Basic Information | |
---|---|
Family ID | F013795 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 268 |
Average Sequence Length | 44 residues |
Representative Sequence | SSDLLRALQLTNPKAVTEPNAHLDRDIPRRAVYARKWEEVKAS |
Number of Associated Samples | 210 |
Number of Associated Scaffolds | 268 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 0.75 % |
% of genes near scaffold ends (potentially truncated) | 98.88 % |
% of genes from short scaffolds (< 2000 bps) | 94.78 % |
Associated GOLD sequencing projects | 194 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.36 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (99.627 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (14.925 % of family members) |
Environment Ontology (ENVO) | Unclassified (30.224 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (50.373 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 32.39% β-sheet: 0.00% Coil/Unstructured: 67.61% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.36 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 268 Family Scaffolds |
---|---|---|
PF00528 | BPD_transp_1 | 26.49 |
PF08402 | TOBE_2 | 1.12 |
PF07969 | Amidohydro_3 | 0.75 |
PF02687 | FtsX | 0.37 |
PF13231 | PMT_2 | 0.37 |
PF03928 | HbpS-like | 0.37 |
PF04343 | DUF488 | 0.37 |
PF10166 | DUF2368 | 0.37 |
PF13377 | Peripla_BP_3 | 0.37 |
PF13449 | Phytase-like | 0.37 |
PF01546 | Peptidase_M20 | 0.37 |
COG ID | Name | Functional Category | % Frequency in 268 Family Scaffolds |
---|---|---|---|
COG3189 | Uncharacterized conserved protein YeaO, DUF488 family | Function unknown [S] | 0.37 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 99.63 % |
Unclassified | root | N/A | 0.37 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2170459002|F0B48LX02F3D09 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
2170459005|F1BAP7Q02J2KBT | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
2189573002|GZIGXIF01ETX1I | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
3300000956|JGI10216J12902_116766646 | All Organisms → cellular organisms → Bacteria | 698 | Open in IMG/M |
3300001686|C688J18823_10531249 | All Organisms → cellular organisms → Bacteria | 753 | Open in IMG/M |
3300004081|Ga0063454_100512316 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycolicibacterium → Mycolicibacterium neoaurum | 847 | Open in IMG/M |
3300004081|Ga0063454_100931697 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycolicibacterium → Mycolicibacterium neoaurum | 690 | Open in IMG/M |
3300004114|Ga0062593_100720919 | All Organisms → cellular organisms → Bacteria | 977 | Open in IMG/M |
3300004153|Ga0063455_100017150 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycolicibacterium → Mycolicibacterium neoaurum | 1868 | Open in IMG/M |
3300004153|Ga0063455_101361600 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
3300004153|Ga0063455_101535938 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
3300004479|Ga0062595_101191866 | All Organisms → cellular organisms → Bacteria | 675 | Open in IMG/M |
3300005177|Ga0066690_10936114 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
3300005179|Ga0066684_10038170 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2676 | Open in IMG/M |
3300005179|Ga0066684_11038217 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
3300005181|Ga0066678_10994766 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
3300005332|Ga0066388_105911535 | All Organisms → cellular organisms → Bacteria | 618 | Open in IMG/M |
3300005335|Ga0070666_11402273 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
3300005337|Ga0070682_100390247 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1050 | Open in IMG/M |
3300005337|Ga0070682_102065208 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
3300005338|Ga0068868_101386261 | All Organisms → cellular organisms → Bacteria | 655 | Open in IMG/M |
3300005339|Ga0070660_100425066 | All Organisms → cellular organisms → Bacteria | 1100 | Open in IMG/M |
3300005341|Ga0070691_10454076 | All Organisms → cellular organisms → Bacteria | 732 | Open in IMG/M |
3300005366|Ga0070659_100324840 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1287 | Open in IMG/M |
3300005436|Ga0070713_102249823 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
3300005437|Ga0070710_11195529 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 562 | Open in IMG/M |
3300005439|Ga0070711_100130829 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycolicibacterium → Mycolicibacterium neoaurum | 1869 | Open in IMG/M |
3300005447|Ga0066689_10826851 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
3300005454|Ga0066687_10098691 | All Organisms → cellular organisms → Bacteria | 1470 | Open in IMG/M |
3300005518|Ga0070699_101264277 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 677 | Open in IMG/M |
3300005546|Ga0070696_101027892 | All Organisms → cellular organisms → Bacteria | 690 | Open in IMG/M |
3300005549|Ga0070704_101101760 | All Organisms → cellular organisms → Bacteria | 721 | Open in IMG/M |
3300005549|Ga0070704_101236111 | All Organisms → cellular organisms → Bacteria | 682 | Open in IMG/M |
3300005552|Ga0066701_10635656 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 646 | Open in IMG/M |
3300005556|Ga0066707_10282569 | All Organisms → cellular organisms → Bacteria | 1086 | Open in IMG/M |
3300005557|Ga0066704_10955853 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
3300005557|Ga0066704_11009850 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
3300005557|Ga0066704_11059195 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
3300005558|Ga0066698_10922221 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
3300005560|Ga0066670_10174874 | All Organisms → cellular organisms → Bacteria | 1274 | Open in IMG/M |
3300005560|Ga0066670_10747985 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
3300005560|Ga0066670_10799623 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
3300005560|Ga0066670_10817390 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
3300005560|Ga0066670_10929297 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 530 | Open in IMG/M |
3300005563|Ga0068855_101996741 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
3300005569|Ga0066705_10863403 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 538 | Open in IMG/M |
3300005575|Ga0066702_10365434 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 878 | Open in IMG/M |
3300005575|Ga0066702_10510672 | All Organisms → cellular organisms → Bacteria | 731 | Open in IMG/M |
3300005614|Ga0068856_100942701 | All Organisms → cellular organisms → Bacteria | 882 | Open in IMG/M |
3300005614|Ga0068856_102720181 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
3300005713|Ga0066905_100112299 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycolicibacterium → Mycolicibacterium neoaurum | 1880 | Open in IMG/M |
3300005764|Ga0066903_100305494 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2523 | Open in IMG/M |
3300005764|Ga0066903_104891294 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 712 | Open in IMG/M |
3300005764|Ga0066903_105308933 | All Organisms → cellular organisms → Bacteria | 681 | Open in IMG/M |
3300005841|Ga0068863_102379724 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycolicibacterium → Mycolicibacterium neoaurum | 539 | Open in IMG/M |
3300006028|Ga0070717_10092001 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2562 | Open in IMG/M |
3300006046|Ga0066652_101743477 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 566 | Open in IMG/M |
3300006046|Ga0066652_102035699 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
3300006046|Ga0066652_102035726 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
3300006059|Ga0075017_100778780 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 738 | Open in IMG/M |
3300006173|Ga0070716_101788169 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
3300006175|Ga0070712_100046583 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2998 | Open in IMG/M |
3300006175|Ga0070712_100301669 | All Organisms → cellular organisms → Bacteria | 1297 | Open in IMG/M |
