga0210398_111844661 | 3300021477 | Soil | MGDLSDRREARRFAMNLPVRVLVNDANGPELKANTRDVSYRGLYFVAEAPF |
| Ga0210402_108220471 | 3300021478 | Soil | MGDLSDRREARRFAMNLPVRVLLNDANGPELKANT |
| Ga0210402_110497701 | 3300021478 | Soil | MPDGADRREARRFNMTLPIRLLLQNSQPQELAGQTRDVSYRGLYFLAEANFKI |
| Ga0210410_105929591 | 3300021479 | Soil | MGDLSDRREARRFVMTLPVRVLARDASGPELKAHTRDVSYR |
| Ga0210409_116826681 | 3300021559 | Soil | MSDGADRREARRFNMTLPLRVLPHEPHGSELTAQT |
| Ga0126371_106191941 | 3300021560 | Tropical Forest Soil | MGDLSDRREARRFVMTLPVRVLARDASGPELKAHTRDVSYRG |
| Ga0212123_107883971 | 3300022557 | Iron-Sulfur Acid Spring | MADGSERRVARRFTMSLPLRVLPRESRGHELRTQTRDVSYQ |
| Ga0247695_10724091 | 3300024179 | Soil | MSDGADRREARRFSMSLPMRVLPREAHKQELRANTRDVSYRGL |
| Ga0137417_12344241 | 3300024330 | Vadose Zone Soil | MPDGTDRREARRYSMSLPMRVLAHESQSRELRASTRNVSYRGLYFLSETKFAVGSQ |
| Ga0179591_10667024 | 3300024347 | Vadose Zone Soil | MSDLSDRREARRFSMNLPVRVLVNDANGPELKANTRDVSYRGLYFVVEA |
| Ga0208192_10105094 | 3300025477 | Peatland | MADLSDRREARRFVMTLPVRVMAHDANSPELKAHTRDVSYRGLYFLAEASFE |
| Ga0207647_105811102 | 3300025904 | Corn Rhizosphere | MSEGADRREARRFNMTLPMRILSLDSNSHELKAFTR |
| Ga0207646_105813002 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MPDGADRREARRFNMTLPMRLLPRDSQSPELKAQTRDVSYRGLYFL |
| Ga0207646_110069031 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MPDGADRREARRFNMTLPMRLLPNDSNSFELPAQTRDV |
| Ga0209849_10697681 | 3300026215 | Soil | MADASDRREARRFVMTLPVRVLARDSSGHELKAQTRDVSYRGLYFLT |
| Ga0209438_11983811 | 3300026285 | Grasslands Soil | MPDGADRREARRFSMSLPMRVLPREAHGKTLPGNT |
| Ga0209471_10162156 | 3300026318 | Soil | MADGEERREARRFTMSLPMRVLPREAKGNELDAHTRD |
| Ga0209266_12909521 | 3300026327 | Soil | MGDGAERREARRFTMNLPMRVLRREDKERELDAHTR |
| Ga0209803_13640381 | 3300026332 | Soil | MPDGADRREARRFNMTLPVRLLPRDSQSPELKAQTRDVSYRGLYFLA |
| Ga0257180_10250972 | 3300026354 | Soil | MPDGADRREARRFNMTLPLRLLPSDSNSPELQAQTRDVSYRGLYFLAAAQFKL |
| Ga0257169_10216261 | 3300026469 | Soil | MPDGADRREARRFNMTLPLRLLPSDSNSPELQAQTR |
| Ga0257172_10671752 | 3300026482 | Soil | MPDGADRREARRFLMSLPMRVLPREAHNKELQANTRDVSYRGLYFVSETKF |
| Ga0257160_10622281 | 3300026489 | Soil | MPDGADRREARRFNMTLPLRLLATDSNSPELQAQTRDVSYRGLY |
| Ga0209056_106360161 | 3300026538 | Soil | MSEGADRREARRFTMSLPMRVLPQAAKGRELDAHTRDVSYRGLYFLSDA |
| Ga0209376_11497093 | 3300026540 | Soil | MSDGSERREARRFNMNLPLRVLLREAKGRELKAHTRD |
| Ga0209376_14087681 | 3300026540 | Soil | MSDGSERREARRFNMNLPMRLMPREGKGRELDAHTRDLSYQGLYFLAEA |
| Ga0209648_101806784 | 3300026551 | Grasslands Soil | MGDLSDRREARRFVMTLPVRVLARDASGSELKAHTRDVSYRGLYFLTEAQVT |
| Ga0207728_1066483 | 3300026833 | Tropical Forest Soil | MGDLSDRREARRFVMTLPVRVLAHDVSSPELKAHT |