3300006581|Ga0074048_13089255 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
3300006755|Ga0079222_10544861 | All Organisms → cellular organisms → Bacteria | 866 | Open in IMG/M |
3300006791|Ga0066653_10538417 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
3300006796|Ga0066665_11181053 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
3300006797|Ga0066659_11410630 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
3300006797|Ga0066659_11944952 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
3300006804|Ga0079221_11361770 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
3300006854|Ga0075425_100692932 | All Organisms → cellular organisms → Bacteria | 1170 | Open in IMG/M |
3300009012|Ga0066710_101146987 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1203 | Open in IMG/M |
3300009012|Ga0066710_102830821 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 684 | Open in IMG/M |
3300009012|Ga0066710_103060734 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
3300009012|Ga0066710_104811554 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
3300009088|Ga0099830_10371888 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1152 | Open in IMG/M |
3300009088|Ga0099830_11792472 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
3300009090|Ga0099827_11933605 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
3300009093|Ga0105240_12639543 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
3300009098|Ga0105245_11255210 | All Organisms → cellular organisms → Bacteria | 789 | Open in IMG/M |
3300009137|Ga0066709_100017513 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Sphaerobacteridae → Sphaerobacterales → Sphaerobacterineae → Sphaerobacteraceae → Nitrolancea → Nitrolancea hollandica | 7016 | Open in IMG/M |
3300009148|Ga0105243_10201952 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycolicibacterium → Mycolicibacterium neoaurum | 1744 | Open in IMG/M |
3300009174|Ga0105241_11901872 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 583 | Open in IMG/M |
3300009176|Ga0105242_11464985 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 712 | Open in IMG/M |
3300009551|Ga0105238_11130302 | All Organisms → cellular organisms → Bacteria | 807 | Open in IMG/M |
3300009553|Ga0105249_10623579 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1134 | Open in IMG/M |
3300009553|Ga0105249_11375888 | All Organisms → cellular organisms → Bacteria | 778 | Open in IMG/M |
3300010044|Ga0126310_10479693 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 904 | Open in IMG/M |
3300010229|Ga0136218_1011817 | Not Available | 882 | Open in IMG/M |
3300010303|Ga0134082_10370111 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 609 | Open in IMG/M |
3300010321|Ga0134067_10497062 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
3300010322|Ga0134084_10152369 | All Organisms → cellular organisms → Bacteria | 778 | Open in IMG/M |
3300010322|Ga0134084_10257206 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
3300010323|Ga0134086_10451120 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
3300010336|Ga0134071_10812545 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
3300010360|Ga0126372_11722478 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 668 | Open in IMG/M |
3300010360|Ga0126372_11990792 | All Organisms → cellular organisms → Bacteria | 627 | Open in IMG/M |
3300010361|Ga0126378_12589098 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
3300010362|Ga0126377_11839736 | All Organisms → cellular organisms → Bacteria | 681 | Open in IMG/M |
3300010362|Ga0126377_12320334 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
3300010366|Ga0126379_11464519 | All Organisms → cellular organisms → Bacteria | 789 | Open in IMG/M |
3300010366|Ga0126379_11475547 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 786 | Open in IMG/M |
3300010366|Ga0126379_12282649 | All Organisms → cellular organisms → Bacteria | 641 | Open in IMG/M |
3300010373|Ga0134128_11264516 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 814 | Open in IMG/M |
3300010375|Ga0105239_11631588 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 746 | Open in IMG/M |
3300010376|Ga0126381_100257002 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2371 | Open in IMG/M |
3300010376|Ga0126381_104111128 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
3300010396|Ga0134126_10858227 | All Organisms → cellular organisms → Bacteria | 1023 | Open in IMG/M |
3300010400|Ga0134122_13205422 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
3300011270|Ga0137391_10795725 | All Organisms → cellular organisms → Bacteria | 779 | Open in IMG/M |
3300011271|Ga0137393_11152602 | All Organisms → cellular organisms → Bacteria | 658 | Open in IMG/M |
3300011439|Ga0137432_1226861 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
3300011999|Ga0120148_1040582 | All Organisms → cellular organisms → Bacteria | 968 | Open in IMG/M |
3300012096|Ga0137389_11133498 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 670 | Open in IMG/M |
3300012198|Ga0137364_10334543 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1128 | Open in IMG/M |
3300012198|Ga0137364_10947430 | All Organisms → cellular organisms → Bacteria | 652 | Open in IMG/M |
3300012199|Ga0137383_10142438 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycolicibacterium → Mycolicibacterium neoaurum | 1753 | Open in IMG/M |
3300012200|Ga0137382_10085990 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycolicibacterium → Mycolicibacterium neoaurum | 2048 | Open in IMG/M |
3300012200|Ga0137382_10288332 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1143 | Open in IMG/M |
3300012200|Ga0137382_10389596 | All Organisms → cellular organisms → Bacteria | 981 | Open in IMG/M |
3300012201|Ga0137365_10883498 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 653 | Open in IMG/M |
3300012201|Ga0137365_11022352 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
3300012205|Ga0137362_10950310 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 733 | Open in IMG/M |
3300012206|Ga0137380_10297501 | All Organisms → cellular organisms → Bacteria | 1446 | Open in IMG/M |
3300012206|Ga0137380_10919443 | All Organisms → cellular organisms → Bacteria | 751 | Open in IMG/M |
3300012207|Ga0137381_11162132 | All Organisms → cellular organisms → Bacteria | 663 | Open in IMG/M |
3300012208|Ga0137376_10002076 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 11763 | Open in IMG/M |
3300012208|Ga0137376_10479093 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1080 | Open in IMG/M |
3300012209|Ga0137379_10215881 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycolicibacterium → Mycolicibacterium neoaurum | 1832 | Open in IMG/M |
3300012210|Ga0137378_10264838 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycolicibacterium → Mycolicibacterium neoaurum | 1599 | Open in IMG/M |
3300012211|Ga0137377_10302504 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycolicibacterium → Mycolicibacterium neoaurum | 1534 | Open in IMG/M |
3300012211|Ga0137377_10770794 | All Organisms → cellular organisms → Bacteria | 895 | Open in IMG/M |
3300012211|Ga0137377_11840547 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
3300012285|Ga0137370_10796420 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
3300012355|Ga0137369_11139525 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
3300012356|Ga0137371_10567518 | All Organisms → cellular organisms → Bacteria | 873 | Open in IMG/M |
3300012357|Ga0137384_11086522 | All Organisms → cellular organisms → Bacteria | 641 | Open in IMG/M |
3300012357|Ga0137384_11233803 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
3300012361|Ga0137360_10177231 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycolicibacterium → Mycolicibacterium neoaurum | 1711 | Open in IMG/M |
3300012362|Ga0137361_11449010 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 609 | Open in IMG/M |
3300012896|Ga0157303_10271119 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 528 | Open in IMG/M |
3300012907|Ga0157283_10006539 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycolicibacterium → Mycolicibacterium neoaurum | 1810 | Open in IMG/M |