| Ga0207802_10142231 | 3300026847 | Tropical Forest Soil | MGDLSDRREARRFTMTLPVRVLAREASSPELKAHTRDVSYRGLYFLSDAR |
| Ga0207804_1106482 | 3300026849 | Tropical Forest Soil | MSDLSDRREARRFVMTLPVRVLAHDASSPELKAHTRDV |
| Ga0209325_10442241 | 3300027050 | Forest Soil | MPDGADRREARRFNMTLPMRLLPNDSNSPELPAQTRDVSYRGLYFLAEAQFKL |
| Ga0207777_10973872 | 3300027330 | Tropical Forest Soil | MGDLSDRREARRFVMTLPVRVLAHDVSSPELKAHTR |
| Ga0209529_10587091 | 3300027334 | Forest Soil | MADGSERRVARRFTMSLPLRVLPREARTSELRTQTRDVSYQGLYFLAEAQFEVGTEI |
| Ga0208985_10266681 | 3300027528 | Forest Soil | MADGSERRVARRFTMSLPLRVLARESRSHELRAQTRDVSYQGLYF |
| Ga0209331_11077462 | 3300027603 | Forest Soil | MSDGADRREARRFTMSLPMRVLSLESEGRELSACTRDLSYRGLYFL |
| Ga0207826_11454042 | 3300027680 | Tropical Forest Soil | MSDLSDRREARRFVMTLPVRVLAHDASSPELKAHTRDVSYRGLYFLSEAKF |
| Ga0209248_100295263 | 3300027729 | Bog Forest Soil | MGDLSDRREARRFMMTLPVRVLAHDANSPELRASTRDVS |
| Ga0209112_100416383 | 3300027817 | Forest Soil | MADGSERRVARRFTMSLPLRVLPREARSSELRTQTRDV |
| Ga0209040_100991371 | 3300027824 | Bog Forest Soil | MGDLSDRREARRFVMTLPVRVLAHEVNSPELKANTRDVSYRGLYF |
| Ga0209580_101576613 | 3300027842 | Surface Soil | MSDGSERREARRFNMNLPMRVLPREAKGHELNAQTRDLSYRGLYF |
| Ga0209693_105853481 | 3300027855 | Soil | MAEGSDRRIARRFTMSLPLRILSSEPPSSELRTQTRDVSYQGLYFLAEANFEVG |
| Ga0209167_100574023 | 3300027867 | Surface Soil | MADGSERRVARRFTMSLPLRVLPREARSSELRTQTRD |
| Ga0209169_102617283 | 3300027879 | Soil | MSDGADRREARRFNMTLPLRVLPNKPHGSELSAQTRDVSY |
| Ga0209068_105279252 | 3300027894 | Watersheds | MGDGADRREARRFTMSLPLRVLPREAKGHELDAQTRDVS |
| Ga0209488_105661412 | 3300027903 | Vadose Zone Soil | MTDGADRREARRFSMSLPMRVLPREARSKELRASTRDVSYRGLYFLSETKFDVGH |
| Ga0209488_105845072 | 3300027903 | Vadose Zone Soil | MAGDESERRIARRFLMTLPLRVLPREAQNHELRAQTRDVS |
| Ga0209488_106903932 | 3300027903 | Vadose Zone Soil | MGDGAERREARRFTMSLPMRVFLREAKGRELDAHTRDVSYRGLYFLAEADFK |
| Ga0209698_104653532 | 3300027911 | Watersheds | MSDDSERREARRYSMNLPLRVFQRDEKDHELDGQTRDVSYRGLYFLADVKFE |
| Ga0247675_10619831 | 3300028072 | Soil | MGDGSERREARRFTMTLPLRVFPHESRGTELKAQTRDVSYRGLYFLAEAKFDLG |
| Ga0247684_10329231 | 3300028138 | Soil | MGDASERRVARRFTMSLPLRVLPRESHNSEFRAQTRDVSYQGLYFLAEEKFEVGAEI |
| Ga0247663_10404592 | 3300028145 | Soil | MSVGADRREARRFNMSLPMRILSLDSNSHDLKALTRDVSYRGLYFLAEAEFK |
| Ga0307504_103274341 | 3300028792 | Soil | MSDGADRREARRFTMSLPMRVLPPEAEGREFSAQTRD |
| Ga0222749_101149773 | 3300029636 | Soil | MSDGAERREARRFNMTLPLRVLPFETRGSELQTQTRDVSYRGLYFLADANF |
| Ga0222749_104461822 | 3300029636 | Soil | MPEGVDRRQARRYSMSLPMRVLPRDARSNELRANTRDVSYRGLYFLSETKF |