3300012907|Ga0157283_10299755 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
3300012912|Ga0157306_10000818 | All Organisms → cellular organisms → Bacteria | 6010 | Open in IMG/M |
3300012944|Ga0137410_10831723 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 777 | Open in IMG/M |
3300012951|Ga0164300_10173090 | All Organisms → cellular organisms → Bacteria | 1033 | Open in IMG/M |
3300012951|Ga0164300_10379822 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 769 | Open in IMG/M |
3300012955|Ga0164298_10737247 | All Organisms → cellular organisms → Bacteria | 696 | Open in IMG/M |
3300012960|Ga0164301_11554232 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 547 | Open in IMG/M |
3300012961|Ga0164302_10806771 | All Organisms → cellular organisms → Bacteria | 709 | Open in IMG/M |
3300012971|Ga0126369_12650525 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
3300012971|Ga0126369_13038278 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
3300012971|Ga0126369_13184494 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
3300012975|Ga0134110_10480633 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
3300012977|Ga0134087_10623232 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
3300012977|Ga0134087_10634072 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
3300012984|Ga0164309_10082595 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycolicibacterium → Mycolicibacterium neoaurum | 1974 | Open in IMG/M |
3300012985|Ga0164308_10294750 | All Organisms → cellular organisms → Bacteria | 1285 | Open in IMG/M |
3300012985|Ga0164308_11709170 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
3300012986|Ga0164304_10030377 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2753 | Open in IMG/M |
3300012987|Ga0164307_11183543 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
3300012988|Ga0164306_10632528 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 842 | Open in IMG/M |
3300012988|Ga0164306_11439279 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
3300012988|Ga0164306_11836523 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
3300012989|Ga0164305_11489358 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
3300012989|Ga0164305_11527855 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 593 | Open in IMG/M |
3300013104|Ga0157370_10402135 | All Organisms → cellular organisms → Bacteria | 1260 | Open in IMG/M |
3300013307|Ga0157372_10249038 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2062 | Open in IMG/M |
3300013763|Ga0120179_1034463 | All Organisms → cellular organisms → Bacteria | 1195 | Open in IMG/M |
3300013765|Ga0120172_1092050 | All Organisms → cellular organisms → Bacteria | 741 | Open in IMG/M |
3300014150|Ga0134081_10210981 | All Organisms → cellular organisms → Bacteria | 664 | Open in IMG/M |
3300015201|Ga0173478_10365782 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 678 | Open in IMG/M |
3300015261|Ga0182006_1164279 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 746 | Open in IMG/M |
3300015358|Ga0134089_10327571 | All Organisms → cellular organisms → Bacteria | 641 | Open in IMG/M |
3300015374|Ga0132255_103698339 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 650 | Open in IMG/M |
3300016319|Ga0182033_10507644 | All Organisms → cellular organisms → Bacteria | 1037 | Open in IMG/M |
3300016445|Ga0182038_11822983 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
3300017654|Ga0134069_1306780 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
3300017657|Ga0134074_1151396 | All Organisms → cellular organisms → Bacteria | 811 | Open in IMG/M |
3300017659|Ga0134083_10548589 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
3300017937|Ga0187809_10083876 | All Organisms → cellular organisms → Bacteria | 1054 | Open in IMG/M |
3300017993|Ga0187823_10152549 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 730 | Open in IMG/M |
3300018032|Ga0187788_10221692 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 740 | Open in IMG/M |
3300018433|Ga0066667_10605854 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 913 | Open in IMG/M |
3300019356|Ga0173481_10810307 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
3300019789|Ga0137408_1102336 | All Organisms → cellular organisms → Bacteria | 788 | Open in IMG/M |
3300019875|Ga0193701_1095345 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
3300020001|Ga0193731_1146879 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 582 | Open in IMG/M |
3300020069|Ga0197907_10215802 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 662 | Open in IMG/M |
3300020140|Ga0179590_1056275 | All Organisms → cellular organisms → Bacteria | 1021 | Open in IMG/M |
3300021080|Ga0210382_10066161 | All Organisms → cellular organisms → Bacteria | 1454 | Open in IMG/M |
3300021080|Ga0210382_10124508 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1090 | Open in IMG/M |
3300021344|Ga0193719_10381979 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 582 | Open in IMG/M |
3300021413|Ga0193750_1032352 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1180 | Open in IMG/M |
3300021478|Ga0210402_11039405 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 746 | Open in IMG/M |
3300021560|Ga0126371_11030273 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 964 | Open in IMG/M |
3300022756|Ga0222622_10719635 | All Organisms → cellular organisms → Bacteria | 726 | Open in IMG/M |
3300022883|Ga0247786_1000953 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 5271 | Open in IMG/M |
3300022899|Ga0247795_1047311 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 719 | Open in IMG/M |
3300024177|Ga0247686_1051865 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
3300024181|Ga0247693_1038493 | All Organisms → cellular organisms → Bacteria | 674 | Open in IMG/M |
3300024249|Ga0247676_1000826 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4625 | Open in IMG/M |
3300024288|Ga0179589_10615400 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
3300025711|Ga0207696_1155126 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
3300025903|Ga0207680_10730782 | All Organisms → cellular organisms → Bacteria | 710 | Open in IMG/M |
3300025912|Ga0207707_11527487 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
3300025914|Ga0207671_10139717 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycolicibacterium → Mycolicibacterium neoaurum | 1865 | Open in IMG/M |
3300025916|Ga0207663_10370776 | All Organisms → cellular organisms → Bacteria | 1088 | Open in IMG/M |
3300025917|Ga0207660_10623676 | All Organisms → cellular organisms → Bacteria | 879 | Open in IMG/M |
3300025921|Ga0207652_10725531 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 886 | Open in IMG/M |
3300025921|Ga0207652_11504316 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
3300025924|Ga0207694_11889044 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
3300025928|Ga0207700_11945590 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
3300025929|Ga0207664_10931452 | All Organisms → cellular organisms → Bacteria | 780 | Open in IMG/M |
3300025929|Ga0207664_11139395 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 697 | Open in IMG/M |
3300025939|Ga0207665_11454323 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 545 | Open in IMG/M |
3300025941|Ga0207711_11265483 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 680 | Open in IMG/M |
3300025945|Ga0207679_12153855 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
3300025961|Ga0207712_11193111 | All Organisms → cellular organisms → Bacteria | 679 | Open in IMG/M |
3300026075|Ga0207708_11937730 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
3300026078|Ga0207702_10597773 | All Organisms → cellular organisms → Bacteria | 1082 | Open in IMG/M |
3300026078|Ga0207702_11913995 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
3300026121|Ga0207683_10381846 | All Organisms → cellular organisms → Bacteria | 1295 | Open in IMG/M |
3300026305|Ga0209688_1072359 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 621 | Open in IMG/M |
3300026322|Ga0209687_1273780 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 528 | Open in IMG/M |
3300026326|Ga0209801_1243504 | All Organisms → cellular organisms → Bacteria | 689 | Open in IMG/M |
3300026329|Ga0209375_1084942 | All Organisms → cellular organisms → Bacteria | 1456 | Open in IMG/M |
3300026330|Ga0209473_1195805 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 769 | Open in IMG/M |
3300026527|Ga0209059_1125612 | All Organisms → cellular organisms → Bacteria | 973 | Open in IMG/M |
3300026530|Ga0209807_1060635 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycolicibacterium → Mycolicibacterium neoaurum | 1717 | Open in IMG/M |
3300026532|Ga0209160_1247118 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 609 | Open in IMG/M |
3300026550|Ga0209474_10010702 | All Organisms → cellular organisms → Bacteria | 7418 | Open in IMG/M |
3300026550|Ga0209474_10289927 | All Organisms → cellular organisms → Bacteria | 975 | Open in IMG/M |
3300027379|Ga0209842_1057940 | All Organisms → cellular organisms → Bacteria | 693 | Open in IMG/M |
3300027875|Ga0209283_10547270 | All Organisms → cellular organisms → Bacteria | 740 | Open in IMG/M |
3300027882|Ga0209590_10088900 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycolicibacterium → Mycolicibacterium neoaurum | 1821 | Open in IMG/M |
3300027882|Ga0209590_10495542 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 789 | Open in IMG/M |
3300027882|Ga0209590_10980165 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
3300027910|Ga0209583_10058534 | All Organisms → cellular organisms → Bacteria | 1379 | Open in IMG/M |
3300028293|Ga0247662_1029443 | All Organisms → cellular organisms → Bacteria | 928 | Open in IMG/M |
3300028711|Ga0307293_10197603 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
3300028881|Ga0307277_10308027 | All Organisms → cellular organisms → Bacteria | 703 | Open in IMG/M |
3300028884|Ga0307308_10210589 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 931 | Open in IMG/M |
3300028884|Ga0307308_10513339 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 575 | Open in IMG/M |
3300031545|Ga0318541_10471779 | All Organisms → cellular organisms → Bacteria | 702 | Open in IMG/M |
3300031719|Ga0306917_10790902 | All Organisms → cellular organisms → Bacteria | 744 | Open in IMG/M |
3300031747|Ga0318502_10776711 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
3300031751|Ga0318494_10517694 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 696 | Open in IMG/M |
3300031754|Ga0307475_10844866 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 725 | Open in IMG/M |
3300031754|Ga0307475_11585829 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
3300031764|Ga0318535_10341603 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 669 | Open in IMG/M |
3300031765|Ga0318554_10486072 | All Organisms → cellular organisms → Bacteria | 699 | Open in IMG/M |
3300031770|Ga0318521_10759449 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
3300031779|Ga0318566_10290937 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 808 | Open in IMG/M |
3300031782|Ga0318552_10351830 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 750 | Open in IMG/M |
3300031820|Ga0307473_11017886 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
3300031832|Ga0318499_10203932 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 771 | Open in IMG/M |
3300031944|Ga0310884_10921859 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
3300032041|Ga0318549_10288301 | All Organisms → cellular organisms → Bacteria | 740 | Open in IMG/M |
3300032044|Ga0318558_10366997 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 715 | Open in IMG/M |
3300032068|Ga0318553_10544622 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
3300032075|Ga0310890_10791257 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 750 | Open in IMG/M |
3300032091|Ga0318577_10592391 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
3300032770|Ga0335085_10351602 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycolicibacterium → Mycolicibacterium neoaurum | 1727 | Open in IMG/M |
3300033004|Ga0335084_10366115 | All Organisms → cellular organisms → Bacteria | 1487 | Open in IMG/M |
3300033158|Ga0335077_11912892 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 554 | Open in IMG/M |
3300033480|Ga0316620_11095757 | All Organisms → cellular organisms → Bacteria | 778 | Open in IMG/M |
3300033550|Ga0247829_11697138 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 14.93% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 14.18% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 10.82% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.72% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.97% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.22% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 5.22% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.24% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 2.24% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 2.24% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.24% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.87% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.87% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.87% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.49% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.12% |
Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 1.12% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.12% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.12% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.12% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.12% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.12% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.75% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.75% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.75% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.75% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.75% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.75% |
Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.75% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.75% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.75% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.75% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.37% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.37% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.37% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.37% |
Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.37% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.37% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.37% |
Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.37% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.37% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.37% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.37% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.37% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.37% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.37% |
Soil | Engineered → Lab Enrichment → Unclassified → Unclassified → Unclassified → Soil | 0.37% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2170459002 | Grass soil microbial communities from Rothamsted Park, UK - March 2009 direct MP BIO 1O1 lysis 0-21 cm | Environmental | Open in IMG/M |
2170459005 | Grass soil microbial communities from Rothamsted Park, UK - July 2009 direct MP BIO1O1 lysis 0-21cm | Environmental | Open in IMG/M |
2189573002 | Grass soil microbial communities from Rothamsted Park, UK - FE1 (NaCl 30g/L 5ml) | Environmental | Open in IMG/M |
3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
3300001686 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
3300004081 | Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2) | Environmental | Open in IMG/M |
3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
3300004153 | Grasslands soil microbial communities from Hopland, California, USA (version 2) | Environmental | Open in IMG/M |
3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Host-Associated | Open in IMG/M |