| Ga0302181_103700152 | 3300030056 | Palsa | MTEGSDRREARRFTMSLPLRVLPNDSWSPELRTQTRDVSY |
| Ga0302183_101864291 | 3300030509 | Palsa | MSTGAERREARRFTMSLPLRVLGGDRGSHPEIETQTRDVSYRGLYFLAEN |
| Ga0075377_113608551 | 3300030844 | Soil | MGDLSGRREARRFVMTLPVRVLARDASGPELKAHTRDVSYRGLYFLTEARFED |
| Ga0170823_131748601 | 3300031128 | Forest Soil | MPDGADRREARRFNMTLPMRLLPNDSNSPELPAQTRDVSYRGLYFLAE |
| Ga0170823_165225851 | 3300031128 | Forest Soil | MPDGADRREARRFNMTLPMRLLPNDSNSPELPAQTRDVSYRGLYFLAEAQFKLGS |
| Ga0318538_102145111 | 3300031546 | Soil | MSIADRREARRFNMTLPMRILSLDSNSHELKAFTRDVSYRGLYFLAET |
| Ga0310915_103640782 | 3300031573 | Soil | MSDGADRREARRFNMTLPMRILSVDSNSPELKAFTRDVSYRGLYFLAEA |
| Ga0318542_101382041 | 3300031668 | Soil | MGDLSDRREARRFTMTLPVRVLAHEASSPELKAHTRDVSYR |
| Ga0318572_108754221 | 3300031681 | Soil | MGDLSDRREARRFTMTLPVRVLAHEASSPELKAHT |
| Ga0307476_107693442 | 3300031715 | Hardwood Forest Soil | MSEGADRREARRFNMTLPLRVLPHEPHGSELMAQTRDVSYRGLYFLAET |
| Ga0307474_100359911 | 3300031718 | Hardwood Forest Soil | MPDGADRREARRFNMTLPMRLLPHDSNSPELPAQTRDV |
| Ga0307474_107267081 | 3300031718 | Hardwood Forest Soil | MGDLSDRREARRFTMTLPVRVLAHEVNSPEMKAHTR |
| Ga0307474_107911491 | 3300031718 | Hardwood Forest Soil | MPDGVDRREARRFSMSLPMRVLPREARGKELRANTRDVSYRGLYF |
| Ga0307474_115070661 | 3300031718 | Hardwood Forest Soil | MPDGADRREARRFSMSLPMRVLPRESRSRELRANTRDVSYRGLYFVSEMKFDV |
| Ga0306917_102829163 | 3300031719 | Soil | MSDGADRREARRFNMTLPMRILSVDSNSPELKAFTRDVSYRGLYFLAEAEFKLGSS |
| Ga0307469_100627581 | 3300031720 | Hardwood Forest Soil | MADGSDRREARRFNMTLPMRVLPRDSQSAEFTAQTRD |
| Ga0307469_101061474 | 3300031720 | Hardwood Forest Soil | MPDGADRREARRFNMTLPMRLLPNDSNSPELPAQTR |
| Ga0307469_103010781 | 3300031720 | Hardwood Forest Soil | MSDASERREARRFTMTLPLRVFPGEIRGLELKAQTRDVSYRGLYF |
| Ga0307469_114095062 | 3300031720 | Hardwood Forest Soil | MTDGADRREARRFSMRLPVRLLPKDSQSPELTAQTRDVSYR |
| Ga0307469_117639401 | 3300031720 | Hardwood Forest Soil | MSDGADRREARRFNMTLPLRVIPPGPHGHELAAQTRDVSYRGL |
| Ga0306918_107472831 | 3300031744 | Soil | MPDESDRRHARRFIMTLPLRVLRRGVHHSELHAQTRDISYRGLYFLTDTRFEP |
| Ga0307475_101390561 | 3300031754 | Hardwood Forest Soil | MPDGADRREARRFLMSLPMRVLTQEAQSKELRASTRDVSYRGLYFLSE |
| Ga0318509_105493662 | 3300031768 | Soil | MSDGADRREARRFNMTLPMRILSVDSNSPELKAFT |
| Ga0318547_109784752 | 3300031781 | Soil | MGDLSDRREARRFTMTLPVRVLAHEASSPELKAHTRDVSYRGLYF |
| Ga0318557_105892602 | 3300031795 | Soil | MSDGSERREARRFNMNLPMRVLSREAKGHELAARTRDLSY |
| Ga0318523_105129231 | 3300031798 | Soil | MSIADRREARRFNMTLPMRILSLDSNSHELKAFTRDV |
| Ga0307473_103963562 | 3300031820 | Hardwood Forest Soil | MSDGAERREARRFTMSLPMRVLPRESQGHELDAHTRDVSYRGLYFLA |