3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Environmental | Open in IMG/M |
3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
3300006581 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
3300010229 | Soil microbial communities from Bangor area, North Wales, UK, treated with sorgoleone, replicate 1 | Engineered | Open in IMG/M |
3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
3300010321 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015 | Environmental | Open in IMG/M |
3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
3300011439 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT820_2 | Environmental | Open in IMG/M |
3300011999 | Permafrost microbial communities from Nunavut, Canada - A28_65cm_6M | Environmental | Open in IMG/M |
3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
3300012896 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S118-311C-2 | Environmental | Open in IMG/M |
3300012907 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S044-104R-1 | Environmental | Open in IMG/M |
3300012912 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S163-409C-2 | Environmental | Open in IMG/M |
3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Host-Associated | Open in IMG/M |
3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
3300013763 | Permafrost microbial communities from Nunavut, Canada - A15_65cm_0M | Environmental | Open in IMG/M |
3300013765 | Permafrost microbial communities from Nunavut, Canada - A30_80cm_6M | Environmental | Open in IMG/M |
3300014150 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300015201 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1 (version 2) | Environmental | Open in IMG/M |
3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Host-Associated | Open in IMG/M |
3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
3300017654 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300017657 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015 | Environmental | Open in IMG/M |
3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300017937 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4 | Environmental | Open in IMG/M |
3300017993 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_3 | Environmental | Open in IMG/M |
3300018032 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP10_20_MG | Environmental | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300019356 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2) | Environmental | Open in IMG/M |
3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300019875 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3s2 | Environmental | Open in IMG/M |
3300020001 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a2 | Environmental | Open in IMG/M |
3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300020140 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300021080 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redo | Environmental | Open in IMG/M |
3300021344 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2 | Environmental | Open in IMG/M |
3300021413 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c1 | Environmental | Open in IMG/M |
3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
3300022883 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S066-202C-4 | Environmental | Open in IMG/M |
3300022899 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S016-104C-6 | Environmental | Open in IMG/M |
3300024177 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK27 | Environmental | Open in IMG/M |
3300024181 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK34 | Environmental | Open in IMG/M |
3300024249 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK17 | Environmental | Open in IMG/M |
3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026305 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 (SPAdes) | Environmental | Open in IMG/M |
3300026322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 (SPAdes) | Environmental | Open in IMG/M |
3300026326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes) | Environmental | Open in IMG/M |
3300026329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 (SPAdes) | Environmental | Open in IMG/M |
3300026330 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes) | Environmental | Open in IMG/M |
3300026527 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 (SPAdes) | Environmental | Open in IMG/M |
3300026530 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 (SPAdes) | Environmental | Open in IMG/M |
3300026532 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 (SPAdes) | Environmental | Open in IMG/M |
3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
3300027379 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_10_20 (SPAdes) | Environmental | Open in IMG/M |
3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027910 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes) | Environmental | Open in IMG/M |
3300028293 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK03 | Environmental | Open in IMG/M |
3300028711 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_150 | Environmental | Open in IMG/M |
3300028881 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116 | Environmental | Open in IMG/M |
3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
3300031764 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27 | Environmental | Open in IMG/M |
3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
3300031832 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25 | Environmental | Open in IMG/M |
3300031944 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1 | Environmental | Open in IMG/M |
3300032041 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22 | Environmental | Open in IMG/M |
3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
3300033480 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D5_B | Environmental | Open in IMG/M |
3300033550 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
E1_03785960 | 2170459002 | Grass Soil | ATLKALLLNNPKGITEPYAHLDRNIPRRPLYEQIWEEVKAA |
E41_09045010 | 2170459005 | Grass Soil | ANVEARPASSDLLNALQLTNPRAVAEPNAHLDRDIPRRPVYAKAWEEVKAS |
FE1_05545260 | 2189573002 | Grass Soil | PSSSALLKALQLTNPKAVTLPNAYLDRDIPNRTTYAHLWEQVKAA |
JGI10216J12902_1167666462 | 3300000956 | Soil | TSKDLISALKLNTPSAITEPHAHIDRDIRRRALYARLWEEVKAS* |
C688J18823_105312492 | 3300001686 | Soil | QLANPKAVTEPNAHLDRDIPRRAVYAKYWEEVKAA* |
Ga0063454_1005123161 | 3300004081 | Soil | NTHAKPTSKDLISALKLNNPGAIREPQAHIDRDIPRRAVYARMWEEVKAS* |
Ga0063454_1009316972 | 3300004081 | Soil | KDLLKALQLTNPRALQEPAAHIDRYIPRRREYARAWEEVKAS* |
Ga0062593_1007209191 | 3300004114 | Soil | NVKARPSSSDLLKALQLTNPRAVTEPAAHLDRDIPRRAVYARAWEQVKAS* |
Ga0063455_1000171503 | 3300004153 | Soil | HANIEARPTSSDLLHALKLTDPHAVGLPNAYLDRNIPQRAAYAKLWDQVKAA* |
Ga0063455_1013616002 | 3300004153 | Soil | SSDLLRALQLTNPKAVTEPNAHLDRDIPRRAVYARKWEEVKAS* |
Ga0063455_1015359382 | 3300004153 | Soil | RPSSADLARVLQISNPKAVGLPNAYLDRDIPRRAVYARMWEEVKAS* |
Ga0062595_1011918661 | 3300004479 | Soil | LRVLKLTNPKAVTVPNAYLDRDIPRRAVYARLWEEVKAS* |
Ga0066690_109361141 | 3300005177 | Soil | ANTLARPSSSDLLNALQLSNPRAVAEPNAHLDRDIPRRALYAKMWQEVKAA* |
Ga0066684_100381701 | 3300005179 | Soil | PTSSDLLRALQLTNPQAVTLPYAHLDRDVPRRATYAKLWDEVKSS* |
Ga0066684_110382171 | 3300005179 | Soil | PSSSDLLRALQLTNPRAVTLPNAYLDRDIPRRALYARTWEEVKAA* |
Ga0066678_109947662 | 3300005181 | Soil | SSDLLHALQLTNPRAVTEPNAHLDRDIPRRQVYAKIWEEVKAA* |
Ga0066388_1059115352 | 3300005332 | Tropical Forest Soil | QAKPSSSALLKALQLTNPKAVTLPNAYLDRDIPNRAQYAHLWEQVKAA* |
Ga0070666_114022731 | 3300005335 | Switchgrass Rhizosphere | RPSSSDLLRALQLTNLRAVTEPNAYMDRDIPRRALYAKTWEQVKAS* |
Ga0070682_1003902472 | 3300005337 | Corn Rhizosphere | PASSDLLKVLQLTNPNAVQEPNAHIDRHIPRRAVYARLWEEVKAS* |
Ga0070682_1020652082 | 3300005337 | Corn Rhizosphere | SSALLKALQLTNPRAVTLPNAYLDRNIPNRAEYAHLWEQVKAA* |
Ga0068868_1013862612 | 3300005338 | Miscanthus Rhizosphere | SDLLKALQLTNPKAVTEPYAHLDRDIPRRATYARLWEEVKAS* |
Ga0070660_1004250662 | 3300005339 | Corn Rhizosphere | ARPASSDLLKALQLTNPRAVTEPAAHLDRDIPRRATYANLWEQVKAS* |
Ga0070691_104540762 | 3300005341 | Corn, Switchgrass And Miscanthus Rhizosphere | PSSSDLLHALQLTNPRAVTEPNAHLDRDIPRRALYAKTWEEVKAA* |
Ga0070659_1003248401 | 3300005366 | Corn Rhizosphere | GEANTLARPTSSDLLKVLKLTNPRAVQEPNAHIDRHIPRRSLYARMWEEVKAS* |
Ga0070713_1022498231 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | HANTTARPSSSDLLKALQLTNPHAVTLPNAYLDRDVPRRSLYAKLWEEVKAS* |
Ga0070710_111955291 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | ARPASSDLLKALQLTNPRAVTEPYAHLDRDIPRRATYANLWEQVKAS* |
Ga0070711_1001308291 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | ARPSSSDLLKALQLTKPRAVTEPNAHLDRDIPRRAVYARMWEEVKAS* |
Ga0066689_108268511 | 3300005447 | Soil | LKALQLTNPRAVTLPNAYLGRDVPRRALYGKLWEEVKAH* |
Ga0066687_100986911 | 3300005454 | Soil | TLARPSSSDLLNALQLSNPRAVAEPNAHLDRDIPRRALYAKMWQEVKAA* |
Ga0070699_1012642771 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | NTLAKPASSDLLKALQLTNPRAVALPNAYLDRNVPRRAVYAKAWDEVKAA* |
Ga0070696_1010278922 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | DLLKALQLTNPRAIQEPAAHIDRYIPRRRIYARLWEEVKAS* |
Ga0070704_1011017602 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | ADLARVLQIANPKAVGLPNAYLDRDIPRRAVYARMWEEVKAA* |
Ga0070704_1012361111 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | PSSSDLLRALQLTNPRAVTEPNAYLDRDIPRRALYAKMWEQVKAS* |
Ga0066701_106356561 | 3300005552 | Soil | RALQLTNLRAVTEPNAYMDRDIPRRALYAKTWEQVKAS* |
Ga0066707_102825691 | 3300005556 | Soil | LRVLRLSNPKAVTLPNAYLDRDIPRRALYAKMWEEVKAS* |
Ga0066704_109558531 | 3300005557 | Soil | HALKLTNPKAVTEPNAHLDRDIPRRALYAKMWQEVKAA* |
Ga0066704_110098502 | 3300005557 | Soil | SQLLKALQLTNPKAVTLPNAYLDRDIPQRSTYANLWEEVKRA* |
Ga0066704_110591952 | 3300005557 | Soil | ANTLARPSSSDLLKALQLANPKAVTLPNAYLDRDVPRRAVYAKLWEEIKAS* |
Ga0066698_109222211 | 3300005558 | Soil | LNLSNPKAVVEPNAHMDRDVPRRDLYIKLWEQVKAS* |
Ga0066670_101748741 | 3300005560 | Soil | LLKALQLTNTRAVTEPAAHLDRDIPRRAQYARMWEEVKASG* |
Ga0066670_107479851 | 3300005560 | Soil | SADLLKVLKLTNPSAVQEPNAHIDRHVPRRALYARLWEEVKAS* |
Ga0066670_107996232 | 3300005560 | Soil | LNALQLSNPRAVAEPNAHLDRDIPRRALYAKMWQEVKAA* |
Ga0066670_108173902 | 3300005560 | Soil | RLARPSSSALLKALQLTDPKAVTEPSAHLDRDIPRRALYAKMWEEVKAS* |
Ga0066670_109292972 | 3300005560 | Soil | ANTLARPASSDLLKALQLTNPRAVTLPNAYLDRNVPRRAVYAKAWDEVKAA* |
Ga0068855_1019967411 | 3300005563 | Corn Rhizosphere | SDLLKALQLTNPRAVTEPNAHLDRDIPQRQLYAKMWEEVKAA* |
Ga0066705_108634031 | 3300005569 | Soil | ASSDLLKALQLTNPRAVTLPNAYLDRNIPQRALYAKTWEEVKAA* |
Ga0066702_103654341 | 3300005575 | Soil | NTLARPASSDLLRALQLTNPRAVTEPNAYLDRDIPRRALYAKLWEQVKAS* |
Ga0066702_105106721 | 3300005575 | Soil | LTNPQAVTLPYAHLDRDVPRRATYAKLWDEVKSS* |
Ga0068856_1009427012 | 3300005614 | Corn Rhizosphere | HANVLARPSSSDLLKALQLTNPKAVTEPYAHLDRDIPRRATYARLWEEVKAS* |
Ga0068856_1027201812 | 3300005614 | Corn Rhizosphere | SDLLHALQLTNPRAVTLPNAYLDRDIPRRANYARAWEEVKAS* |
Ga0066905_1001122991 | 3300005713 | Tropical Forest Soil | SSSDLLHALKLTNPKAVTQPNAYLDRDIPRRAVYARLWEEVKAS* |
Ga0066903_1003054941 | 3300005764 | Tropical Forest Soil | LQLTNPKAVTLPNAYLDRDIPQRAQYAQLWEEVKRS* |
Ga0066903_1048912941 | 3300005764 | Tropical Forest Soil | LKALQLSNPKAVTLPNAYLDRNIPQRATYAHLWEQVKAA* |
Ga0066903_1053089332 | 3300005764 | Tropical Forest Soil | LLKALQLTNPRAVTEPSAHLDRDIPRRAVYARLWEQVKAA* |
Ga0068863_1023797241 | 3300005841 | Switchgrass Rhizosphere | RPASKDLLTALKLTNPRAIQEPNAHIDRYIPRRREYAKAWEEVKAS* |
Ga0070717_100920011 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | ALQLTNPKAVTLPNAYLDRDTPRRALYAKLWEEVKAS* |
Ga0066652_1017434772 | 3300006046 | Soil | KALQLANPRAVTLPNAYLDRDIPQRALYAHLWEQVKASG* |
Ga0066652_1020356991 | 3300006046 | Soil | RALQLGNPRAVTEPNAHLDRDIPRRSTYAHMWEQVKAS* |
Ga0066652_1020357262 | 3300006046 | Soil | PSSSALLKALQLTNPKAVTEPAAHLDRDIPRRAVYARMWEEVKAS* |
Ga0075017_1007787801 | 3300006059 | Watersheds | SVDLVKALQLNNPKAVDLPNAYLDRDIPQRALYAKLWEEVKAS* |
Ga0070716_1017881692 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | RPASSDLLKALQLTNPRAVTEPAAHLDRDIPRRAVYARMWEEVKAS* |
Ga0070712_1000465831 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | SDLLKALQLTNPRAVTEPAAHLDRDIPRRAVYARAWEQVKAS* |
Ga0070712_1003016693 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | SSDLLKALQLTNPRAVALPNAYLDRNVPRRAVYAKAWDEVKAA* |
Ga0074048_130892552 | 3300006581 | Soil | DLTNPRALLEPHAHIDRYIPRRREYARAWEEVKAS* |
Ga0079222_105448612 | 3300006755 | Agricultural Soil | EANTVARPSSSDLLHALQLTNPHAVTEPAAHLDRDIPQRALYARLWEEVKAS* |
Ga0066653_105384172 | 3300006791 | Soil | LQIANPRAVALPNAYLDRDIPRRSLYARMWEEVKAA* |
Ga0066665_111810531 | 3300006796 | Soil | TQAKPSSSQLLKALQLTNPKAVTLPNAYLDRDIPQRSTYANLWEEVKRA* |
Ga0066659_114106302 | 3300006797 | Soil | LQLTNPKAVTLPNAYLDRDIPNRATYAHLWEQVKAA* |
Ga0066659_119449522 | 3300006797 | Soil | QLLKALQLTNPKAVTLPNAYLDRDIPQRSTYANLWEEVKRA* |
Ga0079221_113617702 | 3300006804 | Agricultural Soil | SDLLRVLKLADPRAVTLPNAYLDRDVPRRATYAKLWEEVKAS* |
Ga0075425_1006929323 | 3300006854 | Populus Rhizosphere | RPSSSDLLHALKLTNPKSVTLPNAYLDRDVPRRAVYARLWEEVKAS* |
Ga0066710_1011469871 | 3300009012 | Grasslands Soil | ARPSSSDLLRALQLTNLRAVTEPNAYMDRDIPRRALYAKTWEQVKAS |
Ga0066710_1028308212 | 3300009012 | Grasslands Soil | QLTNPRAVTEPNAHLDRDIPRRSTYAKIWEEVKAA |
Ga0066710_1030607342 | 3300009012 | Grasslands Soil | LQLANPRAVTLPNAIFDRDVPRRAVYARLWDEVKAS |
Ga0066710_1048115541 | 3300009012 | Grasslands Soil | SNTHARPASQDLVRALKLKDPGALSEPHTHIDRRIPRRALYARMWEEVKAS |
Ga0099830_103718881 | 3300009088 | Vadose Zone Soil | HANTVARPSSSALLKALQLTNPRAVTLPNAYLDRDVRRRALYAKLWEEIKAS* |
Ga0099830_117924721 | 3300009088 | Vadose Zone Soil | DLLRALQLTNPRAVTEPNAHLDRDIPRRALYAKMWEQVKAS* |
Ga0099827_119336052 | 3300009090 | Vadose Zone Soil | HANTLARPSSSDLLKALQLTNPRAVTLPNAYLDRDVPRRALYAKLWEEVKAH* |
Ga0105240_126395432 | 3300009093 | Corn Rhizosphere | ANTVARPSSSDLLHALQLTNPRAVAEPNAHLDRDIPQRALYARYWEEVKAS* |
Ga0105245_112552102 | 3300009098 | Miscanthus Rhizosphere | ANTLARPSSADLARVLQIANPKAVGLPNAYLDRDIPRRAVYARMWEEVKAA* |
Ga0066709_10001751310 | 3300009137 | Grasslands Soil | LMRVLQITNPRAVTLPNAYFDRDIPRRSLYAKMWEEVKAA* |
Ga0105243_102019521 | 3300009148 | Miscanthus Rhizosphere | DLLKALRLTDPRAVTEPSAHLDRDIPRRALYARMWEEVKASG* |
Ga0105241_119018722 | 3300009174 | Corn Rhizosphere | IKARPSSSDLLRALQLTNPKAVTEPNAHLDRDIPRRAVYARKWEEVKAS* |
Ga0105242_114649851 | 3300009176 | Miscanthus Rhizosphere | PSSSDLLRALKLGNPRAVTLPNAYLDRDIPRRAVYAKMWEEVKAS* |
Ga0105238_111303021 | 3300009551 | Corn Rhizosphere | TPLMKARPKSSDLLRVLKLTNPNAVREPNAHIDRYVPRRAVYARLWEEVKAA* |
Ga0105249_106235792 | 3300009553 | Switchgrass Rhizosphere | ANTLARPASSDLLKALRLTDPRAVTEPSAHLDRDIPRRALYARMWEEVKASG* |
Ga0105249_113758882 | 3300009553 | Switchgrass Rhizosphere | SSQLLRALQLTNPKAVTLPNAYLDRDIPQRPLYAHLWEQVKASG* |
Ga0126310_104796931 | 3300010044 | Serpentine Soil | LQLGNPKAVTEPNAHLDRDIPRRAVYARMWEEVKAS* |
Ga0136218_10118171 | 3300010229 | Soil | LARPTSSDLLKVLKLTNPRAVQEPNAHIDRHIPRRSLYARLWEEVKAS* |
Ga0134082_103701112 | 3300010303 | Grasslands Soil | SDLLRALQLTNLRAVTGPNAHMDRDIPRRALYAKTWEQVKAS* |
Ga0134067_104970621 | 3300010321 | Grasslands Soil | ANTLARPSSSDLLKALRLTDPRAVTEPNAHLDRDIPRRALYARMWEEVKAS* |
Ga0134084_101523692 | 3300010322 | Grasslands Soil | MCDLLRVLRLSNPKAVTLPNAYLDRDIPRRALYAKMWEEVKAS* |
Ga0134084_102572062 | 3300010322 | Grasslands Soil | LTNTRAVTEPAAHLDRDIPRRAQYARMWEEVKASG* |
Ga0134086_104511202 | 3300010323 | Grasslands Soil | ASSDLLHALQLTNPKAVTEPNAHLDRDIPRRAVYAKVWEEVKAA* |
Ga0134071_108125451 | 3300010336 | Grasslands Soil | SALLKALQLTNPRAVTLPNAYLDRNIPNRATYAHLWEQVKAA* |
Ga0126372_117224782 | 3300010360 | Tropical Forest Soil | GHANVLARPTSSDLLRALQLTNPKAVTEPAAHLDRDIPRRAVYARAWEQVKAS* |
Ga0126372_119907921 | 3300010360 | Tropical Forest Soil | AKPSSSALLKALQLTNPKAVTLPNAYLDRNIPNRAQYAHLWEQVKAA* |
Ga0126378_125890982 | 3300010361 | Tropical Forest Soil | LQLSNPHAVGLPNAYLDRNIPQRAQYAKLWEEVKAA* |
Ga0126377_118397362 | 3300010362 | Tropical Forest Soil | SSALLKALQLTNTRAVTLPNAYLDRDIPQRQLYAHLWDQVKASG* |
Ga0126377_123203342 | 3300010362 | Tropical Forest Soil | PRQHARQASSSDLLHALKLTNPKAVTQPNAYLDRDIPRRAVYARLWEEVKAS* |
Ga0126379_114645192 | 3300010366 | Tropical Forest Soil | ALQLDNPKAVTLPNAYLDRDIPRRAVYAKAWEQVKAS* |