| Ga0307473_106168172 | 3300031820 | Hardwood Forest Soil | MADGSERRVARRFTMSLPLRVLPRASRNHELRAQTRDVSYQGLYFVAEDQFEV |
| Ga0307478_106309752 | 3300031823 | Hardwood Forest Soil | MADGSERRVARRFTMSLPLRVLPREARTSELRTQTRDVSYQGLYFLAEAQFEVG |
| Ga0318564_105222711 | 3300031831 | Soil | MSDGSERREARRFNMNLPMRVLSREAKGHELAARTRDLSYRGLYFLA |
| Ga0318527_104376272 | 3300031859 | Soil | MSIADRREARRFNMTLPMRILSLDSNSHELKAFTRDVSYRGLYFL |
| Ga0306925_1000145623 | 3300031890 | Soil | MGDLSDRREARRFVMTLPVKVLAHDANGPELKAHTRDVSYQG |
| Ga0318536_103041572 | 3300031893 | Soil | MGDLSDRREARRFTMTLPVRVLAHEASSPELKAHTRDVSY |
| Ga0302322_1030923141 | 3300031902 | Fen | MSDLSDRREARRFVMTLPVRVLAKDSHEHELKAHTRDVSYRGLYFLT |
| Ga0306921_118186821 | 3300031912 | Soil | MGDLSDRREARRFVMTLPVRVLARDASGPELKAHTRDVSYRGLYF |
| Ga0310912_102475991 | 3300031941 | Soil | MGDLSDRREARRFVMTLPVKVLAHDANGPELKAHTRDV |
| Ga0310913_112398831 | 3300031945 | Soil | MGDLSDRREARRFTMTLPVRVLAHEASSPELKAHTRDVS |
| Ga0310910_100143646 | 3300031946 | Soil | MGDLSDRREARRFVMTLPVKVLAHDANGPELKAHTRDVSYQGLYFL |
| Ga0310910_113691672 | 3300031946 | Soil | MSDLSDRREARRFVMTLPVRVLAHDASSPELKAHTRDVSYRGLYFLSEAKFED |
| Ga0310909_103652243 | 3300031947 | Soil | MSDLSDRREARRFVMTLPVRVLAHDASSPELKAHTRDVSYRGLYFLSEAKFQDG |
| Ga0307479_118661331 | 3300031962 | Hardwood Forest Soil | MADGSERRVARRFTMSLPLRLLPRASRNHELRAQTRDVSYQGLYFVAEDQFE |
| Ga0310911_103837401 | 3300032035 | Soil | MSIADRREARRFNMTLPMRILSLDSNSHELKAFTR |
| Ga0306924_105129441 | 3300032076 | Soil | MGDLSDRREARRFTMTLPVRVLAHEASSPELKAHTRDVSYRGLYFL |
| Ga0318540_104097862 | 3300032094 | Soil | MTGNRMSDGADRREARRFNMTLPMRILSVDSNSPELKA |
| Ga0311301_122830772 | 3300032160 | Peatlands Soil | MGDLSDRREARRFVMTLPVRVLARDASGSELKAHTRDV |
| Ga0307470_100306854 | 3300032174 | Hardwood Forest Soil | MADGSERRVARRFTMSLPLRVLPRASRNHELRAQTRDVSYQGLYFVAEDQFEVGTEI |
| Ga0307470_106318501 | 3300032174 | Hardwood Forest Soil | MPDGADRREARRFNMTLPMRLLPNDSNSPELPAQTRDVSYRGL |
| Ga0307471_1006235793 | 3300032180 | Hardwood Forest Soil | MGDGAERREARRFTMSLPMRVLPREAKGRELDAHTRDVSYRGLYF |
| Ga0307471_1035299871 | 3300032180 | Hardwood Forest Soil | MPDGADRREARRFNMTLPMRLLPRDSSSPELTAQTR |
| Ga0335085_122671921 | 3300032770 | Soil | MGDLTDRREARRFVMTLPVRVLAREANAPELKAHTRDVSYRGLYFLS |
| Ga0335079_100453991 | 3300032783 | Soil | MGDGSERREARRFNMTLPMRVLPREEHGTELLTHTRDVSYR |
| Ga0335078_100307938 | 3300032805 | Soil | MGDGSERREARRFNMTLPMRVLPREEHGTELLTHT |
| Ga0335071_109532721 | 3300032897 | Soil | MADLSDRREARRFVMTLPVRVMAHDVNSPELKAHTR |
| Ga0307510_105643041 | 3300033180 | Ectomycorrhiza | MPDGADRREARRFNMSLPMRVLATDSHSVELKVQTRDVSYRGLYFLSEMEFKVGN |
| Ga0310914_104489633 | 3300033289 | Soil | MSDGADRREARRFNMTLPMRILSVDSNSPELKAFTRDVSYRGLYFLA |
| ⦗Top⦘ |