Ga0126379_114755472 | 3300010366 | Tropical Forest Soil | KALQLANPKAVTLPNAYLDRDIPRRALYAKMWEEVKAS* |
Ga0126379_122826491 | 3300010366 | Tropical Forest Soil | LQLTNPKAVTLPNAYLDRNIPNRAEYAHLWEQVKAA* |
Ga0134128_112645162 | 3300010373 | Terrestrial Soil | SDLLKALQLTNPRAITEPAAHLDRDIPRRAVYARMWEQVKAS* |
Ga0105239_116315881 | 3300010375 | Corn Rhizosphere | DLLRALQLTNPRAVTEPAAHLDRDIPRRAVYARAWEQVKAS* |
Ga0126381_1002570021 | 3300010376 | Tropical Forest Soil | QARPQSSALLRALQLTNPKAVTLPNAYLDRDIPQRAQYNQLWEEVKRA* |
Ga0126381_1041111282 | 3300010376 | Tropical Forest Soil | KPSSSALLKALQLTNPKAVTLPNAYLDRNIPQRELYGHLWEQVKAA* |
Ga0134126_108582272 | 3300010396 | Terrestrial Soil | LQLTNPRAVTEPAAHLDRDIPRRAVYDRAWEQVKAS* |
Ga0134122_132054222 | 3300010400 | Terrestrial Soil | VLARPESSALLKALQLTNPKAVTEPAAHLDRDIPRRAVYARMWEEVKAS* |
Ga0137391_107957252 | 3300011270 | Vadose Zone Soil | LLNALQLTNPKAVTEPNAHLDRDIPRRAVYAKAWEEVKAS* |
Ga0137393_111526021 | 3300011271 | Vadose Zone Soil | GEANTRARPKSSDLLRVLQLTNPNAVSEPNAHIDRYVPRRQVYAKLWEEVKAA* |
Ga0137432_12268611 | 3300011439 | Soil | ANTLSRPKSKDLLLALKLANPNALKEPNAHIDRYIPNRQEYAKRWREVKAS* |
Ga0120148_10405822 | 3300011999 | Permafrost | LQLANPKAVTEPNAHLDRDIPRRALYAKMWQEVKAA* |
Ga0137389_111334982 | 3300012096 | Vadose Zone Soil | SSSDLLRALQLTNPRAVTEPAAHLDRDIPRRALYAKLWEEVKAS* |
Ga0137364_103345431 | 3300012198 | Vadose Zone Soil | LARPSSSALLKALQLTNPKAVTEPAAHLDRDIPRRAVYARMWEEVKAS* |
Ga0137364_109474302 | 3300012198 | Vadose Zone Soil | ARPASSDLLKALQITNPRAVAEPNAHLDRDIPRRAVYARLWEEVKAS* |
Ga0137383_101424383 | 3300012199 | Vadose Zone Soil | SDLLRALQLTNPRAVTEPNAHLDRDIPRRALYAKMWEQVKAS* |
Ga0137382_100859901 | 3300012200 | Vadose Zone Soil | SKDLVSALKLNTPSAITEPRAHIDRDIPRRALYARMWEEVKAS* |
Ga0137382_102883321 | 3300012200 | Vadose Zone Soil | LARPSSSALLKALQLTDPKAVTEPSAHLDRDIPRRALYAKMWEEVKAS* |
Ga0137382_103895962 | 3300012200 | Vadose Zone Soil | ESDLLRALQLTNPKAVTEPNAHLDRDIPRRAVYARKWEEVKAS* |
Ga0137365_108834982 | 3300012201 | Vadose Zone Soil | MTENDPVPARPASSDLLHALRLTNPKAVTEPNAHLDRDIPRRAVYARLWEEVKAS* |
Ga0137365_110223521 | 3300012201 | Vadose Zone Soil | KDLISALKLNDPGAITEPRAHIDRDIPRRALYARMWEEVKAS* |
Ga0137362_109503101 | 3300012205 | Vadose Zone Soil | SSDLLRVLQLTNPNAVQEPNAHIDRHIPRRQLYAKLWEEVKAA* |
Ga0137380_102975013 | 3300012206 | Vadose Zone Soil | ARPSSSDLLNALKLTNPRAVTEPNAHLDRDIPRRALYAKKWEEVKAA* |
Ga0137380_109194432 | 3300012206 | Vadose Zone Soil | LQLTNPRAVTEPNAYLDRDIPRRALYAKMWEQVKAS* |
Ga0137381_111621322 | 3300012207 | Vadose Zone Soil | PQSSQLLRALQLTNPKAVTLPNAYLDRDIPRRALYAKLWEQVKAS* |
Ga0137376_1000207614 | 3300012208 | Vadose Zone Soil | NVEAKPSSSALLKALQLTNPKAVTLPNAYLDRNIPNRATYAHLWEQVKAA* |
Ga0137376_104790932 | 3300012208 | Vadose Zone Soil | LTNPRAVTLPNAYLDRDVPRRALYAKLWEEVKAS* |
Ga0137379_102158813 | 3300012209 | Vadose Zone Soil | LARPSSSDLLKALQLTNPKAVTEPSAHLDRDIPRRAVYARMWEEVKAS* |
Ga0137378_102648381 | 3300012210 | Vadose Zone Soil | ARPSSSDLLRALQLTNPRAVTEPNAYLDRDIPRRALYAKMWEQVKAS* |
Ga0137377_103025043 | 3300012211 | Vadose Zone Soil | ALQLTNPKAVTEPNAHLDRDIPRRALYARMWEEVKAS* |
Ga0137377_107707942 | 3300012211 | Vadose Zone Soil | AKPSSSQLLKALQLANPKAVTLPNAYLDRDIPQRSAYAAAWESVKR* |
Ga0137377_118405472 | 3300012211 | Vadose Zone Soil | LARPSSSALLRALQLTNPKAVTEPNAHLDRDIPRRALYARMWEEVKASG* |
Ga0137370_107964202 | 3300012285 | Vadose Zone Soil | HANTLARPASSDLLRALQLNDPRAVTEPNAHLDRDIPRRAVYAHLWEQVKAS* |
Ga0137369_111395252 | 3300012355 | Vadose Zone Soil | NRLARPKSADLLRALQLTNPKAVAEPNAHIDRHVPRRALYAKLWEEVKAS* |
Ga0137371_105675181 | 3300012356 | Vadose Zone Soil | HANTLARPSSSDLLRALQLTNPKAVTEPSAHLDRDIPRRALYARMWEEVKAS* |
Ga0137384_110865222 | 3300012357 | Vadose Zone Soil | LTNPKAVTLPNAYLDRDIPRRALYAKMWEEVKAS* |
Ga0137384_112338031 | 3300012357 | Vadose Zone Soil | LRALQLNNPRAVTEPNAHLDRDIPRRALYEKLWEEVKAS* |
Ga0137360_101772313 | 3300012361 | Vadose Zone Soil | SSSDLLRALQLTNPRAVTLPNAYLDRDVPRRALYAKLWEEVKAS* |
Ga0137361_114490101 | 3300012362 | Vadose Zone Soil | LLRALQLTNLRAVTEPNAYMDRDIPRRALYAKTWEQVKAS* |
Ga0157303_102711192 | 3300012896 | Soil | RPSSSDLLRALRLTNPRAVTEPNAHLDRDIPRRAVYARAWEQVKAS* |
Ga0157283_100065391 | 3300012907 | Soil | RALQLTNLKAVTEPNAYMDRDIPRRALYAKTWEQVKAS* |
Ga0157283_102997551 | 3300012907 | Soil | PTSSDLLRALRLTNLRAVTEPNAHLDRDIPRRAVYARMWEQVKAS* |
Ga0157306_1000081810 | 3300012912 | Soil | SSSDLLRALQLTNPKAVTEPAAHLDRDIPRRAEYARAWQQVKAS* |
Ga0137410_108317231 | 3300012944 | Vadose Zone Soil | NTVARPSSSNLLRALQLTNPRAVTEPNAYLDRDIPRRALYAKMWEQVKAS* |
Ga0164300_101730902 | 3300012951 | Soil | ARPSSSDLLRALKLGNPRAVTLPNAYLDRDIPRRAVYAKMWEEVKAS* |
Ga0164300_103798222 | 3300012951 | Soil | DLITALKLKTPGAITEPHAHIDRDIPRRALYARMWEEVKAS* |
Ga0164298_107372472 | 3300012955 | Soil | LQLTNTRAVQEPKAHIDRYIPRRREYARAWEEVKAS* |
Ga0164301_115542321 | 3300012960 | Soil | DLLKALRIANPRAVTLPNAYLDRDIPRRALYAKMWQEVKAS* |
Ga0164302_108067712 | 3300012961 | Soil | SSDLLRALQLTNLRAVTEPNAYMDRDIPRRALYAKTWEQVKAS* |
Ga0126369_126505251 | 3300012971 | Tropical Forest Soil | ASSDLLKALQLTNPKAVTEPAAHLDRDIPRRAVYARAWEQVKAS* |
Ga0126369_130382782 | 3300012971 | Tropical Forest Soil | YGHANTRARPSSSDLLHALQLTNPRAVTLPNAYLDRNIPQRELYGHLWEQVKAA* |
Ga0126369_131844942 | 3300012971 | Tropical Forest Soil | EAKPSSSALLKALQLTNPKAVTLPNAYLDRNIQQRQLYGHLWEQVKAA* |
Ga0134110_104806332 | 3300012975 | Grasslands Soil | GHSNTHAHPASQDLVRALKLKDPGALSEPHTHIDRRVPRRALYARLWEEVKAS* |
Ga0134087_106232321 | 3300012977 | Grasslands Soil | GHANLEAKPSSSALLKALQLTNPKAVTLPNAYLDRDIPNRATYAHLWEQVKAA* |
Ga0134087_106340722 | 3300012977 | Grasslands Soil | SSQLLKALQLANPKAVTLPNAYLDRDIPQRSAYAAAWESVKR* |
Ga0164309_100825951 | 3300012984 | Soil | TLARPSSSDLLRALQLTNPKAVTLPNAYLDRDVPRRAVYAKLWEEVKAS* |
Ga0164308_102947503 | 3300012985 | Soil | VLARPSSSDLLKALQLTNPKAVTEPAAHLDRDIPRRAVYAKAWEQVKAS* |
Ga0164308_117091702 | 3300012985 | Soil | EANTIARPSSSDLLKALQLTNPRAVTEPYAHLDRDIPRRALYAKMWQEVKAS* |
Ga0164304_100303774 | 3300012986 | Soil | HANTLARPSSSDLLRALQLTNPRAVTEPNAYLDRDIPRRAQYAKLWEEVKAS* |
Ga0164307_111835431 | 3300012987 | Soil | NLLARPASSDLLKALQITNPKAVTEPNAHLDRDIPRRAVYAKAWQEVKAS* |
Ga0164306_106325281 | 3300012988 | Soil | VKARPSSSDLLKALRIANPRAVTLPNAYLDRDIPRRALYAKMWQEVKAS* |
Ga0164306_114392791 | 3300012988 | Soil | ALQLTNPKAVTLPNAYLDRDIPQRPLYAHLWEQVKASG* |
Ga0164306_118365232 | 3300012988 | Soil | RARPKSSDLLKVLKLTDPNAVREPNAHIDRYVPRRAVYARLWEQVKAA* |
Ga0164305_114893581 | 3300012989 | Soil | KALQLTNPKAVTEPAAHLDRDIPRRAVYAKAWEQVKAS* |
Ga0164305_115278552 | 3300012989 | Soil | LQLTNPRAVTEPNAHLDRDIPRRAVYARMWEQVKGS* |
Ga0157370_104021353 | 3300013104 | Corn Rhizosphere | QLTNPRAVTEPNAHLDRDIPRRALYAKTWEEVKAA* |
Ga0157372_102490381 | 3300013307 | Corn Rhizosphere | TIARPASSDLLKALQLTNPRAVTEPAAHLDRDIPRRATYANLWEQVKAS* |
Ga0120179_10344633 | 3300013763 | Permafrost | NTLARPKSSDLLKVLQLTNPNAVQEPNAHIDRHIPRRQVYAKLWEEVKAA* |
Ga0120172_10920502 | 3300013765 | Permafrost | NTVARPSSSDLLRALQLTNPRAVTEPNAYLDRDIPRRALYAKMWEQVKAS* |
Ga0134081_102109811 | 3300014150 | Grasslands Soil | SDLLKALRLTDPKAVTEPSAHLDRDIPRRALYAKMWEEVKAS* |
Ga0173478_103657821 | 3300015201 | Soil | ARPTSSDLLRALRLTNLRAVTEPNAHLDRDIPRRAVYARMWEQVKAS* |
Ga0182006_11642791 | 3300015261 | Rhizosphere | LQLTNPRAVTEPAAHLDRDIPRRATYANLWEQVKAS* |
Ga0134089_103275712 | 3300015358 | Grasslands Soil | ANTVARPSSSDLLRALQLTNLRAVTEPSAYMDRDIPRRALYAKTWEQVKAS* |
Ga0132255_1036983392 | 3300015374 | Arabidopsis Rhizosphere | SSDLLHALQLTNPKAVTQPNAYLDRDIPRRAVYAKKWEEVKAS* |
Ga0182033_105076441 | 3300016319 | Soil | DLLRALQLANPRAVTLPYAYLDRDVPRRAVYAKIWDEIKAS |
Ga0182038_118229832 | 3300016445 | Soil | SSSDLLKALQLTNPRAVTQPYAYLDRNVPRRAVYAQAWDEVKAA |
Ga0134069_13067802 | 3300017654 | Grasslands Soil | QLGNPRAVTEPNAHLDRDIPRRATYAHMWEQVKAS |
Ga0134074_11513962 | 3300017657 | Grasslands Soil | SDLLRALQLNDPRAVTEPNAHLDRDIPRRAVYAHLWEQVKAS |
Ga0134083_105485891 | 3300017659 | Grasslands Soil | SDLLRALQLTNLRAVTEPSAYMDRDIPRRALYAKTWEQVKAS |
Ga0187809_100838763 | 3300017937 | Freshwater Sediment | LKALQLANPRAVTEPNAHLDRDIPRRALYARTWEQVKAS |
Ga0187823_101525491 | 3300017993 | Freshwater Sediment | ALELTNPRAVTLPNAYLDRNIPQRALYAKTWEEVKAA |
Ga0187788_102216922 | 3300018032 | Tropical Peatland | SNTLARPTSSDLLRALQLTNPKAVGWPNAYLDRDVPRRALYAKLWEEVKAA |
Ga0066667_106058541 | 3300018433 | Grasslands Soil | ARPSSSALLKALRLTDPKAVTEPAAHLDRDIPRRAVYARMWEEVKAS |
Ga0173481_108103071 | 3300019356 | Soil | TLARPASSDLLKALRLTDPRAVTEPSAHLDRDIPRRAVYARMWEEVKASG |
Ga0137408_11023362 | 3300019789 | Vadose Zone Soil | KALQLTNPKAVTEPSAHLDRDIPRRAVYARMWEEVKAS |
Ga0193701_10953452 | 3300019875 | Soil | SDLLRALQLTNPRAVTEPSAHLDRDIPRRALYAKMWEQVKAS |
Ga0193731_11468792 | 3300020001 | Soil | SDLLRALQLTNLKAVTEPAAHLDRDIPRRAVYARMWEEVKAS |
Ga0197907_102158022 | 3300020069 | Corn, Switchgrass And Miscanthus Rhizosphere | QLANPKAVTLPNAYLDRDIRQRSTYANLWEEVKRA |
Ga0179590_10562751 | 3300020140 | Vadose Zone Soil | DLLKALQLTNPKAVTLPNAYLDRDIPRRALYAKMWEEVKAS |
Ga0210382_100661611 | 3300021080 | Groundwater Sediment | SSDLLNALQLTNPRAVTEPNAHLDRDIPRRALYAKMWQEVKAA |
Ga0210382_101245082 | 3300021080 | Groundwater Sediment | LLRALQLTNPRAVTEPSAHLDRDIPRRALYAKMWEQVKAS |
Ga0193719_103819792 | 3300021344 | Soil | LLRALQLTNLKAVTEPAAHLDRDIPRRAVYARMWEEVKAS |
Ga0193750_10323521 | 3300021413 | Soil | TLARPSSSDLLRALQLTNPRAVTEPNAHLDRDIPRRALYAKMWEQVKAS |
Ga0210402_110394051 | 3300021478 | Soil | GHANVEAKPSSSALLKALQLTNPKAVTLPNAYLDRNVPRRAVYAKLWEEVKAA |
Ga0126371_110302732 | 3300021560 | Tropical Forest Soil | LQLTNPKAVTLPNAYLDRNIQQRQLYGHLWEQVKAA |
Ga0222622_107196352 | 3300022756 | Groundwater Sediment | ANTLARPTSSDLLRALRLTNLRAVTEPNAHLDRDIPRRAVYARMWEQVKAS |
Ga0247786_10009539 | 3300022883 | Soil | ARPSSSDLLRALQLTNPKAVTEPAAHLDRDIPRRAEYARAWQQVKAS |
Ga0247795_10473112 | 3300022899 | Soil | RPSSSDLLRALQLTNPKAVTEPAAHLDRDIPRRAEYARAWQQVKAS |
Ga0247686_10518652 | 3300024177 | Soil | LLKALQLTNPKAVTEPAAHLDRDIPRRAVYAKAWEQVKAS |
Ga0247693_10384932 | 3300024181 | Soil | ARPKSKDLLKALQLTNPRALLEPYSHIDRHIPRRREYARAWEEVKAS |
Ga0247676_10008261 | 3300024249 | Soil | DLLKALQLTNPKAVTEPAAHLDRDIPRRAVYAKAWEQVKAS |
Ga0179589_106154002 | 3300024288 | Vadose Zone Soil | HANTVARPSSSDLLKALQLTNPKAVTLPNAYLDRDIPRRALYAKMWEEVKAS |
Ga0207696_11551262 | 3300025711 | Switchgrass Rhizosphere | SDLLKALQLTNPKAVTEPYAHLDRDIPRRATYARLWEEVKAS |
Ga0207680_107307822 | 3300025903 | Switchgrass Rhizosphere | LQLTNPRAVTEPYAHLDRDIPRRATYARLWEEVKAS |
Ga0207707_115274872 | 3300025912 | Corn Rhizosphere | LLKALQLTNPRAVTEPAAHLDRDIPRRATYANLWEQVKAS |
Ga0207671_101397173 | 3300025914 | Corn Rhizosphere | HANTKARPTSSDLLRALQLTNPKAVTEPNAHLDRDIPRRAVYARKWEEVKAS |
Ga0207663_103707763 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | SDLLKALRLTDPRAVTEPSAHLDRDIPRRALYARMWEEVKASG |
Ga0207660_106236761 | 3300025917 | Corn Rhizosphere | RPSSSQLLRALQLTNPKAVTLPNAYLDRDIPQRPLYAHLWEQVKASG |
Ga0207652_107255311 | 3300025921 | Corn Rhizosphere | QLTNPKAVTEPNAHLDRDIPRRAVYARKWEEVKAS |
Ga0207652_115043161 | 3300025921 | Corn Rhizosphere | KPSSSQLLKALQLANPKAVTLPNAYLDRDIRQRSTYANLWEEVKRA |
Ga0207694_118890441 | 3300025924 | Corn Rhizosphere | ALQLTNPRAVTEPYAHLDRDIPRRALYAKTWEEVKAA |
Ga0207700_119455901 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | LLKVLQLSNPHAVGLPNAYTDRDVPRRAVYAHLWDEVKAA |
Ga0207664_109314522 | 3300025929 | Agricultural Soil | SADLARVLQISNPKAVGLPNAYLDRDIPRRALYARMWEEVKAA |
Ga0207664_111393952 | 3300025929 | Agricultural Soil | KPSSSDLLKVLQLSNPHAVGLPNAYTDRDVPRRAVYAHLWDEVKAA |
Ga0207665_114543231 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | DLLHALRLTNPRAVTEPNAHLDRDIPRRAVYARLWEEVKAS |
Ga0207711_112654832 | 3300025941 | Switchgrass Rhizosphere | TKARPTSSDLLRALQLTNPKAVTEPNAHLDRDIPRRAVYARKWEEVKAS |
Ga0207679_121538552 | 3300025945 | Corn Rhizosphere | HANIKARPSSSDLLRALQLTNPKAVTEPNAHLDRDIPRRAVYARKWEEVKAS |
Ga0207712_111931112 | 3300025961 | Switchgrass Rhizosphere | QLTNPKAVTLPNAYLDRDIPQRPLYAHLWEQVKASG |
Ga0207708_119377302 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | SNTLARPTSKDLLTALKLASPSSIREPNAHIDRYIPRRREYARAWEEVKAS |
Ga0207702_105977731 | 3300026078 | Corn Rhizosphere | NTIARPASSDLLKALQLTNPRAVTEPAAHLDRDIPRRATYANLWEQVKAS |
Ga0207702_119139951 | 3300026078 | Corn Rhizosphere | ASSDLLHALQLTNPRAVTLPNAYLDRDIPRRANYARAWEEVKAS |
Ga0207683_103818461 | 3300026121 | Miscanthus Rhizosphere | ARPKSKDLLKALDLTNPRALLEPRAHIDRYIPRRREYARAWEEVKAS |
Ga0209688_10723592 | 3300026305 | Soil | RPSSSALLKALQLNNPKAVTEPEAHLDRDIPRRSTYARLWEEVKAS |
Ga0209687_12737802 | 3300026322 | Soil | ALLKALQLTNPKAVTEPAAHLDRDIPRRAVYARMWEEVKAS |
Ga0209801_12435042 | 3300026326 | Soil | NTLARPSSSDLLRALQLDNPRAVTLPNAIFDRDVPRRALYAKLWDEVKAS |
Ga0209375_10849421 | 3300026329 | Soil | LARPASSDLLRALQLNDPRAVTEPNAHLDRDIPRRAVYAHLWEQVKAS |
Ga0209473_11958051 | 3300026330 | Soil | NTLARPSSSDLLNALQLSNPRAVAEPNAHLDRDIPRRALYAKMWQEVKAA |
Ga0209059_11256122 | 3300026527 | Soil | RPASSDLLHALQLTNPKAVTEPNAHLDRDIPRRAVYAKVWEEVKAA |
Ga0209807_10606351 | 3300026530 | Soil | HAHPASQDLVRALKLKDPGALSEPHTHIDRRVPRRALYARLWEEVKAS |
Ga0209160_12471181 | 3300026532 | Soil | RALQLTNPKAVTEPNAHLDRDIPRRALYARMWEEVKAS |
Ga0209474_1001070212 | 3300026550 | Soil | KLTNPRAVTEPNAHLDRDIPRRAVYAKMWEEVKASG |
Ga0209474_102899271 | 3300026550 | Soil | NTVARPSSSDLLKALKLTNPRAVTEPNAHLDRDIPRRAVYARMWEEVKAS |
Ga0209842_10579401 | 3300027379 | Groundwater Sand | LLRALQLTNPNALREPNAHIDRYIPNRQEYAKRWQEVKAAG |
Ga0209283_105472701 | 3300027875 | Vadose Zone Soil | KSSDLLRVLQLSNPNAVKEPNAHIDRYVPRRQVYARLWEQVKAA |
Ga0209590_100889001 | 3300027882 | Vadose Zone Soil | DLLRALQLTNPRAVTEPNAHLDRDIPRRSTYAKIWEEVKAA |
Ga0209590_104955421 | 3300027882 | Vadose Zone Soil | NTLARPSSSDLLHALRLTNPRAVTEPSAHLDRDIPRRAVYARKWQEVKAS |
Ga0209590_109801651 | 3300027882 | Vadose Zone Soil | DLLKALQLTNPRAVTLPNAYLDRDVPRRALYAKLWEEVKAH |
Ga0209583_100585341 | 3300027910 | Watersheds | VHALQLNNPKAVGLPNAYLDRDIPQRALYAKLWEQVKAS |
Ga0247662_10294431 | 3300028293 | Soil | NTLARPASKDLLTALKLTNPRAIQEPNAHIDRYIPRRREYAKAWEEVKAS |
Ga0307293_101976031 | 3300028711 | Soil | TKARPASSDLLKVLKLTDPNAVREPKAHIDRYMPRRAVYARLWQEVKAS |
Ga0307277_103080271 | 3300028881 | Soil | LLKALQLTNPKAVTEPAAHLDRDIPRRAVYARMWEQVKASG |
Ga0307308_102105892 | 3300028884 | Soil | NTLARPSSSDLLRALRLTNPRAVTEPSAHLDRDIPRRAVYARMWEEVKAS |
Ga0307308_105133391 | 3300028884 | Soil | HANTLARPSSSDLLRALQLTNPKAVTEPAAHLDRDIPRRAVYARMWEEVKAS |
Ga0318541_104717791 | 3300031545 | Soil | SSSDLLRALQLTNPHAVGLPNAYLDRDVPRRAVYAKLWEEVKAA |
Ga0306917_107909022 | 3300031719 | Soil | HANLLARPSSSDLLRALQLANPRAVTLPYAYLDRDVPRRAVYAKIWDEIKAS |
Ga0318502_107767112 | 3300031747 | Soil | LQLTNPHAVGLPNAYLDRDVPRRAVYAKLWEEVKAA |
Ga0318494_105176941 | 3300031751 | Soil | HANLLARPSSSDLLKALQLTNPRAVTLPYAYFDRNVPRRAVYAKAWDEVKAA |
Ga0307475_108448661 | 3300031754 | Hardwood Forest Soil | KPASSDLLKALQLTNPHAVALPYAYLDRNVPRRAVYAKAWDEVKAA |
Ga0307475_115858292 | 3300031754 | Hardwood Forest Soil | LLRALDLTNPKAVTLPNAYLDRDVPRRALYAKLWEEVKAS |
Ga0318535_103416032 | 3300031764 | Soil | RVLELTNPRAVTLPNAYLDRDVPQRALYAKMWEEVKAA |
Ga0318554_104860721 | 3300031765 | Soil | SSSDLLRALQLTNPKAVTQPNAYLDRDVPRRAVYAKLWEEVKAA |
Ga0318521_107594492 | 3300031770 | Soil | LQLTNPRAVTLPNAYLDRDVPRRALYAKLWEEVKAA |
Ga0318566_102909371 | 3300031779 | Soil | SSDLLRVLELTNPRAVTLPNAYLDRDVPQRALYAKMWEEVKAA |
Ga0318552_103518301 | 3300031782 | Soil | ANTLARPSSSDLLTALQLTNPRAVTLPNAYLDRDIPRRALYAKMWEEVKAS |
Ga0307473_110178862 | 3300031820 | Hardwood Forest Soil | ANVKARPSSSDLLKALQLTNPRAVTEPAAHLDRDIPRRAVYARAWEQVKAS |
Ga0318499_102039322 | 3300031832 | Soil | LARPSSSDLLRALQLNNPRAVTLPNAYLDRDVPRRALYAKLWEEVKAS |
Ga0310884_109218592 | 3300031944 | Soil | RALQLTNPKAVTEPAAHLDRDIPRRAEYARAWQQVKAS |
Ga0318549_102883012 | 3300032041 | Soil | QLTNPRAVTLPNAYLDRDIPRRALYAKMWEEVKAS |
Ga0318558_103669971 | 3300032044 | Soil | ELTNPRAVTLPNAYLDRDVPQRALYAKMWEEVKAA |
Ga0318553_105446221 | 3300032068 | Soil | ASLDTLRLLQLTNPRAILLPNAYLDRDIPRRALYAKLWEEVKAS |
Ga0310890_107912572 | 3300032075 | Soil | SDLLRALQLTNPKAVTEPAAHLDRDIPRRAEYARAWQQVKAS |
Ga0318577_105923912 | 3300032091 | Soil | SNTLARPSSSDLLRVLDLANPRAVTLPNAYLDRDVPRRALYAQLWEQVKAA |
Ga0335085_103516023 | 3300032770 | Soil | ARPTSTDLVHALQLNNPKAVGLPNAYLDRDIPQRALYAKLWEEVKAS |
Ga0335084_103661151 | 3300033004 | Soil | NTKARPTSADLVKALQLNNPKAVDLPNAYLDRDIPQRALYAKMWEEVKAS |
Ga0335077_119128922 | 3300033158 | Soil | ALQLTNPKAVGWPNAYLDRDVPRRALYAKLWEEVKAA |
Ga0316620_110957571 | 3300033480 | Soil | RPSSSDLLKALQITNPKAVTEPNAHLDRDIPRRALYAKLWEEVKAS |
Ga0247829_116971381 | 3300033550 | Soil | PSSSDLLRALQLTNPRAVTAPYAILDRDIPRRAVYARAWEQVKAS |
⦗Top⦘ |